← Back to search

9rff

Crystal Structure of Human Rac1 Fused with the Scaffold Protein POSH (residues 319-371)

Method: X-RAY DIFFRACTION D_max: 60.0 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9rff
deposition_date	2025-06-04
title	Crystal Structure of Human Rac1 Fused with the Scaffold Protein POSH (residues 319-371)
keywords	GTPase GTP/GDP-Binding Nucleotide binding, HYDROLASE; HYDROLASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	17.91 Å
rg_electron	16.94 Å
i0	11027800.00
molecular_weight	24828.0 kDa
excluded_volume	31176 Å³
envelope_volume	35072 Å³
shell_volume	17228 Å³
envelope_diameter	62.2 Å
shell_rg	23.31 Å
envelope_rg	17.44 Å
shape_rg	16.92 Å
total_rg	18.00 Å
total_atoms	1738
n_residues	220
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	60.0 Å
rg_real	17.80 Å
rg_real_error	0.46 Å
i0_real	1.1030e+07
i0_real_error	1.3840e+05
rg_reciprocal	17.81 Å
i0_reciprocal	11030000.0000
total_estimate	0.7916
solution_quality	GOOD a GOOD solution
n_peaks	3
r_peak_primary	23.5 Å
skewness	0.199
kurtosis	-0.264
angular_range	— – 0.4450 Å⁻¹
current_alpha	0.0000
highest_alpha	2167000.0000
n_real_points	75
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.763; Stabil: 0.999; Sysdev: 1.000; Positv: 1.000; Valcen: 0.998; Smooth: 0.000

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (5)

Entity 1 polymer

description	Ras-related C3 botulinum toxin substrate 1,E3 ubiquitin-protein ligase SH3RF1
formula_weight	25569.4 kDa
ec_number	3.6.5.2,2.3.2.27
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	1958

GRRMQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLQNRHSMEISPPVLISSSNPTAAARISELSGLSCSAPSQVHISTTGLIVTPPPS

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Escherichia coli

Entity 2 non-polymer

description	PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
formula_weight	522.2 kDa
src_method	syn
entity_count	1

Entity 3 non-polymer

description	MAGNESIUM ION
formula_weight	24.3 kDa
src_method	syn
entity_count	1

Entity 4 non-polymer

description	(4S)-2-METHYL-2,4-PENTANEDIOL
formula_weight	118.2 kDa
src_method	syn
entity_count	1

Entity 5 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	193

▶

6. Citations (1)

▶

length_a	39.222 Å
length_b	73.082 Å
length_c	73.283 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	4

space_group	P 21 21 21
int_tables_number	19
crystal_system	—

resolution	1.248 Å
resolution_low	51.748 Å
r_factor	—
r_work	0.1338
r_free	0.1640

fit	/app/data/saxs_computation/rf/9rff/9rff.fit
pddf	/app/data/pr_computation/rf/9rff/9rff.pr.out
profile	/app/data/saxs_computation/rf/9rff/9rff.dat