9eeb

Tubulin cofactors D,E,G bound to tubulin dimer

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein PAC2

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	GTP-binding protein CIN4 × 1 （P39110） Tubulin beta chain × 1 （P02554） DESIGNED ANKYRIN REPEAT PROTEIN -- DARPin × 1 Chromosome instability protein 1 × 1 （P40987） Tubulin alpha-1A chain × 1 （P02550） GUANOSINE-5'-TRIPHOSPHATE × 2 GUANOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PAC2_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain E； PDBConstruct 252–347； UniProt 423–518

GTP-binding protein CIN4

Saccharomyces cerevisiae

UniProt P39110

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Protein PAC2 × 1 （P39937） Tubulin beta chain × 1 （P02554） DESIGNED ANKYRIN REPEAT PROTEIN -- DARPin × 1 Chromosome instability protein 1 × 1 （P40987） Tubulin alpha-1A chain × 1 （P02550） GUANOSINE-5'-TRIPHOSPHATE × 2 GUANOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CIN4_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain G； PDBConstruct 1–191； UniProt 1–191

Tubulin beta chain

OrganismNot specified

UniProt P02554

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Protein PAC2 × 1 （P39937） GTP-binding protein CIN4 × 1 （P39110） DESIGNED ANKYRIN REPEAT PROTEIN -- DARPin × 1 Chromosome instability protein 1 × 1 （P40987） Tubulin alpha-1A chain × 1 （P02550） GUANOSINE-5'-TRIPHOSPHATE × 2 GUANOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBB_PIG
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain B； PDBConstruct 1–445； UniProt 1–445

Chromosome instability protein 1

Saccharomyces cerevisiae

UniProt P40987

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Protein PAC2 × 1 （P39937） GTP-binding protein CIN4 × 1 （P39110） Tubulin beta chain × 1 （P02554） DESIGNED ANKYRIN REPEAT PROTEIN -- DARPin × 1 Tubulin alpha-1A chain × 1 （P02550） GUANOSINE-5'-TRIPHOSPHATE × 2 GUANOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CIN1_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain D； PDBConstruct 8–1020； UniProt 2–1014

Tubulin alpha-1A chain

OrganismNot specified

UniProt P02550

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Protein PAC2 × 1 （P39937） GTP-binding protein CIN4 × 1 （P39110） Tubulin beta chain × 1 （P02554） DESIGNED ANKYRIN REPEAT PROTEIN -- DARPin × 1 Chromosome instability protein 1 × 1 （P40987） GUANOSINE-5'-TRIPHOSPHATE × 2 GUANOSINE-5'-DIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBA1A_PIG
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain A； PDBConstruct 1–451； UniProt 1–451

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9eeb
Deposition date deposition_date	2024-11-18
Structure title title	Tubulin cofactors D,E,G bound to tubulin dimer
Keywords keywords	Tubulin, Tubulin cofactors, Tubulin biogenesis, Tubulin degradation, microtubules, CYTOSOLIC PROTEIN; CYTOSOLIC PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9eeb__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9eeb__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9eeb__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	47.38 Å
Rg (electron density)	47.57 Å
Total Rg	47.70 Å
Atom count	12555
Residues	2510
Excluded volume	201720 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9eeb__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Protein PAC2
Molecular weight formula_weight	32342.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E
Atom count atom_count	12555

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLVLKIKIRAGKKPSSDLDYWVLPSFTVRYVKSVICRKLNFDILNVKLFHENSEGMINEIKYNFRPISDFNVVNGDIIHVSSPVNNKSIQKVNSPS

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	GTP-binding protein CIN4
Molecular weight formula_weight	22096.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MGLLSIIRKQKLRDKEIRCLILGLDNSGKSTIVNKLLPKDEQNNDGIMPTVGFQIHSLMIKDVTISLWDIGGQRTLRPFWDNYFDKTQAMIWCIDVSLSMRFDETLQELKELINRDENRIGYECAVIVVLNKIDLVEDKSELHRRCLLVESELKCLFKPDIRIELVKCSGVTGEGIDNLRDRLVESCHFTQ

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Tubulin beta chain
Molecular weight formula_weight	49907.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEGEEDEA

Entity 4 Entity 4 polymer

Description description	DESIGNED ANKYRIN REPEAT PROTEIN -- DARPin
Molecular weight formula_weight	17955.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MRGSHHHHHHGSDLGKKLLEAARAGQDDEVRVLMANGADVNATDASGLTPLHLAATYGHLEIVEVLLKHGADVSASDLMGSTPLHLAALIGHLEIVEVLLKHGADVNAVDTWGDTPLRLAAVMGHLKIVEALLKHGADVNAQDKFGKTAYDTSIDNGSEDLAEILQKLN

Source Source

Source organism organism	Saccharomyces cerevisiae
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	Chromosome instability protein 1
Molecular weight formula_weight	117608.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MHHHHHHNNIRALLDSIQSGVQTVSPEKHQQTIAAINKFQDDPALLDTILPRCVPLLTKSFFCMSQRDQKLVAELFYNLDKISHSKVLKSLDTSIFRLNEILNYLQDRASPSSFSDVLCVYLNLSWLSVILLSPYAFKDKFNKTLQVSSRFENYPICIPPINKIKAVLYFKNFTDAFDQLPEREQANVPFLNQFLKLFIQSSEKANYYFSNENLRHLQQVALSNDGIKLLPKLFQISFNHGSHDILDAIVEFFHDHLSSNSTDTRFQLAHSFAKIAKFLHQADPASFIELIDYTIENTVSLLQAPCDSIDSNELHTSLLIIAEVALAKILPIDLVDRVLTLIIPKTCHFQKSHFQIIKGHHIRDSTNFIIWSVIRSNRSNSLSPQVLQSLLSHLLINAFFDPELIIRYSSFAALQELLGRSNKSLALNQNDIALILQANWKDLPRSFEENSGLIRRLFNPENTSKSAVCVWKVFRDWSFNWNLLENLHLTTMKLNIDYNLVPLIKSKLSSPALLQEVLNKAGSSVTQNCQILYLYLKLFENDVNCPKISEICIDIYQKKIKFQLTTQAKRQFNDNSPELFQIFVILKYWQLTGQNDFNQELFWKFVDIVSPQKKLNLYNEFIPIIQQIISQCVSLNYTRIVQLIKSDNELTCRSICHMPDQEKMCSLFFSQFPLLSPQSRSLLIGELDHHWDVRISLLPSNSYRKFRNIIINCLDDYTITQQGDVGRLVRIQALKLMQSHPDFLSGDCDSINPKLTRLLAEPVPEIRKLSYQLLASATSQITVLSDSSILNFRHKQGLSEEFWKGYAVSAGAIHFTDSQLTSSIDSFIVYYRSLSPSQQLELCHDLIRIIPSAKQIAESRIRDRNKDPLTGGMRFDTIKFTIHCVKFWTRIMESGLVVLHPNFNFQGVFAKFYNLHLLDCTTLRVSVIKFFPFLAISCYHTMRENADQKNLSNIILKRLLVLVKREYAATKSKFMTDQNVALQGMFQIFLELGVTRQLQALQVACQKHELANILESDITL

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 6 Entity 6 polymer

Description description	Tubulin alpha-1A chain
Molecular weight formula_weight	50121.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRAHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY

Entity 7 Entity 7 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 8 Entity 8 non-polymer

Description description	GUANOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	443.2 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.70 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	275487

Tubulin cofactors D,E,G bound to tubulin dimer

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein PAC2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

GTP-binding protein CIN4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tubulin beta chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chromosome instability protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tubulin alpha-1A chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9eeb__assembly_1__model_1

9eeb__assembly_1__model_1 | I(q)

9eeb__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

7. Citations (1)