← Back to search

9q3t

Crystal Structure of WT HIV-1 Protease (NL4-3) with Inhibitor NR03-92

Method: X-RAY DIFFRACTION D_max: 59.1 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9q3t
deposition_date	2025-08-19
title	Crystal Structure of WT HIV-1 Protease (NL4-3) with Inhibitor NR03-92
keywords	HIV-1 Protease, wild-type HIV-1 Protease, Protease-Inhibitor complex, VIRAL PROTEIN, HYDROLASE-INHIBITOR complex; VIRAL PROTEIN, HYDROLASE/INHIBITOR
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	18.02 Å
rg_electron	17.08 Å
i0	7816340.00
molecular_weight	21893.0 kDa
excluded_volume	28021 Å³
envelope_volume	30781 Å³
shell_volume	15487 Å³
envelope_diameter	57.0 Å
shell_rg	22.70 Å
envelope_rg	17.35 Å
shape_rg	17.08 Å
total_rg	18.05 Å
total_atoms	3134
n_residues	198
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	59.1 Å
rg_real	17.98 Å
rg_real_error	0.39 Å
i0_real	7.8160e+06
i0_real_error	9.8520e+04
rg_reciprocal	17.98 Å
i0_reciprocal	7816000.0000
total_estimate	0.8783
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	20.8 Å
skewness	0.326
kurtosis	-0.275
angular_range	— – 0.4400 Å⁻¹
current_alpha	0.0000
highest_alpha	2995000.0000
n_real_points	75
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.819; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 1.000; Smooth: 0.958

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (4)

Entity 1 polymer

description	Protease
formula_weight	10831.8 kDa
ec_number	3.4.23.16
src_method	man
entity_count	2

Polymer

type	polypeptide(L)
strand_id	A,B
atom_count	3333

PQITLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

Source

organism	Human immunodeficiency virus 1
ncbi_taxonomy_id	11676
host_organism	;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ;

Entity 2 non-polymer

description	SULFATE ION
formula_weight	96.1 kDa
src_method	syn
entity_count	1

Entity 3 non-polymer

description	;(3R,3aS,6aR)-hexahydrofuro[2,3-b]furan-3-yl [(2S,3R)-3-hydroxy-4-{[(1R)-1-hydroxy-2,3-dihydro-1H-indene-5-sulfonyl](2-methylpropyl)amino}-1-phenylbutan-2-yl]carbamate ;
formula_weight	588.7 kDa
src_method	syn
entity_count	1

Entity 4 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	134

▶

6. Citations (1)

▶

length_a	62.308 Å
length_b	62.308 Å
length_c	82.176 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	120.00 °
z_pdb	12

space_group	P 61
int_tables_number	169
crystal_system	hexagonal

resolution	1.870 Å
resolution_low	19.800 Å
r_factor	0.2080
r_work	0.2001
r_free	0.2462

fit	/app/data/saxs_computation/q3/9q3t/9q3t.fit
pddf	/app/data/pr_computation/q3/9q3t/9q3t.pr.out
profile	/app/data/saxs_computation/q3/9q3t/9q3t.dat

Crystal Structure of WT HIV-1 Protease (NL4-3) with Inhibitor NR03-92

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction