9v10

Cryo-EM structure of the 48-nm repeat doublet microtubule from mouse sperm

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cilia- and flagella-associated protein 95

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA95_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 0； PDBConstruct 1–228； UniProt 1–228 Author chain 7； PDBConstruct 1–228； UniProt 1–228

EF-hand domain-containing family member B

OrganismNot specified

UniProt Q8CDU5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EFHB_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 1； PDBConstruct 1–853； UniProt 1–853 Author chain 2； PDBConstruct 1–853； UniProt 1–853

Cilia- and flagella-associated protein 53

OrganismNot specified

UniProt Q9D439

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA53_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 3； PDBConstruct 1–514； UniProt 1–514 Author chain 4； PDBConstruct 1–514； UniProt 1–514

Nucleoside diphosphate kinase homolog 7

OrganismNot specified

UniProt Q9QXL8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDK7_MOUSE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 5； PDBConstruct 1–395； UniProt 1–395 Author chain 6； PDBConstruct 1–395； UniProt 1–395 Author chain j1； PDBConstruct 1–395； UniProt 1–395

Cilia- and flagella-associated protein 107

OrganismNot specified

UniProt Q4KKZ1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CF107_MOUSE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 8； PDBConstruct 1–196； UniProt 1–196

Cilia- and flagella-associated protein 141

OrganismNot specified

UniProt Q9D9D9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CP141_MOUSE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain A； PDBConstruct 1–101； UniProt 1–101 Author chain N1； PDBConstruct 1–101； UniProt 1–101

Tektin-1

OrganismNot specified

UniProt Q9DAJ2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT1_MOUSE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain A0； PDBConstruct 1–418； UniProt 1–418 Author chain A1； PDBConstruct 1–418； UniProt 1–418 Author chain A2； PDBConstruct 1–418； UniProt 1–418 Author chain A3； PDBConstruct 1–418； UniProt 1–418 Author chain A4； PDBConstruct 1–418； UniProt 1–418 Author chain A5； PDBConstruct 1–418； UniProt 1–418

Tubulin alpha-3 chain

OrganismNot specified

UniProt P05214

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBA3_MOUSE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain AA； PDBConstruct 1–450； UniProt 1–450 Author chain AC； PDBConstruct 1–450； UniProt 1–450 Author chain AE； PDBConstruct 1–450； UniProt 1–450 Author chain AG； PDBConstruct 1–450； UniProt 1–450 Author chain AI； PDBConstruct 1–450； UniProt 1–450 Author chain AK； PDBConstruct 1–450； UniProt 1–450 Author chain AM； PDBConstruct 1–450； UniProt 1–450 Author chain AO； PDBConstruct 1–450； UniProt 1–450 Author chain BC； PDBConstruct 1–450； UniProt 1–450 Author chain BE； PDBConstruct 1–450； UniProt 1–450 Author chain BG； PDBConstruct 1–450； UniProt 1–450 Author chain BI； PDBConstruct 1–450； UniProt 1–450 Author chain BK； PDBConstruct 1–450； UniProt 1–450 Author chain BM； PDBConstruct 1–450； UniProt 1–450 Author chain BO； PDBConstruct 1–450； UniProt 1–450 Author chain CC； PDBConstruct 1–450； UniProt 1–450 Author chain CE； PDBConstruct 1–450； UniProt 1–450 Author chain CG； PDBConstruct 1–450； UniProt 1–450 Author chain CI； PDBConstruct 1–450； UniProt 1–450 Author chain CK； PDBConstruct 1–450； UniProt 1–450 Author chain CM； PDBConstruct 1–450； UniProt 1–450 Author chain CO； PDBConstruct 1–450； UniProt 1–450 Author chain DC； PDBConstruct 1–450； UniProt 1–450 Author chain DE； PDBConstruct 1–450； UniProt 1–450 Author chain DG； PDBConstruct 1–450； UniProt 1–450 Author chain DI； PDBConstruct 1–450； UniProt 1–450 Author chain DK； PDBConstruct 1–450； UniProt 1–450 Author chain DM； PDBConstruct 1–450； UniProt 1–450 Author chain DO； PDBConstruct 1–450； UniProt 1–450 Author chain EA； PDBConstruct 1–450； UniProt 1–450 Author chain EC； PDBConstruct 1–450； UniProt 1–450 Author chain EE； PDBConstruct 1–450； UniProt 1–450 Author chain EG； PDBConstruct 1–450； UniProt 1–450 Author chain EI； PDBConstruct 1–450； UniProt 1–450 Author chain EK； PDBConstruct 1–450； UniProt 1–450 Author chain EM； PDBConstruct 1–450； UniProt 1–450 Author chain FC； PDBConstruct 1–450； UniProt 1–450 Author chain FE； PDBConstruct 1–450； UniProt 1–450 Author chain FG； PDBConstruct 1–450； UniProt 1–450 Author chain FI； PDBConstruct 1–450； UniProt 1–450 Author chain FK； PDBConstruct 1–450； UniProt 1–450 Author chain FM； PDBConstruct 1–450； UniProt 1–450 Author chain GC； PDBConstruct 1–450； UniProt 1–450 Author chain GE； PDBConstruct 1–450； UniProt 1–450 Author chain GG； PDBConstruct 1–450； UniProt 1–450 Author chain GI； PDBConstruct 1–450； UniProt 1–450 Author chain GK； PDBConstruct 1–450； UniProt 1–450 Author chain GM； PDBConstruct 1–450； UniProt 1–450 Author chain GO； PDBConstruct 1–450； UniProt 1–450 Author chain HC； PDBConstruct 1–450； UniProt 1–450 Author chain HE； PDBConstruct 1–450； UniProt 1–450 Author chain HG； PDBConstruct 1–450； UniProt 1–450 Author chain HI； PDBConstruct 1–450； UniProt 1–450 Author chain HK； PDBConstruct 1–450； UniProt 1–450 Author chain HM； PDBConstruct 1–450； UniProt 1–450 Author chain HO； PDBConstruct 1–450； UniProt 1–450 Author chain IC； PDBConstruct 1–450； UniProt 1–450 Author chain IE； PDBConstruct 1–450； UniProt 1–450 Author chain IG； PDBConstruct 1–450； UniProt 1–450 Author chain II； PDBConstruct 1–450； UniProt 1–450 Author chain IK； PDBConstruct 1–450； UniProt 1–450 Author chain IM； PDBConstruct 1–450； UniProt 1–450 Author chain IO； PDBConstruct 1–450； UniProt 1–450 Author chain JC； PDBConstruct 1–450； UniProt 1–450 Author chain JE； PDBConstruct 1–450； UniProt 1–450 Author chain JG； PDBConstruct 1–450； UniProt 1–450 Author chain JI； PDBConstruct 1–450； UniProt 1–450 Author chain JK； PDBConstruct 1–450； UniProt 1–450 Author chain JM； PDBConstruct 1–450； UniProt 1–450 Author chain JO； PDBConstruct 1–450； UniProt 1–450 Author chain JQ； PDBConstruct 1–450； UniProt 1–450 Author chain KA； PDBConstruct 1–450； UniProt 1–450 Author chain KC； PDBConstruct 1–450； UniProt 1–450 Author chain KE； PDBConstruct 1–450； UniProt 1–450 Author chain KG； PDBConstruct 1–450； UniProt 1–450 Author chain KI； PDBConstruct 1–450； UniProt 1–450 Author chain KK； PDBConstruct 1–450； UniProt 1–450 Author chain KM； PDBConstruct 1–450； UniProt 1–450 Author chain KO； PDBConstruct 1–450； UniProt 1–450 Author chain LA； PDBConstruct 1–450； UniProt 1–450 Author chain LC； PDBConstruct 1–450； UniProt 1–450 Author chain LE； PDBConstruct 1–450； UniProt 1–450 Author chain LG； PDBConstruct 1–450； UniProt 1–450 Author chain LI； PDBConstruct 1–450； UniProt 1–450 Author chain LK； PDBConstruct 1–450； UniProt 1–450 Author chain LM； PDBConstruct 1–450； UniProt 1–450 Author chain LO； PDBConstruct 1–450； UniProt 1–450 Author chain MA； PDBConstruct 1–450； UniProt 1–450 Author chain MC； PDBConstruct 1–450； UniProt 1–450 Author chain ME； PDBConstruct 1–450； UniProt 1–450 Author chain MG； PDBConstruct 1–450； UniProt 1–450 Author chain MI； PDBConstruct 1–450； UniProt 1–450 Author chain MK； PDBConstruct 1–450； UniProt 1–450 Author chain MM； PDBConstruct 1–450； UniProt 1–450 Author chain MO； PDBConstruct 1–450； UniProt 1–450 Author chain NA； PDBConstruct 1–450； UniProt 1–450 Author chain NC； PDBConstruct 1–450； UniProt 1–450 Author chain NE； PDBConstruct 1–450； UniProt 1–450 Author chain NG； PDBConstruct 1–450； UniProt 1–450 Author chain NI； PDBConstruct 1–450； UniProt 1–450 Author chain NK； PDBConstruct 1–450； UniProt 1–450 Author chain NM； PDBConstruct 1–450； UniProt 1–450 Author chain NO； PDBConstruct 1–450； UniProt 1–450 Author chain OC； PDBConstruct 1–450； UniProt 1–450 Author chain OE； PDBConstruct 1–450； UniProt 1–450 Author chain OG； PDBConstruct 1–450； UniProt 1–450 Author chain OI； PDBConstruct 1–450； UniProt 1–450 Author chain OK； PDBConstruct 1–450； UniProt 1–450 Author chain OM； PDBConstruct 1–450； UniProt 1–450 Author chain OO； PDBConstruct 1–450； UniProt 1–450 Author chain PC； PDBConstruct 1–450； UniProt 1–450 Author chain PE； PDBConstruct 1–450； UniProt 1–450 Author chain PG； PDBConstruct 1–450； UniProt 1–450 Author chain PI； PDBConstruct 1–450； UniProt 1–450 Author chain PK； PDBConstruct 1–450； UniProt 1–450 Author chain PM； PDBConstruct 1–450； UniProt 1–450 Author chain PO； PDBConstruct 1–450； UniProt 1–450 Author chain QC； PDBConstruct 1–450； UniProt 1–450 Author chain QE； PDBConstruct 1–450； UniProt 1–450 Author chain QG； PDBConstruct 1–450； UniProt 1–450 Author chain QI； PDBConstruct 1–450； UniProt 1–450 Author chain QK； PDBConstruct 1–450； UniProt 1–450 Author chain QM； PDBConstruct 1–450； UniProt 1–450 Author chain QO； PDBConstruct 1–450； UniProt 1–450 Author chain RC； PDBConstruct 1–450； UniProt 1–450 Author chain RE； PDBConstruct 1–450； UniProt 1–450 Author chain RG； PDBConstruct 1–450； UniProt 1–450 Author chain RI； PDBConstruct 1–450； UniProt 1–450 Author chain RK； PDBConstruct 1–450； UniProt 1–450 Author chain RM； PDBConstruct 1–450； UniProt 1–450 Author chain RO； PDBConstruct 1–450； UniProt 1–450 Author chain SA； PDBConstruct 1–450； UniProt 1–450 Author chain SC； PDBConstruct 1–450； UniProt 1–450 Author chain SE； PDBConstruct 1–450； UniProt 1–450 Author chain SG； PDBConstruct 1–450； UniProt 1–450 Author chain SI； PDBConstruct 1–450； UniProt 1–450 Author chain SK； PDBConstruct 1–450； UniProt 1–450 Author chain SM； PDBConstruct 1–450； UniProt 1–450 Author chain TA； PDBConstruct 1–450； UniProt 1–450 Author chain TC； PDBConstruct 1–450； UniProt 1–450 Author chain TE； PDBConstruct 1–450； UniProt 1–450 Author chain TG； PDBConstruct 1–450； UniProt 1–450 Author chain TI； PDBConstruct 1–450； UniProt 1–450 Author chain TK； PDBConstruct 1–450； UniProt 1–450 Author chain TM； PDBConstruct 1–450； UniProt 1–450 Author chain UA； PDBConstruct 1–450； UniProt 1–450 Author chain UC； PDBConstruct 1–450； UniProt 1–450 Author chain UE； PDBConstruct 1–450； UniProt 1–450 Author chain UG； PDBConstruct 1–450； UniProt 1–450 Author chain UI； PDBConstruct 1–450； UniProt 1–450 Author chain UK； PDBConstruct 1–450； UniProt 1–450 Author chain UM； PDBConstruct 1–450； UniProt 1–450 Author chain VA； PDBConstruct 1–450； UniProt 1–450 Author chain VC； PDBConstruct 1–450； UniProt 1–450 Author chain VE； PDBConstruct 1–450； UniProt 1–450 Author chain VG； PDBConstruct 1–450； UniProt 1–450 Author chain VI； PDBConstruct 1–450； UniProt 1–450 Author chain VK； PDBConstruct 1–450； UniProt 1–450 Author chain VM； PDBConstruct 1–450； UniProt 1–450 Author chain VO； PDBConstruct 1–450； UniProt 1–450 Author chain WC； PDBConstruct 1–450； UniProt 1–450 Author chain WE； PDBConstruct 1–450； UniProt 1–450 Author chain WG； PDBConstruct 1–450； UniProt 1–450 Author chain WI； PDBConstruct 1–450； UniProt 1–450 Author chain WK； PDBConstruct 1–450； UniProt 1–450 Author chain WM； PDBConstruct 1–450； UniProt 1–450 Author chain WO； PDBConstruct 1–450； UniProt 1–450

Tubulin beta-4B chain

OrganismNot specified

UniProt P68372

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBB4B_MOUSE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain AB； PDBConstruct 1–445； UniProt 1–445 Author chain AD； PDBConstruct 1–445； UniProt 1–445 Author chain AF； PDBConstruct 1–445； UniProt 1–445 Author chain AH； PDBConstruct 1–445； UniProt 1–445 Author chain AJ； PDBConstruct 1–445； UniProt 1–445 Author chain AL； PDBConstruct 1–445； UniProt 1–445 Author chain AN； PDBConstruct 1–445； UniProt 1–445 Author chain AP； PDBConstruct 1–445； UniProt 1–445 Author chain BB； PDBConstruct 1–445； UniProt 1–445 Author chain BD； PDBConstruct 1–445； UniProt 1–445 Author chain BF； PDBConstruct 1–445； UniProt 1–445 Author chain BH； PDBConstruct 1–445； UniProt 1–445 Author chain BJ； PDBConstruct 1–445； UniProt 1–445 Author chain BL； PDBConstruct 1–445； UniProt 1–445 Author chain BN； PDBConstruct 1–445； UniProt 1–445 Author chain BP； PDBConstruct 1–445； UniProt 1–445 Author chain CD； PDBConstruct 1–445； UniProt 1–445 Author chain CF； PDBConstruct 1–445； UniProt 1–445 Author chain CH； PDBConstruct 1–445； UniProt 1–445 Author chain CJ； PDBConstruct 1–445； UniProt 1–445 Author chain CL； PDBConstruct 1–445； UniProt 1–445 Author chain CN； PDBConstruct 1–445； UniProt 1–445 Author chain CP； PDBConstruct 1–445； UniProt 1–445 Author chain DD； PDBConstruct 1–445； UniProt 1–445 Author chain DF； PDBConstruct 1–445； UniProt 1–445 Author chain DH； PDBConstruct 1–445； UniProt 1–445 Author chain DJ； PDBConstruct 1–445； UniProt 1–445 Author chain DL； PDBConstruct 1–445； UniProt 1–445 Author chain DN； PDBConstruct 1–445； UniProt 1–445 Author chain DP； PDBConstruct 1–445； UniProt 1–445 Author chain EB； PDBConstruct 1–445； UniProt 1–445 Author chain ED； PDBConstruct 1–445； UniProt 1–445 Author chain EF； PDBConstruct 1–445； UniProt 1–445 Author chain EH； PDBConstruct 1–445； UniProt 1–445 Author chain EJ； PDBConstruct 1–445； UniProt 1–445 Author chain EL； PDBConstruct 1–445； UniProt 1–445 Author chain EN； PDBConstruct 1–445； UniProt 1–445 Author chain FB； PDBConstruct 1–445； UniProt 1–445 Author chain FD； PDBConstruct 1–445； UniProt 1–445 Author chain FF； PDBConstruct 1–445； UniProt 1–445 Author chain FH； PDBConstruct 1–445； UniProt 1–445 Author chain FJ； PDBConstruct 1–445； UniProt 1–445 Author chain FL； PDBConstruct 1–445； UniProt 1–445 Author chain FN； PDBConstruct 1–445； UniProt 1–445 Author chain GB； PDBConstruct 1–445； UniProt 1–445 Author chain GD； PDBConstruct 1–445； UniProt 1–445 Author chain GF； PDBConstruct 1–445； UniProt 1–445 Author chain GH； PDBConstruct 1–445； UniProt 1–445 Author chain GJ； PDBConstruct 1–445； UniProt 1–445 Author chain GL； PDBConstruct 1–445； UniProt 1–445 Author chain GN； PDBConstruct 1–445； UniProt 1–445 Author chain HB； PDBConstruct 1–445； UniProt 1–445 Author chain HD； PDBConstruct 1–445； UniProt 1–445 Author chain HF； PDBConstruct 1–445； UniProt 1–445 Author chain HH； PDBConstruct 1–445； UniProt 1–445 Author chain HJ； PDBConstruct 1–445； UniProt 1–445 Author chain HL； PDBConstruct 1–445； UniProt 1–445 Author chain HN； PDBConstruct 1–445； UniProt 1–445 Author chain IB； PDBConstruct 1–445； UniProt 1–445 Author chain ID； PDBConstruct 1–445； UniProt 1–445 Author chain IF； PDBConstruct 1–445； UniProt 1–445 Author chain IH； PDBConstruct 1–445； UniProt 1–445 Author chain IJ； PDBConstruct 1–445； UniProt 1–445 Author chain IL； PDBConstruct 1–445； UniProt 1–445 Author chain IN； PDBConstruct 1–445； UniProt 1–445 Author chain IP； PDBConstruct 1–445； UniProt 1–445 Author chain JD； PDBConstruct 1–445； UniProt 1–445 Author chain JF； PDBConstruct 1–445； UniProt 1–445 Author chain JH； PDBConstruct 1–445； UniProt 1–445 Author chain JJ； PDBConstruct 1–445； UniProt 1–445 Author chain JL； PDBConstruct 1–445； UniProt 1–445 Author chain JN； PDBConstruct 1–445； UniProt 1–445 Author chain JP； PDBConstruct 1–445； UniProt 1–445 Author chain KB； PDBConstruct 1–445； UniProt 1–445 Author chain KD； PDBConstruct 1–445； UniProt 1–445 Author chain KF； PDBConstruct 1–445； UniProt 1–445 Author chain KH； PDBConstruct 1–445； UniProt 1–445 Author chain KJ； PDBConstruct 1–445； UniProt 1–445 Author chain KL； PDBConstruct 1–445； UniProt 1–445 Author chain KN； PDBConstruct 1–445； UniProt 1–445 Author chain KP； PDBConstruct 1–445； UniProt 1–445 Author chain LB； PDBConstruct 1–445； UniProt 1–445 Author chain LD； PDBConstruct 1–445； UniProt 1–445 Author chain LF； PDBConstruct 1–445； UniProt 1–445 Author chain LH； PDBConstruct 1–445； UniProt 1–445 Author chain LJ； PDBConstruct 1–445； UniProt 1–445 Author chain LL； PDBConstruct 1–445； UniProt 1–445 Author chain LN； PDBConstruct 1–445； UniProt 1–445 Author chain LP； PDBConstruct 1–445； UniProt 1–445 Author chain MB； PDBConstruct 1–445； UniProt 1–445 Author chain MD； PDBConstruct 1–445； UniProt 1–445 Author chain MF； PDBConstruct 1–445； UniProt 1–445 Author chain MH； PDBConstruct 1–445； UniProt 1–445 Author chain MJ； PDBConstruct 1–445； UniProt 1–445 Author chain ML； PDBConstruct 1–445； UniProt 1–445 Author chain MN； PDBConstruct 1–445； UniProt 1–445 Author chain MP； PDBConstruct 1–445； UniProt 1–445 Author chain NB； PDBConstruct 1–445； UniProt 1–445 Author chain ND； PDBConstruct 1–445； UniProt 1–445 Author chain NF； PDBConstruct 1–445； UniProt 1–445 Author chain NH； PDBConstruct 1–445； UniProt 1–445 Author chain NJ； PDBConstruct 1–445； UniProt 1–445 Author chain NL； PDBConstruct 1–445； UniProt 1–445 Author chain NN； PDBConstruct 1–445； UniProt 1–445 Author chain NP； PDBConstruct 1–445； UniProt 1–445 Author chain OB； PDBConstruct 1–445； UniProt 1–445 Author chain OD； PDBConstruct 1–445； UniProt 1–445 Author chain OF； PDBConstruct 1–445； UniProt 1–445 Author chain OH； PDBConstruct 1–445； UniProt 1–445 Author chain OJ； PDBConstruct 1–445； UniProt 1–445 Author chain OL； PDBConstruct 1–445； UniProt 1–445 Author chain ON； PDBConstruct 1–445； UniProt 1–445 Author chain OP； PDBConstruct 1–445； UniProt 1–445 Author chain PB； PDBConstruct 1–445； UniProt 1–445 Author chain PD； PDBConstruct 1–445； UniProt 1–445 Author chain PF； PDBConstruct 1–445； UniProt 1–445 Author chain PH； PDBConstruct 1–445； UniProt 1–445 Author chain PJ； PDBConstruct 1–445； UniProt 1–445 Author chain PL； PDBConstruct 1–445； UniProt 1–445 Author chain PN； PDBConstruct 1–445； UniProt 1–445 Author chain PP； PDBConstruct 1–445； UniProt 1–445 Author chain QD； PDBConstruct 1–445； UniProt 1–445 Author chain QF； PDBConstruct 1–445； UniProt 1–445 Author chain QH； PDBConstruct 1–445； UniProt 1–445 Author chain QJ； PDBConstruct 1–445； UniProt 1–445 Author chain QL； PDBConstruct 1–445； UniProt 1–445 Author chain QN； PDBConstruct 1–445； UniProt 1–445 Author chain QP； PDBConstruct 1–445； UniProt 1–445 Author chain RD； PDBConstruct 1–445； UniProt 1–445 Author chain RF； PDBConstruct 1–445； UniProt 1–445 Author chain RH； PDBConstruct 1–445； UniProt 1–445 Author chain RJ； PDBConstruct 1–445； UniProt 1–445 Author chain RL； PDBConstruct 1–445； UniProt 1–445 Author chain RN； PDBConstruct 1–445； UniProt 1–445 Author chain RP； PDBConstruct 1–445； UniProt 1–445 Author chain SB； PDBConstruct 1–445； UniProt 1–445 Author chain SD； PDBConstruct 1–445； UniProt 1–445 Author chain SF； PDBConstruct 1–445； UniProt 1–445 Author chain SH； PDBConstruct 1–445； UniProt 1–445 Author chain SJ； PDBConstruct 1–445； UniProt 1–445 Author chain SL； PDBConstruct 1–445； UniProt 1–445 Author chain SN； PDBConstruct 1–445； UniProt 1–445 Author chain TB； PDBConstruct 1–445； UniProt 1–445 Author chain TD； PDBConstruct 1–445； UniProt 1–445 Author chain TF； PDBConstruct 1–445； UniProt 1–445 Author chain TH； PDBConstruct 1–445； UniProt 1–445 Author chain TJ； PDBConstruct 1–445； UniProt 1–445 Author chain TL； PDBConstruct 1–445； UniProt 1–445 Author chain TN； PDBConstruct 1–445； UniProt 1–445 Author chain UB； PDBConstruct 1–445； UniProt 1–445 Author chain UD； PDBConstruct 1–445； UniProt 1–445 Author chain UF； PDBConstruct 1–445； UniProt 1–445 Author chain UH； PDBConstruct 1–445； UniProt 1–445 Author chain UJ； PDBConstruct 1–445； UniProt 1–445 Author chain UL； PDBConstruct 1–445； UniProt 1–445 Author chain UN； PDBConstruct 1–445； UniProt 1–445 Author chain VB； PDBConstruct 1–445； UniProt 1–445 Author chain VD； PDBConstruct 1–445； UniProt 1–445 Author chain VF； PDBConstruct 1–445； UniProt 1–445 Author chain VH； PDBConstruct 1–445； UniProt 1–445 Author chain VJ； PDBConstruct 1–445； UniProt 1–445 Author chain VL； PDBConstruct 1–445； UniProt 1–445 Author chain VN； PDBConstruct 1–445； UniProt 1–445 Author chain WB； PDBConstruct 1–445； UniProt 1–445 Author chain WD； PDBConstruct 1–445； UniProt 1–445 Author chain WF； PDBConstruct 1–445； UniProt 1–445 Author chain WH； PDBConstruct 1–445； UniProt 1–445 Author chain WJ； PDBConstruct 1–445； UniProt 1–445 Author chain WL； PDBConstruct 1–445； UniProt 1–445 Author chain WN； PDBConstruct 1–445； UniProt 1–445

Sperm axonemal maintenance protein CFAP97D1

OrganismNot specified

UniProt Q9DAN9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CF97D_MOUSE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain Aa； PDBConstruct 1–164； UniProt 1–164 Author chain Ab； PDBConstruct 1–164； UniProt 1–164 Author chain Ac； PDBConstruct 1–164； UniProt 1–164

Meiosis-specific nuclear structural protein 1

OrganismNot specified

UniProt Q61884

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MNS1_MOUSE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain B； PDBConstruct 1–491； UniProt 1–491 Author chain C； PDBConstruct 1–491； UniProt 1–491

Tektin-2

OrganismNot specified

UniProt Q922G7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT2_MOUSE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain B0； PDBConstruct 1–430； UniProt 1–430 Author chain B1； PDBConstruct 1–430； UniProt 1–430 Author chain B2； PDBConstruct 1–430； UniProt 1–430 Author chain B3； PDBConstruct 1–430； UniProt 1–430 Author chain B4； PDBConstruct 1–430； UniProt 1–430 Author chain B5； PDBConstruct 1–430； UniProt 1–430 Author chain R0； PDBConstruct 1–430； UniProt 1–430 Author chain R1； PDBConstruct 1–430； UniProt 1–430 Author chain R2； PDBConstruct 1–430； UniProt 1–430 Author chain R3； PDBConstruct 1–430； UniProt 1–430 Author chain R4； PDBConstruct 1–430； UniProt 1–430 Author chain R5； PDBConstruct 1–430； UniProt 1–430

EF-hand calcium-binding domain-containing protein 3

OrganismNot specified

UniProt Q80X60

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EFCB3_MOUSE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain Ba； PDBConstruct 1–432； UniProt 1–432 Author chain Bb； PDBConstruct 1–432； UniProt 1–432 Author chain Bc； PDBConstruct 1–432； UniProt 1–432

Tektin-3

OrganismNot specified

UniProt Q6X6Z7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT3_MOUSE
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain C0； PDBConstruct 1–490； UniProt 1–490 Author chain C1； PDBConstruct 1–490； UniProt 1–490 Author chain C2； PDBConstruct 1–490； UniProt 1–490 Author chain C3； PDBConstruct 1–490； UniProt 1–490 Author chain C4； PDBConstruct 1–490； UniProt 1–490 Author chain C6； PDBConstruct 1–490； UniProt 1–490 Author chain S0； PDBConstruct 1–490； UniProt 1–490 Author chain S1； PDBConstruct 1–490； UniProt 1–490 Author chain S2； PDBConstruct 1–490； UniProt 1–490 Author chain S3； PDBConstruct 1–490； UniProt 1–490 Author chain S4； PDBConstruct 1–490； UniProt 1–490 Author chain S5； PDBConstruct 1–490； UniProt 1–490 Author chain S6； PDBConstruct 1–490； UniProt 1–490 Author chain S7； PDBConstruct 1–490； UniProt 1–490 Author chain S8； PDBConstruct 1–490； UniProt 1–490 Author chain S9； PDBConstruct 1–490； UniProt 1–490

Sperm-associated antigen 8

OrganismNot specified

UniProt Q3V0Q6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPAG8_MOUSE
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain D； PDBConstruct 1–470； UniProt 1–470 Author chain K3； PDBConstruct 1–470； UniProt 1–470

Tektin-4

OrganismNot specified

UniProt Q149S1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT4_MOUSE
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain D0； PDBConstruct 1–447； UniProt 1–447 Author chain D1； PDBConstruct 1–447； UniProt 1–447 Author chain D2； PDBConstruct 1–447； UniProt 1–447 Author chain D3； PDBConstruct 1–447； UniProt 1–447 Author chain D4； PDBConstruct 1–447； UniProt 1–447 Author chain D5； PDBConstruct 1–447； UniProt 1–447 Author chain T0； PDBConstruct 1–447； UniProt 1–447 Author chain T1； PDBConstruct 1–447； UniProt 1–447 Author chain T2； PDBConstruct 1–447； UniProt 1–447 Author chain T3； PDBConstruct 1–447； UniProt 1–447 Author chain T4； PDBConstruct 1–447； UniProt 1–447 Author chain T5； PDBConstruct 1–447； UniProt 1–447

Cilia- and flagella-associated protein 161

OrganismNot specified

UniProt Q6P8Y0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CF161_MOUSE
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain E； PDBConstruct 1–303； UniProt 1–303 Author chain F； PDBConstruct 1–303； UniProt 1–303 Author chain N2； PDBConstruct 1–303； UniProt 1–303

Ciliary microtubule inner protein 1

OrganismNot specified

UniProt Q9DA42

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CMIP1_MOUSE
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain Ea； PDBConstruct 1–136； UniProt 1–136

Ciliary microtubule inner protein 3

OrganismNot specified

UniProt Q8K168

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8K168_MOUSE
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain Fa； PDBConstruct 1–210； UniProt 1–210 Author chain Fb； PDBConstruct 1–210； UniProt 1–210 Author chain Fc； PDBConstruct 1–210； UniProt 1–210 Author chain Fd； PDBConstruct 1–210； UniProt 1–210

Piercer of microtubule wall 2 protein

OrganismNot specified

UniProt V9GXK1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PIRC2_MOUSE
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain G； PDBConstruct 1–122； UniProt 1–122

Ciliary microtubule inner protein 4

OrganismNot specified

UniProt Q9D9J2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CMIP4_MOUSE
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain Ga； PDBConstruct 1–266； UniProt 1–266

Ciliary microtubule inner protein 2A

OrganismNot specified

UniProt Q9D4K5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CMI2A_MOUSE
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain H； PDBConstruct 1–319； UniProt 1–319 Author chain I； PDBConstruct 1–319； UniProt 1–319 Author chain J； PDBConstruct 1–319； UniProt 1–319 Author chain K； PDBConstruct 1–319； UniProt 1–319 Author chain L； PDBConstruct 1–319； UniProt 1–319 Author chain M； PDBConstruct 1–319； UniProt 1–319 Author chain N； PDBConstruct 1–319； UniProt 1–319 Author chain O7； PDBConstruct 1–319； UniProt 1–319 Author chain O8； PDBConstruct 1–319； UniProt 1–319 Author chain O9； PDBConstruct 1–319； UniProt 1–319 Author chain P8； PDBConstruct 1–319； UniProt 1–319 Author chain P9； PDBConstruct 1–319； UniProt 1–319 Author chain Z2； PDBConstruct 1–319； UniProt 1–319 Author chain Z3； PDBConstruct 1–319； UniProt 1–319 Author chain Z4； PDBConstruct 1–319； UniProt 1–319 Author chain Z5； PDBConstruct 1–319； UniProt 1–319

Luteinizing hormone beta

OrganismNot specified

UniProt A0A571BEL8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A571BEL8_MOUSE
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain Ha； PDBConstruct 1–310； UniProt 1–310 Author chain Hb； PDBConstruct 1–310； UniProt 1–310

Cilia- and flagella-associated protein 68

OrganismNot specified

UniProt Q9D131

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA68_MOUSE
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain I1； PDBConstruct 1–166； UniProt 1–166

Protein SPMIP1

OrganismNot specified

UniProt B9EJX3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMIP1_MOUSE
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain Ia； PDBConstruct 1–177； UniProt 1–177 Author chain Ib； PDBConstruct 1–177； UniProt 1–177 Author chain Ic； PDBConstruct 1–177； UniProt 1–177

Cilia- and flagella-associated protein 77

OrganismNot specified

UniProt A0A087WRI3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA77_MOUSE
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain J1； PDBConstruct 1–283； UniProt 1–283 Author chain J2； PDBConstruct 1–283； UniProt 1–283 Author chain J3； PDBConstruct 1–283； UniProt 1–283 Author chain J4； PDBConstruct 1–283； UniProt 1–283 Author chain J5； PDBConstruct 1–283； UniProt 1–283

Cilia- and flagella-associated protein 144

OrganismNot specified

UniProt Q5NC57

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CF144_MOUSE
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain K1； PDBConstruct 1–135； UniProt 1–135 Author chain K2； PDBConstruct 1–135； UniProt 1–135

Protein SPMIP3

OrganismNot specified

UniProt Q9DAA7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMIP3_MOUSE
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain Ka； PDBConstruct 1–145； UniProt 1–145 Author chain Kb； PDBConstruct 1–145； UniProt 1–145

Cilia- and flagella-associated protein 90

OrganismNot specified

UniProt Q9DAR0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA90_MOUSE
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain L1； PDBConstruct 1–182； UniProt 1–182

Sperm-associated microtubule inner protein 4

OrganismNot specified

UniProt Q9D5Y0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMIP4_MOUSE
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain La； PDBConstruct 1–588； UniProt 1–588 Author chain Lb； PDBConstruct 1–588； UniProt 1–588

Ciliary microtubule inner protein 2C

OrganismNot specified

UniProt Q9DAS2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CMI2C_MOUSE
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain M1； PDBConstruct 1–200； UniProt 1–200 Author chain M2； PDBConstruct 1–200； UniProt 1–200 Author chain M3； PDBConstruct 1–200； UniProt 1–200 Author chain M4； PDBConstruct 1–200； UniProt 1–200

Protein SPMIP7

OrganismNot specified

UniProt Q5NC83

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMIP7_MOUSE
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain Ma； PDBConstruct 1–441； UniProt 1–441

Sperm microtubule inner protein 8

OrganismNot specified

UniProt Q6IMH0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMIP8_MOUSE
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain Na； PDBConstruct 1–216； UniProt 1–216 Author chain Nb； PDBConstruct 1–216； UniProt 1–216 Author chain Nc； PDBConstruct 1–216； UniProt 1–216 Author chain Nd； PDBConstruct 1–216； UniProt 1–216 Author chain Ne； PDBConstruct 1–216； UniProt 1–216

RIB43A-like with coiled-coils protein 1

OrganismNot specified

UniProt Q9D0B8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RIBC1_MOUSE
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain O； PDBConstruct 1–379； UniProt 1–379 Author chain P； PDBConstruct 1–379； UniProt 1–379 Author chain Q； PDBConstruct 1–379； UniProt 1–379

Dual specificity phosphatase 21

OrganismNot specified

UniProt Q9D9D8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DUS21_MOUSE
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain O1； PDBConstruct 1–189； UniProt 1–189 Author chain O2； PDBConstruct 1–189； UniProt 1–189 Author chain O3； PDBConstruct 1–189； UniProt 1–189 Author chain O4； PDBConstruct 1–189； UniProt 1–189

EF-hand domain-containing protein 1

OrganismNot specified

UniProt Q9D9T8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EFHC1_MOUSE
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain O5； PDBConstruct 1–648； UniProt 1–648 Author chain O6； PDBConstruct 1–648； UniProt 1–648 Author chain T； PDBConstruct 1–648； UniProt 1–648 Author chain U； PDBConstruct 1–648； UniProt 1–648 Author chain V； PDBConstruct 1–648； UniProt 1–648

Sperm microtubule inner protein 6

OrganismNot specified

UniProt Q2MH31

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMIP6_MOUSE
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain Oa； PDBConstruct 1–260； UniProt 1–260 Author chain Ob； PDBConstruct 1–260； UniProt 1–260 Author chain Oc； PDBConstruct 1–260； UniProt 1–260 Author chain Od； PDBConstruct 1–260； UniProt 1–260 Author chain Oe； PDBConstruct 1–260； UniProt 1–260 Author chain Of； PDBConstruct 1–260； UniProt 1–260 Author chain Og； PDBConstruct 1–260； UniProt 1–260 Author chain Oh； PDBConstruct 1–260； UniProt 1–260

Sperm microtubule inner protein 11

OrganismNot specified

UniProt Q8CDT5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMI11_MOUSE
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain P1； PDBConstruct 1–131； UniProt 1–131 Author chain P2； PDBConstruct 1–131； UniProt 1–131

Protein SPMIP9

OrganismNot specified

UniProt Q9DAG4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMIP9_MOUSE
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain P3； PDBConstruct 1–180； UniProt 1–180 Author chain P4； PDBConstruct 1–180； UniProt 1–180 Author chain P5； PDBConstruct 1–180； UniProt 1–180 Author chain P6； PDBConstruct 1–180； UniProt 1–180 Author chain P7； PDBConstruct 1–180； UniProt 1–180

Tektin bundle-interacting protein 1

OrganismNot specified

UniProt A6H6Q4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TKTI1_MOUSE
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain Q1； PDBConstruct 1–206； UniProt 1–206 Author chain Q2； PDBConstruct 1–206； UniProt 1–206 Author chain Q3； PDBConstruct 1–206； UniProt 1–206 Author chain Q4； PDBConstruct 1–206； UniProt 1–206

RIB43A-like with coiled-coils protein 2

OrganismNot specified

UniProt Q9D4Q1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RIBC2_MOUSE
Isoform	—
PDB entities	41
Chains and sequence ranges	Author chain R； PDBConstruct 1–377； UniProt 1–377 Author chain S； PDBConstruct 1–377； UniProt 1–377

Tektin-5

OrganismNot specified

UniProt G5E8A8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT5_MOUSE
Isoform	—
PDB entities	42
Chains and sequence ranges	Author chain U0； PDBConstruct 1–557； UniProt 1–557 Author chain U1； PDBConstruct 1–557； UniProt 1–557 Author chain U2； PDBConstruct 1–557； UniProt 1–557 Author chain U3； PDBConstruct 1–557； UniProt 1–557 Author chain U4； PDBConstruct 1–557； UniProt 1–557 Author chain U5； PDBConstruct 1–557； UniProt 1–557 Author chain U6； PDBConstruct 1–557； UniProt 1–557 Author chain U7； PDBConstruct 1–557； UniProt 1–557 Author chain U8； PDBConstruct 1–557； UniProt 1–557 Author chain U9； PDBConstruct 1–557； UniProt 1–557 Author chain V0； PDBConstruct 1–557； UniProt 1–557 Author chain V1； PDBConstruct 1–557； UniProt 1–557 Author chain V2； PDBConstruct 1–557； UniProt 1–557 Author chain V3； PDBConstruct 1–557； UniProt 1–557 Author chain V4； PDBConstruct 1–557； UniProt 1–557 Author chain V5； PDBConstruct 1–557； UniProt 1–557 Author chain V6； PDBConstruct 1–557； UniProt 1–557 Author chain V7； PDBConstruct 1–557； UniProt 1–557 Author chain V8； PDBConstruct 1–557； UniProt 1–557 Author chain V9； PDBConstruct 1–557； UniProt 1–557 Author chain W0； PDBConstruct 1–557； UniProt 1–557 Author chain W2； PDBConstruct 1–557； UniProt 1–557 Author chain W4； PDBConstruct 1–557； UniProt 1–557 Author chain W5； PDBConstruct 1–557； UniProt 1–557 Author chain W6； PDBConstruct 1–557； UniProt 1–557 Author chain W7； PDBConstruct 1–557； UniProt 1–557

EF-hand domain-containing family member C2

OrganismNot specified

UniProt Q9D485

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EFHC2_MOUSE
Isoform	—
PDB entities	43
Chains and sequence ranges	Author chain W； PDBConstruct 1–750； UniProt 1–750 Author chain X； PDBConstruct 1–750； UniProt 1–750 Author chain Y； PDBConstruct 1–750； UniProt 1–750 Author chain Z； PDBConstruct 1–750； UniProt 1–750

Stabilizer of axonemal microtubules 4

OrganismNot specified

UniProt Q148A4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SAXO4_MOUSE
Isoform	—
PDB entities	44
Chains and sequence ranges	Author chain X4； PDBConstruct 1–427； UniProt 1–427 Author chain X5； PDBConstruct 1–427； UniProt 1–427

Testis-specific serine/threonine-protein kinase 6

OrganismNot specified

UniProt Q925K9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TSSK6_MOUSE
Isoform	—
PDB entities	45
Chains and sequence ranges	Author chain X6； PDBConstruct 1–273； UniProt 1–273 Author chain X7； PDBConstruct 1–273； UniProt 1–273 Author chain X8； PDBConstruct 1–273； UniProt 1–273

Cilia- and flagella-associated protein 20

OrganismNot specified

UniProt Q8BTU1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA20_MOUSE
Isoform	—
PDB entities	46
Chains and sequence ranges	Author chain XB； PDBConstruct 1–193； UniProt 1–193 Author chain XC； PDBConstruct 1–193； UniProt 1–193 Author chain XD； PDBConstruct 1–193； UniProt 1–193 Author chain XE； PDBConstruct 1–193； UniProt 1–193 Author chain XF； PDBConstruct 1–193； UniProt 1–193 Author chain XG； PDBConstruct 1–193； UniProt 1–193 Author chain XH； PDBConstruct 1–193； UniProt 1–193

Ciliary microtubule associated protein 1A

OrganismNot specified

UniProt Q920N1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CMA1A_MOUSE
Isoform	—
PDB entities	47
Chains and sequence ranges	Author chain Y0； PDBConstruct 1–254； UniProt 1–254 Author chain Y1； PDBConstruct 1–254； UniProt 1–254 Author chain Y2； PDBConstruct 1–254； UniProt 1–254 Author chain Y3； PDBConstruct 1–254； UniProt 1–254 Author chain Y4； PDBConstruct 1–254； UniProt 1–254 Author chain Y5； PDBConstruct 1–254； UniProt 1–254 Author chain Y6； PDBConstruct 1–254； UniProt 1–254 Author chain Y7； PDBConstruct 1–254； UniProt 1–254

Parkin coregulated gene protein homolog

OrganismNot specified

UniProt Q9DAK2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PACRG_MOUSE
Isoform	—
PDB entities	48
Chains and sequence ranges	Author chain YA； PDBConstruct 1–241； UniProt 1–241 Author chain YB； PDBConstruct 1–241； UniProt 1–241 Author chain YC； PDBConstruct 1–241； UniProt 1–241 Author chain YD； PDBConstruct 1–241； UniProt 1–241 Author chain YE； PDBConstruct 1–241； UniProt 1–241 Author chain YF； PDBConstruct 1–241； UniProt 1–241 Author chain YG； PDBConstruct 1–241； UniProt 1–241 Author chain YH； PDBConstruct 1–241； UniProt 1–241

Cilia- and flagella-associated protein 45

OrganismNot specified

UniProt Q9D9U9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA45_MOUSE
Isoform	—
PDB entities	49
Chains and sequence ranges	Author chain a； PDBConstruct 1–551； UniProt 1–551 Author chain a6； PDBConstruct 1–551； UniProt 1–551 Author chain b； PDBConstruct 1–551； UniProt 1–551 Author chain c； PDBConstruct 1–551； UniProt 1–551 Author chain d； PDBConstruct 1–551； UniProt 1–551

Sperm-associated microtubule inner protein 5

OrganismNot specified

UniProt Q9CQT6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMIP5_MOUSE
Isoform	—
PDB entities	50
Chains and sequence ranges	Author chain a1； PDBConstruct 1–229； UniProt 1–229 Author chain a2； PDBConstruct 1–229； UniProt 1–229 Author chain a3； PDBConstruct 1–229； UniProt 1–229 Author chain a4； PDBConstruct 1–229； UniProt 1–229

Tektin-like protein 1

OrganismNot specified

UniProt Q9D4K7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKL1_MOUSE
Isoform	—
PDB entities	51
Chains and sequence ranges	Author chain b1； PDBConstruct 1–499； UniProt 1–499 Author chain b2； PDBConstruct 1–499； UniProt 1–499 Author chain b3； PDBConstruct 1–499； UniProt 1–499 Author chain b4； PDBConstruct 1–499； UniProt 1–499 Author chain b5； PDBConstruct 1–499； UniProt 1–499

Cilia- and flagella-associated protein 52

OrganismNot specified

UniProt Q5F201

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA52_MOUSE
Isoform	—
PDB entities	52
Chains and sequence ranges	Author chain e； PDBConstruct 1–620； UniProt 1–620 Author chain f； PDBConstruct 1–620； UniProt 1–620 Author chain g； PDBConstruct 1–620； UniProt 1–620

Enkurin

OrganismNot specified

UniProt Q6SP97

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ENKUR_MOUSE
Isoform	—
PDB entities	53
Chains and sequence ranges	Author chain h； PDBConstruct 1–255； UniProt 1–255 Author chain i； PDBConstruct 1–255； UniProt 1–255 Author chain j； PDBConstruct 1–255； UniProt 1–255 Author chain k； PDBConstruct 1–255； UniProt 1–255

Sperm-associated microtubule inner protein 10

OrganismNot specified

UniProt Q9D9I1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SMI10_MOUSE
Isoform	—
PDB entities	54
Chains and sequence ranges	Author chain h1； PDBConstruct 1–141； UniProt 1–141 Author chain h2； PDBConstruct 1–141； UniProt 1–141 Author chain h3； PDBConstruct 1–141； UniProt 1–141 Author chain h4； PDBConstruct 1–141； UniProt 1–141

Protein Flattop

OrganismNot specified

UniProt Q6P8X9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLTOP_MOUSE
Isoform	—
PDB entities	55
Chains and sequence ranges	Author chain i1； PDBConstruct 1–189； UniProt 1–189 Author chain l； PDBConstruct 1–189； UniProt 1–189 Author chain m； PDBConstruct 1–189； UniProt 1–189 Author chain n； PDBConstruct 1–189； UniProt 1–189

EF-hand calcium-binding domain-containing protein 6

OrganismNot specified

UniProt Q6P1E8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EFCB6_MOUSE
Isoform	—
PDB entities	56
Chains and sequence ranges	Author chain i2； PDBConstruct 1–1516； UniProt 1–1516 Author chain i3； PDBConstruct 1–1516； UniProt 1–1516 Author chain i4； PDBConstruct 1–1516； UniProt 1–1516

Cilia- and flagella- associated protein 210

OrganismNot specified

UniProt A0JLY1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CF210_MOUSE
Isoform	—
PDB entities	57
Chains and sequence ranges	Author chain o； PDBConstruct 1–547； UniProt 1–547 Author chain p； PDBConstruct 1–547； UniProt 1–547

Cilia- and flagella-associated protein 276

OrganismNot specified

UniProt Q9DAD0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CF276_MOUSE
Isoform	—
PDB entities	58
Chains and sequence ranges	Author chain q； PDBConstruct 1–168； UniProt 1–168 Author chain r； PDBConstruct 1–168； UniProt 1–168 Author chain s； PDBConstruct 1–168； UniProt 1–168

Piercer of microtubule wall 1 protein

OrganismNot specified

UniProt Q5BN45

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Sperm microtubule inner protein 2 × 1 （E9QAV2） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PIRC1_MOUSE
Isoform	—
PDB entities	59
Chains and sequence ranges	Author chain y； PDBConstruct 1–167； UniProt 1–167

Sperm microtubule inner protein 2

OrganismNot specified

UniProt E9QAV2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 589	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） EF-hand domain-containing family member B × 2 （Q8CDU5） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Nucleoside diphosphate kinase homolog 7 × 3 （Q9QXL8） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 141 × 2 （Q9D9D9） Tektin-1 × 6 （Q9DAJ2） Tubulin alpha-3 chain × 167 （P05214） Tubulin beta-4B chain × 170 （P68372） Sperm axonemal maintenance protein CFAP97D1 × 3 （Q9DAN9） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-2 × 12 （Q922G7） EF-hand calcium-binding domain-containing protein 3 × 3 （Q80X60） Tektin-3 × 16 （Q6X6Z7） Sperm-associated antigen 8 × 2 （Q3V0Q6） Tektin-4 × 12 （Q149S1） Cilia- and flagella-associated protein 161 × 3 （Q6P8Y0） Ciliary microtubule inner protein 1 × 1 （Q9DA42） Ciliary microtubule inner protein 3 × 4 （Q8K168） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Ciliary microtubule inner protein 4 × 1 （Q9D9J2） Ciliary microtubule inner protein 2A × 16 （Q9D4K5） Luteinizing hormone beta × 2 （A0A571BEL8） Cilia- and flagella-associated protein 68 × 1 （Q9D131） Protein SPMIP1 × 3 （B9EJX3） Cilia- and flagella-associated protein 77 × 5 （A0A087WRI3） Cilia- and flagella-associated protein 144 × 2 （Q5NC57） Protein SPMIP3 × 2 （Q9DAA7） Cilia- and flagella-associated protein 90 × 1 （Q9DAR0） Sperm-associated microtubule inner protein 4 × 2 （Q9D5Y0） Ciliary microtubule inner protein 2C × 4 （Q9DAS2） Protein SPMIP7 × 1 （Q5NC83） Sperm microtubule inner protein 8 × 5 （Q6IMH0） RIB43A-like with coiled-coils protein 1 × 3 （Q9D0B8） Dual specificity phosphatase 21 × 4 （Q9D9D8） EF-hand domain-containing protein 1 × 5 （Q9D9T8） Sperm microtubule inner protein 6 × 8 （Q2MH31） Sperm microtubule inner protein 11 × 2 （Q8CDT5） Protein SPMIP9 × 5 （Q9DAG4） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） RIB43A-like with coiled-coils protein 2 × 2 （Q9D4Q1） Tektin-5 × 26 （G5E8A8） EF-hand domain-containing family member C2 × 4 （Q9D485） Stabilizer of axonemal microtubules 4 × 2 （Q148A4） Testis-specific serine/threonine-protein kinase 6 × 3 （Q925K9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Ciliary microtubule associated protein 1A × 8 （Q920N1） Parkin coregulated gene protein homolog × 8 （Q9DAK2） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Sperm-associated microtubule inner protein 5 × 4 （Q9CQT6） Tektin-like protein 1 × 5 （Q9D4K7） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Sperm-associated microtubule inner protein 10 × 4 （Q9D9I1） Protein Flattop × 4 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Piercer of microtubule wall 1 protein × 1 （Q5BN45） GUANOSINE-5'-TRIPHOSPHATE × 167 MAGNESIUM ION × 170 GUANOSINE-5'-DIPHOSPHATE × 170 ADENOSINE-5'-TRIPHOSPHATE × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E9QAV2_MOUSE
Isoform	—
PDB entities	60
Chains and sequence ranges	Author chain ke； PDBConstruct 1–189； UniProt 1–189

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9v10
Deposition date deposition_date	2025-05-19
Structure title title	Cryo-EM structure of the 48-nm repeat doublet microtubule from mouse sperm
Keywords keywords	sperm flagellar doublet microtubules, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9v10__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9v10__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9v10__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	230.00 Å
Total Rg	230.00 Å
Atom count	1603403
Residues	201106
Excluded volume	28339000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9v10__assembly_1__model_1`	589-meric （589）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (64)

Entity 1 Entity 1 polymer

Description description	Cilia- and flagella-associated protein 95
Molecular weight formula_weight	26633.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0,7
Atom count atom_count	1603403

MGTFDSQCHECFESKERWYEIGPTDLLERKGSLTLRSHHKKYSEPVLVYSWHRNREAFPKDYDIESLETVKNLCMSTYKRFGSDSPRWMSEAREQMAQVLVNKDLVEKKKTGLLDEETLCPGILERDPELPPTGFRDVPMESPPDPRKPCFSTTYSEDFTPQYEYPPPACPRREEYSIVHRKCRSQFTDLNGSKRLGINTWHDESGIYANSEAKQKLYALARNPIVPF

Entity 2 Entity 2 polymer

Description description	EF-hand domain-containing family member B
Molecular weight formula_weight	95892.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,2

MCSFVRVGSPKPLQTSASPLEMSSLRRTRAPEISELGLTPEQKDDIRDRVLRGSKSPTELGFDLRLEQDRKWRERMGSSEAKSPPCHALGVGLERHTISGTPTEMGNLGLHKGSAFQGSKPLGVLPGRVGPENKGLPPRLRYGGTLHPPFSTVHASPLAAESRRRPLAWGSAWTDAVVEKQPVVGLELRKEPEKEPTCVVMNPYPEMPPKEVDIGLPQTQESDEAKNTEPLIGLVREPSECPFAQQPEEKKEPGSTEPGVEPPGNIRPIYSGKFFDRVPCWPSAGKVKPVGYRVATCLTEKLPRLMTPPEAKKYFNFRYPPAGAERVFYGRANDPQIAPYLTHGLRSKISIPMGSLINPQPITTFQQKIKDKKESIYFSHQRAPLGKSHDQTPGLPKGMDVINTTLGTPTIRELSVRDTVNPSKSFEDVLKEGQEGHDLYTVSHNDYFAGEAKNRKYNPASFHRFNLYGIPTPHFNDGRTMAKALHWLHELQMERGAKIVSKRVDDFKEKFQHKLGKVLDPIAETMNVPPGHTFGSCLHPEEYGAGDLIHYRSPDEYLRGKDHQRAVVAAARHHLKKFNHQNFDTLQVAFRHYDKKGDGVIDRAELHEACVQANLHLDKMLLDHLFDYCDVDQDGLINYLEFANFLNWKDRIPLKEHEKRVVVKGKKPDCENVTDTSMGEAEPSLLINPEDIVPKEPGSSEETLRTIQRPGDKVSHQYKTTSSEINAVVGAVPSMCHPIFGVPTIRSDISAPRIRRVSDMNNYGDEGNAYSLLHPSIFSQKGVFERDFFKTRSKEEISDILTNIGVKLSKEEFENVWNLASKKHQRGEVCVETIRNVLDELLHADLVKCKTAM

Entity 3 Entity 3 polymer

Description description	Cilia- and flagella-associated protein 53
Molecular weight formula_weight	62036.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3,4

MYSQQFGTVPREFKGPTPKAVIIRAKPPKAQRAEQHLKRIQRSYHKYHTTLASIKSNEENRLKCDWIQRNNHKTFDSLVQARVQDAMQGFVINTEERRNKLRELLASEENEYFSEMQLKGETIEEKKDKMRERTKLLREKKEKERQEFVAEKLDQQFRERCEELRTKLASIHEKKVVEERNAQIEFNKELKRQKLVEEHLFARLWEEDRLAKERREAQEEKRQRELVQNTRLGLDAQVTSIQAQRQGARRMKEEEARILEQNKAQIKREDEQEKLQKQKRRQETRSSLKKAVQDKIESMQREYREDLDLNMKLVGRALQDLQDEADKKKQKREEMGREQKIYNDYLMQRREEEKAQEKELNRLLEDIKAKKLAEKDRELALQRAARKQLMNEVMNTRKLQVQERLQRKLREQEELALHEQRISESLKVLHQEDMEDFARRCALAEEYRNQLQMQIAHQQQAREAEKEEERQEFEAGLAANKACLDKIQRILSENQALSQNVHPMRRGYPDKPPL

Entity 4 Entity 4 polymer

Description description	Nucleoside diphosphate kinase homolog 7
Molecular weight formula_weight	44489.8 kDa
EC 编号 ec_number	3.1.-.-,2.7.-.-
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5,6,j1

MRACQQGRSSSLVSPYMAPKNQSERFAFIAEWYDPNASLLRRYELLFYPVDGSVEMHDVKNRRTFLKRTKYEDLRLEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAVSKAGEIIEMINKSGFTITKLRMMTLTRKEAADFHVDHHSRPFYNELIQFITSGPVIAMEILRDDAICEWKRLLGPANSGLSRTDAPGSIRALFGTDGVRNAAHGPDTFASAAREMELFFPSSGGCGPANTAKFTNCTCCIIKPHAISEGMLGKNLIAIRDACFGMSAIQMFNLDRANVEEFYEVYKGVVSEYNDMVTELCSGPCVAIEIQQSNPTKTFREFCGPADPEIARHLRPETLRAIFGKTKVQNAVHCTDLPEDGLLEVQYFFKILDN

Entity 5 Entity 5 polymer

Description description	Cilia- and flagella-associated protein 107
Molecular weight formula_weight	23062.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

MAMLSTSVVPEAFSTPGWQIEKKYSTKVLLGNWVEERGKFTKAIDHTPQCIYRKEYVPMPDHRPDFVSRWYSKSKMEGLPYKHLITHHQEPSHRYLISTYDDHYNRHNYNPGLPALRTWNGQKLLWLPEKSDFPLVAPPTNYGLLEQLQQKWLASKTSLKESIYTTSYPRLPVCAMSRREHAIPVPHPRLQPIPRF

Entity 6 Entity 6 polymer

Description description	Cilia- and flagella-associated protein 141
Molecular weight formula_weight	12278.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,N1

MSAEKMTKLEENLQRAVALKKTVDRWRNFHIHCMWQTTLDQRRNLFAALRMKDTKEQELALSNKQLLVVRQAALHELFEKEYQQYQQELNQMGKAFYEERL

Entity 7 Entity 7 polymer

Description description	Tektin-1
Molecular weight formula_weight	48713.0 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A0,A1,A2,A3,A4,A5

MAKLLQSPPRFLPEEWYIANKSQYHRAEAQRSQSERLVAESQRLVEEIEKTTRKSQSDVNKKLEQRLEEVRFWKKELDDKLEQLVNQTDDLLTYKTRLERSLESYKEPLHITEKCLEYREKRVGIDLVHDVVEQELQKEADIIHGVMNLLIRTLEESTEQIRLNRSAKYNLEKDLRDKFTAITIDDVCFSLNNNSPNINFSEKVVRIEPNSVSLEDWLDFSNANVEKADKQLNNSTALKTLVDQILSQTANDLRRQCEVVDEAFINGLKETKDARNKLADHLAKVMEEIASQEKNIMALENAITQQEGPAKVAHTRLETRTHRPNVELCRDIAQYRLIKEIQEINHNVARLKETLAQAQTQLKALYRRQLALQEEIQVKENTIYIDQVLCMEMRKSIPPRDGDDHGAWEGGIRAEAIC

Entity 8 Entity 8 polymer

Description description	Tubulin alpha-3 chain
Molecular weight formula_weight	50012.4 kDa
EC 编号 ec_number	3.6.5.-
Source method src_method	nat
Copy count entity_count	167

Polymer Polymer

Polymer type type

polypeptide(L)

Chain IDs strand_id

;AA,AC,AE,AG,AI,AK,AM,AO,BC,BE,BG,BI,BK,BM,BO,CC,CE,CG,CI,CK,CM,CO,DC,DE,DG,DI,DK,DM,DO,EA,EC,EE,EG,EI,EK,EM,FC,FE,FG,FI,FK,FM,GC,GE,GG,GI,GK,GM,GO,HC,HE,HG,HI,HK,HM,HO,IC,IE,IG,II,IK,IM,IO,JC,JE,JG,JI,JK,JM,JO,JQ,KA,KC,KE,KG,KI,KK,KM,KO,LA,LC,LE,LG,LI,LK,LM,LO,MA,MC,ME,MG,MI,MK,MM,MO,NA,NC,NE,NG,NI,NK,NM,NO,OC,OE,OG,OI,OK,OM,OO,PC,PE,PG,PI,PK,PM,PO,QC,QE,QG,QI,QK,QM,QO,RC,RE,RG,RI,RK,RM,RO,SA,SC,SE,SG,SI,SK,SM,TA,TC,TE,TG,TI,TK,TM,UA,UC,UE,UG,UI,UK,UM,VA,VC,VE,VG,VI,VK,VM,VO,WC,WE,WG,WI,WK,WM,WO ;

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDSVEAEAEEGEEY

Entity 9 Entity 9 polymer

Description description	Tubulin beta-4B chain
Molecular weight formula_weight	49877.8 kDa
Source method src_method	nat
Copy count entity_count	170

Polymer Polymer

Polymer type type

polypeptide(L)

Chain IDs strand_id

;AB,AD,AF,AH,AJ,AL,AN,AP,BB,BD,BF,BH,BJ,BL,BN,BP,CD,CF,CH,CJ,CL,CN,CP,DD,DF,DH,DJ,DL,DN,DP,EB,ED,EF,EH,EJ,EL,EN,FB,FD,FF,FH,FJ,FL,FN,GB,GD,GF,GH,GJ,GL,GN,HB,HD,HF,HH,HJ,HL,HN,IB,ID,IF,IH,IJ,IL,IN,IP,JD,JF,JH,JJ,JL,JN,JP,KB,KD,KF,KH,KJ,KL,KN,KP,LB,LD,LF,LH,LJ,LL,LN,LP,MB,MD,MF,MH,MJ,ML,MN,MP,NB,ND,NF,NH,NJ,NL,NN,NP,OB,OD,OF,OH,OJ,OL,ON,OP,PB,PD,PF,PH,PJ,PL,PN,PP,QD,QF,QH,QJ,QL,QN,QP,RD,RF,RH,RJ,RL,RN,RP,SB,SD,SF,SH,SJ,SL,SN,TB,TD,TF,TH,TJ,TL,TN,UB,UD,UF,UH,UJ,UL,UN,VB,VD,VF,VH,VJ,VL,VN,WB,WD,WF,WH,WJ,WL,WN ;

MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEFEEEAEEEVA

Entity 10 Entity 10 polymer

Description description	Sperm axonemal maintenance protein CFAP97D1
Molecular weight formula_weight	19811.6 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Aa,Ab,Ac

MNNSLDYLAYPVIVSNHRQSTTFRKKLDFGHYILHKNRVQIVKPAVDTKPPMAHTHYILKLSKIQGEQKRIDKIEYENRQLCQKIANAYRGPAKVDCWNEYLSKSLNRESRNRELVRITMENQGILRRLSDRKPNYDRRSSEMDWQNSRRYIRNTTRYLLFQED

Entity 11 Entity 11 polymer

Description description	Meiosis-specific nuclear structural protein 1
Molecular weight formula_weight	60353.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,C

MATKKRALSFSEKHQKLVDEKFRKSLNIQVMNKLERQAKNQVVQNENDEKVERQRFLRVLQNEQFELDMEEAIQKAEANKMLRDRQLEQEERLANELARLKHESLKDKKMRQQVRENSIELRELEQKLKAAYMNKERAAQIVEKDAMKYEQMKRDAEIERIMMEEHDRLLKEESAKQERRNKERAQYYLDLEKQLEDQERRKQEAYEQLLKEKLMIDEIVRKIYEEDQVERQQKLEKKNAIQKYIEEFQRAQDFWRQKKREEMEEENRKIIEFANIQEQREGERMARVHEIEEKRVQRQNLLMKQLEETLRQRDDLEQVRQELYQEEQAEIIKLKVKEEAELRLRRQREMKQDFEDQMALKELILQAAKEEEETFKKAMLAKFAEDDRIELMNAQKQRMKQLEHKRAVEKLIEERRSQFLADKQRELEELQLQQRRQGCINEIIEEERLRLLKEHAAKLLGYLPKGVFKREDDVDMLGEEFRKAYQKRDGV

Entity 12 Entity 12 polymer

Description description	Tektin-2
Molecular weight formula_weight	50385.1 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B0,B1,B2,B3,B4,B5,R0,R1,R2,R3,R4,R5

MATLSFKPSERYRLSDWRTNSYLLSTNAERQRDASHQIRQEARILRNETNNQIVWDEHDNRTRLAERIDTVNRWKETLDKCLTDLDAEIDSLAQAKESAEQNLQAKNLPLDVAIECLTLRESRRDIDVVRDPVEEELLKEVEVIEATKKVLQEKISQAFQHLCLLQEIRQQLNSDHRDKMETLEIDRGCLSLNLTSPNISLKVNPTRIPKDSTTLQQWDEFTRFNKNRAEAEMKASIELREAIALAIAQTNNELDAQRVATEFTFRKRLREMESFYSELKWQEKNTLEEIAELQGDIRRLEEDLRRKMMNLKLAHTRLESRTYRSNVELCRDQTQYGLIDEVHQLEATINTMKQKLAQTQNALDALFKHLARIQADIACKTNTLLLDTKCMDTRRKLTVPAEKFVPQVDTFTRTTNRTLSPLKICQLELT

Entity 13 Entity 13 polymer

Description description	EF-hand calcium-binding domain-containing protein 3
Molecular weight formula_weight	49795.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ba,Bb,Bc

MAVSEIKATMKLKPLKAPVFHKRDKDLRGSFSDHLKHKESKLSPAQLEAFRNAYNFFTKDRTGCIDSHGLISTIAKLGMNLNTYDIYNELKCADLDRDGKINFSDFINVLTDKKLFLKAVVPEKKICLDLANNPGILLFEILSKFVETSSLHRKDIIELVSYFRKRFQESHSEIMWSSYGRRGLKSEICSPPRSSTAAFANSARISIMKERDLYKFLEALKRCNLRTDSPYSKIPVFPLFPDVDGTVMGKPFKDTQKIEMLRRKEPLTFFEDYFFNKRDWKTQAMNVKPLKSASGYSDDILAIDHLFKKKQHWTVTDAAAIKQHVKKATESYNLGIALDHRKEMLNLWKKIRGDLVGIESNNESFYNTFSTYTWSWNVCQELLSAKDLRLHDASMNKSSPSNSGLSSPSDFSESDPETGRKRKRKSSRGFRQ

Entity 14 Entity 14 polymer

Description description	Tektin-3
Molecular weight formula_weight	56754.8 kDa
Source method src_method	nat
Copy count entity_count	16

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C0,C1,C2,C3,C4,C6,S0,S1,S2,S3,S4,S5,S6,S7,S8,S9

MELLGSTLTATYAHPPPASASFLPAIGTITSSYKDRFPHRNLTHSLSLPWRPNTYYKTAYNYPTLAPYSSRSQRVCESTMLPFVSNRTTFFTRYTPDDWYRSNLVSFQESNSSRHNSERLRVDTSRLIQDKYQQIRKTQAHSTQNLGERVNDLAFWKSEITHELDEMIGETNALTDIKRRLERGLIETEGPLQVSRECLFHREKRMGIDLVHDEAEKELLAEVDTILCCQERMRQHLDKANAQLASDRSAQHELEKDLSDKQAALRIDDKCQHLRNTSEGVSYFRGVERVDATVSVPETWAKFTDDNVLRSQSERAASAKLREETENLLIVTANEMWNQFNKVNLAFTNRIAETVDAKNKIHTHLTKTLQEIFQIEMTIESIKKAIKEKSAFLKVAQTRLDERTRRPNVELCRDMAQLRLVNEVYEVDETIQTLQQRLRDSEDTLQSLAHTKATLEHDLAVKANTLYIDQEKCMSMRNSYPSTLRLVGYC

Entity 15 Entity 15 polymer

Description description	Sperm-associated antigen 8
Molecular weight formula_weight	50591.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,K3

METTESTEGSLSRSCDVQPSSERLDTPSEPVPSSSSSPRSTAPAEAPAQYSVLTEPSSDSLYGAPCPPAHHRGHGFGFQPFYVSCIPQDPCNMADLSSRADPTSSYPCHSSVHGSGSGTCGLGQSSEPSQGSGPTSGPAPASVPSLVSGPDSASGPDSSASGPALASGPGPADPGQGPKFSTCIPQGYRCIPVDLAPDYNAWCQHLHWKPQRSWEPLQVSEPGVRGPYKPPEPGALGPCEPCEPCEPPEAESEETLCKARPRGQCLLYNWEEERATNQLDQIPPLQDGSESYFFRHGHQGLLTTQPQSPMSSSTTQRDSYQLPRHICQPLRGKREAMLEMLLRHQICKEVQAEQEPARKLFETESVTHHDYRVELVRAAPPASTKPHDYRQEQPETFWIQRAARLPGVSDIRTLDTPFRKNCSFSTPVPLSLGQPLPYELESGPHQVGVISSLACQGGGQGCGRTKTTPI

Entity 16 Entity 16 polymer

Description description	Tektin-4
Molecular weight formula_weight	52121.4 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D0,D1,D2,D3,D4,D5,T0,T1,T2,T3,T4,T5

MAQTGVLLTKEPAPQSIDVCELPRKEYEVACNTGAYTSSGLATAGFRTAKYLRDEWFQNSYARYHQAFADRDYSERQRHESGQLVAETGALAQRTQLDSTRKVGERLEDMHCWKSELQREIDELSSETDLMMAQKLRLQRALDATSVPYSIATDNLQCRERRQHPDLVRDYVEVELLKETELIRNIQELLKRTIGQAVDQIRLNREHKESCEMNWSDKVEVYNIDDTCSRYTNESTQVQFYPHSSKFEESASTPETWAKFNHDNLLRAERERLASVNLRKLIDCILRDTAEDLRLQCDAVNSAFSSRCQELDDSLQKLQYHLRKTLTEITDQEHQIAALKQAIKDKEAPLRVAQTRLYQRSHRPNVELCRDNAQFRLLSEVEELNMSLRALKEKLQDAEQALRNLEDSRMSLEKDIAVKTNSLFIDRQKCMTHRNRYPSVLQLAGYQ

Entity 17 Entity 17 polymer

Description description	Cilia- and flagella-associated protein 161
Molecular weight formula_weight	34433.4 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,N2

MAQNVYGPGVRMGNWNEDVYLEEERMRHFLEKREKGELLIQRNRRVKKNILRPMQLSVSEDGYVHYGDKVIIVNPDQVLGEEAGKFMRGDLSLCMSPDEVKAQLSDDLEIPCGVSAVQTIAPMGRNTFTILSDGANSCEMGQVVVYGQNFCLGIAAGLEGKMLYLTSDHRTLLKSSLKSGLQEVTLTDEVTHLNCWQAAFLDPQLRLEYEGFPVRANEKIVIYHRHTNRALAVHRNLFLRTYFGKEMEVVAHTYLDSHKVEKPKNQWMLVTGNPRNKSNTMLDISKPITEDTRALEQAMGINT

Entity 18 Entity 18 polymer

Description description	Ciliary microtubule inner protein 1
Molecular weight formula_weight	15610.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ea

MAQKPLSTTAAERMNLVAQDEIWKYRLRAESEARQNWPAKWGYLTTSMKELLEGEEEPQTPKPKPELPSHFYVRPVSPMDKHIKILPSPPVPKTTQGFIGWRSGKPALYCLEKYSEVCSCKGAYARELCWPEQGVH

Entity 19 Entity 19 polymer

Description description	Ciliary microtubule inner protein 3
Molecular weight formula_weight	23717.5 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Fa,Fb,Fc,Fd

MKGDRERQADLSPREGPSVPRPVLLQTEPRSVFPGDTSRPWSPAALPARAPGDRWCGRRRRSPGNASYLDSDISEKSRSASEEEKSHALGACHCAENAFQDSQKSLVPSRGQKMTSGTKAKVPLTALSQKWKRDREQTLEAAYVPVVVDPRGQNPDTSIRFSFYNSQYSNSLNPFYTLQKPTCGYLYQRETDHTRKRFDVPPANLILWRT

Entity 20 Entity 20 polymer

Description description	Piercer of microtubule wall 2 protein
Molecular weight formula_weight	13728.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MARETDCDLDKKTSLTSDAEMRPEPPALCVNPGNPVFSCMLDPKTLHTATSLSKAQMIMYKTSASQYGAFSPRPFFFPCKFLPQEQAFTEHLKTTGFYQNNSLNVGPDRTRTIDSPNYQHTL

Entity 21 Entity 21 polymer

Description description	Ciliary microtubule inner protein 4
Molecular weight formula_weight	30278.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ga

MELSHRQGTTTLTRTHPNDKEGQQDMNSFRANHSSLDNSKFKYHARLSQSPLGSSLGQGYLETPPLPPTPTCRTSLAMNSHPEDLKKGASRSSSRDARETFREGCVGEEGQDSRSPEQRTVPLSKKDSVIPENIRHKFGSKMVDQLISEDQARQAIGEMFEGQKRPSSWPSRTQSPMQASSIFSDYYDLGYHMRSNLFQGPPQETKSLMKASYTPEVIEKSVRDVEHWHGRKTDDLGRWHRKNAMNMNLQKALEEKYGEKSRSKAK

Entity 22 Entity 22 polymer

Description description	Ciliary microtubule inner protein 2A
Molecular weight formula_weight	36659.6 kDa
Source method src_method	nat
Copy count entity_count	16

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,I,J,K,L,M,N,O7,O8,O9,P8,P9,Z2,Z3,Z4,Z5

MTATQKHNLFTPEPHYIPGYAGFYPQLRYQVGNTYGRTTAQLLTDPSVQKSPCSVLSPMTKPKFIEDFSKSKPPWIPCRDLREPYIPHYTSLKPYKNFEILGQLPRQDVDTQGPPQVENRQGPLTAGFMPYPPYPACPPGRKGEARDLGHPGLLLAYGEEAWKDAAPLQDTPGKNNQLYHCRRDEYLPPHPPQETLDVGRFQRLPQLDHPNLIQRKAISGYAGFVPRFAWVMGMNYRDGVTQAMDDFDKNQFVFRHPVCALGERLPRTHWPNTTIYRSQGLIPFYMGFIPSMQDNYALTFGNSTRRAYQKELDRRSHTL

Entity 23 Entity 23 polymer

Description description	Luteinizing hormone beta
Molecular weight formula_weight	34424.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ha,Hb

MAGRTLALRYGPPWSPISETEVLGTWPNWHLTSSGVAHHWIPPASFPLPTLQSMVKAPLPAVSKVISRWETTSQSTYTPKTHGGPCAQPKAPEHKDPRRTLGIKSLAEKLRRHEGRGVPLNTKCQISETKAQYKGWPDVDQSAPLFAEPQPPELADHHRGGPSQALIPWTKNPEMAGQPFTVNKMGILDRLQPYQTITASDFTRNVSGYPHQKPVMGLSWPRKASHRDRASLPRVRPARPRPSQPYLGALSLTRESYGPLVHPLCGMDRICPVHASWGSPHRKPVLGLYSVPKAYCTENSRYGSARAELL

Entity 24 Entity 24 polymer

Description description	Cilia- and flagella-associated protein 68
Molecular weight formula_weight	19552.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I1

MAVSCSLNHSTYLQRQNLVCYLRNPHYGSLIYADGHGEVWTDWNDMSKFLQYGWRCTTNENSYSNRTLVGNWNQERYDLKNIVKPKPLPSQFGHAFETTYDANYSRKKPQSTHRFKREPHWFPGHQPELDPPHYKCTAKSTYMTNYSEPQPTHYSCCVYDPSVSQS

Entity 25 Entity 25 polymer

Description description	Protein SPMIP1
Molecular weight formula_weight	20439.8 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ia,Ib,Ic

MSRQLNMDTLRQNFWKEEYLKEMMLRYEWQRKYGTLVKAKQKAKAASRLPRKLPTLLPQASVAPPPPASKTTPSKAPSPAPEPLFLSDMYPVAPNTKALLYEGISHDLQGRYQYLNTRKLDLPETRYLFPITTNFTYGWQLGPPTKQELVSCKMCRIESFFRKNGAFALLDPRDLAL

Entity 26 Entity 26 polymer

Description description	Cilia- and flagella-associated protein 77
Molecular weight formula_weight	32786.0 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J1,J2,J3,J4,J5

MPDPAKPGKDLTAWKKKKQPVHRTVSQICPPPRRPLTVVDIRTGMENERLGVVRDSMFQNPLIVKAELGKPRERSCSLPGINFNYGLYIRGLDGGVPEAIGHWNVFKQQPTCPHELTRNYIAMNRGAVKAGLVTARENMLYRELNDIRINDQEDRRQKEPPPIPPNMTFGIRSRPSTPFFDLLQHRYQQLWVQEQKATQQAIKMEKKQKVILGKLYETRSSQLRKYKPPVKLDALWHMPHFKKVASHLATFPTEADRQRALKAHKEEYAVRQGTLRMGNYTHP

Entity 27 Entity 27 polymer

Description description	Cilia- and flagella-associated protein 144
Molecular weight formula_weight	16155.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K1,K2

MAGRVGQMKNQDEVHQNQILRELFLKELRAQKLYTQYHVNPLRKVHTITRKPMSWHDNLEEPEDAKFLNLIHHAAQGPKKKYSETQTEAQEIGWDPNPLINPDRQDHRLNHFRVYHDITLYKAKLWSLGEDDHQK

Entity 28 Entity 28 polymer

Description description	Protein SPMIP3
Molecular weight formula_weight	17001.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ka,Kb

MSTIRLREFVERRPSIPPRLYITHQGRDIKGYYPGQLARLHFDYSGRKAPRPLIDLTIPLKSTTPYQPQLDQQTLIRSICSRRLSRPTDLWHNETSYQRDYSLPFYESGWDRKLGTISLHPRPVNSVPEVYCCGGERSSYARSTF

Entity 29 Entity 29 polymer

Description description	Cilia- and flagella-associated protein 90
Molecular weight formula_weight	20886.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L1

MEELAKKERRAMDPGGLKKEGKVEEEAGKEEGREEEGGEEEEVTSETLRGKPRPLPISALPAFSYIPPRHQGPKERSYFSREGQTGIVSLYDCVFKRRLDYNQKLHRDDREHAKNLGLHINEEEQERTVPVLMSSVYGKRINQPIEPLNRDYGHVSHVKTDFYRKNEIPSIKGPGFGHINPA

Entity 30 Entity 30 polymer

Description description	Sperm-associated microtubule inner protein 4
Molecular weight formula_weight	67755.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	La,Lb

MEVIHGRPHCCRNLEGADILSNTFYSNGLHTPYETTIRPTASQARYQELREALPQCRLRWGADREYGGVLPVSLPEEHRPKCEPPRLMSKGHQHYGFGGEIWPKKLPIEQYYYMTQNKKSDVYGNDSLLPKPPNSAVKEICSPYPIEHPYHTHISRGSVFPTFTSPKDLYTGIKARTQQPFPPTVPTKACDTTILKTRGNPYRYELLDFPMDSKKKALTWPGQGVYYDFPKFVEKNKPVFYPKPPKTFAPNSSVNPWDTMSSAKDANIQRNLERSHWLTSYAHDFTGLGPMSPLELDDYHEKELAELTGQIGFDPQPQEKFHPALKTPRPLDGRIARLTQNQRPLEATVQIPPPCPDCTPRVLCAFHTFIPTSAEIMAMNNNLLSGITHKNQDVEEKIKEEQGLMSTCPLPTCYESKDLTSLYDVQSFPKITDTKKTDDLYWRQLEMKPLPISCSKSNHYIDYEPLKSAYRDPYAMCPNPVRLSKSNILQNKTDTADFTFDNFLSKPEFLGMNMESNEETRPLLDWIPRAGVPKHHSNLRNLRNTFSKSMAQKRLHNSIQEEQKDLRDKLQCGMRHQFFGYNGHHFYN

Entity 31 Entity 31 polymer

Description description	Ciliary microtubule inner protein 2C
Molecular weight formula_weight	23098.0 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M1,M2,M3,M4

MAFRSAGTLMTEFNAAFVPPALMPGYKGHVPGVASSFGSSYGNTTFKYFQDLRNTGLEKSYALLSGGCFPTIFSPNSPLVLTDNSQNWDRWLHQPTYSRSNQDNGRTTELTNFYKTVQQQRKYYQDKTGILSRVPYFVLPVKEPDRYPLPTDLPPLSEKSKWNLLRLSPDYKRTYQTFPSGKRVSSQERQRRDLYFEFRA

Entity 32 Entity 32 polymer

Description description	Protein SPMIP7
Molecular weight formula_weight	50476.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ma

MDMEVKTMPGKISIPRRFIFSEGKAIEHPDYPHYSNLLQKMNMPSVKGLEDRHNCVRFEKKCNPTFLKFHPYPPSVLPDYHLHYPYPPPYGRAYPLAPLRDDVPLGDPCSGFMSPGGDANLKPNIGRAIPNLVSFHDVKPQNRVPRPDKGFQTTIKRQTILAEELKQDRRWNSRKVPDISIKAKLGGWTSPMKVVPVPVHEHEVGTLSRIYTFDEEAISTDDSEPLVQLDKKYNIKDSFYKSSTQKAYEDVPWDKMLPPKLDPEETTVEKAADHISQCFSLKRYERLPAITQMVGGLWDRFQTRLFSAPAKPINFVSPSTRSKYIPLYTGHVQSTDADNVDNPYGDIKSVASPRHSKLQYTNSSRSANIPGYTGKVHFTATHPTNSNIPSREPSADSEMNRLLLQEMRVDRFRHQGPMSQMVTTVKPYNPFNKKEKETLEY

Entity 33 Entity 33 polymer

Description description	Sperm microtubule inner protein 8
Molecular weight formula_weight	24985.7 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Na,Nb,Nc,Nd,Ne

MAQIIDLVPWDECSAHLYASPAVLLPLERVRHPLAGVKHQLYHPALPSLRRMDMDTVKGCLSDEHCQSSTYFSKDDFNKAHFTLLGVPNKPLQCLDFTATGQKLCHKYRGGKMIPIAPGINRVDWPCFTRAIEDWSKFVSRSEEFKLPCANKRVEGFSGYAVRYLKPEVTQNWRYCLNQNPSLDRYGQKPLPFDSLNAFRRFGSHYSRINYLTPWH

Entity 34 Entity 34 polymer

Description description	RIB43A-like with coiled-coils protein 1
Molecular weight formula_weight	45032.2 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,P,Q

MYKLDLVSDPRELAAIEARRNREKERQSRFFNVRNRVMGVDVEALNYQVEERKFREAIERNKDIAYGTKHAHYDLVAQMLEKEEAERAYRLSKRVQDFREQRQQQYKNGHEFDFWDPDQFQEFRVPYYEKDAYFGPASMQYFFGEDLERASHVRMQQEQMRYNLEKQLQEQQAAREEEARAALLSDQLRLAADTRAAELARLEESCRAAMRTAMANANKAQAAKQALQQRREQQRQQEANLTEVKKQVTSDLLTENPQVAQRANAPHRVLPYCWKGMSAEQRAAIRKTQETQRQEKKEQRQAEKLVEAEWGRQNKRLAEAALELEEQERELCAEFRRGLGSFNRELAKEQQAQQNYLNSVIYTNQPTAHYYLQFNTSSR

Entity 35 Entity 35 polymer

Description description	Dual specificity phosphatase 21
Molecular weight formula_weight	21527.6 kDa
EC 编号 ec_number	3.1.3.16,3.1.3.48
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O1,O2,O3,O4

MTTASCIFPSQATQQDNIYGLSQITASLFISNSAVANDKLTLSNNHITTIINVSAEVVNTFFEDIQYVQVPVSDAPNSYLYDFFDPIADHIHGVEMRNGRTLLHCAAGVSRSATLCLAYLMKYHNMTLLDAHTWTKTCRPIIRPNNGFWEQLIHYEFKLFSRNTVRMIYSPIGLIPNIYEKEAYLMELM

Entity 36 Entity 36 polymer

Description description	EF-hand domain-containing protein 1
Molecular weight formula_weight	75235.4 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O5,O6,T,U,V

MGTNPVHGLPFLPGSSFTDSTKTAFHRSQTLNYRNGYAVVRRPTMGIGGDRLHYNQLSQAELDELANKAPILTYGPLKQAPLAEFVPAHVAFDKKVLKFSAYFQEDVPISMEEHYRIRHVNIYYYLEDDSMSVIEPVVENSGIPQGKLIKRQRFTKNDMGDHYHWKDLNRGINLTVYGKTFRIVDCDRFTQDFLESQGIELNPSEKIPLDPYTQLRKEPVRKYVTPSDFDQLKQFLTFDKQVLRFYAIWDDTDSLFGECRHYIIHYYLMDDTVEIREVHERNNGRDPFPLLMNRQRMPKVLVENAKNFPKCVLEISDQEVLEWYTAKDFIVGKPLTILGRTFFIYDCDPFTRQFYKDKFGMPDLPPVDVTKKEPPPVKQELPPYNGYGLIEDSAQNCFALIPKAPRKDVVKMLMNDNKVLRYLAALESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKFLGRTKVVKSFSPVDNPIYYSPSDFFIGAVIEVFGHRFVILDTDEYVLKYMESNASQYSPEALASIQNRIQKPELPAPELESKQATGEPMVQGTEESKVQDLDALIDQIHMHLKYNSYKENLRETFQMYDKDESGYVDRETFFKICETLNVPVDDSLIKELIRLCTHGEGRINYYNFVRAFSN

Entity 37 Entity 37 polymer

Description description	Sperm microtubule inner protein 6
Molecular weight formula_weight	29977.2 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Oa,Ob,Oc,Od,Oe,Of,Og,Oh

MFLFSRKTKTPISTYSDSYRAPTSIKEVYKDPPLWAWEANKFVTPGLTQTMHRHVDPEALQKMTKCAAQDYTYKSSISGHPYLPEKYWLSPDEEDKCCPSYLDNDRYNTWKTSPCSNYWNKYTGCLPRLSKDTGMESVRGMPLEYPPKQERLNAYEREVVVNMLNSLSRNRTLPQIVPRCGCVDPLPGRLPYQGYESPCSGRHYCLRGMDYCTTREPSTERRLRPLCSQQPTECVALRSPARNAMCCYNSPAIILPVSQP

Entity 38 Entity 38 polymer

Description description	Sperm microtubule inner protein 11
Molecular weight formula_weight	15528.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P1,P2

MAFFNLYLLGYQHYFQSKKRNTAQETNQKDEVPTRLPPIISEDGNYSVHQNSHERYQEAVRKVLLKTFPNQVFRVPVTDAQNFSFWRSNIPGVRPEKAIPWIKTPHHCLIKSPMTRFVDHSHLNDKTFSLY

Entity 39 Entity 39 polymer

Description description	Protein SPMIP9
Molecular weight formula_weight	21069.1 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P3,P4,P5,P6,P7

MARVVRPQKNHVDLDIYQSSYMVDYKPFGKYKYSRVTPQEQAKLDAQLQSKEFYQPKPNPNPKLEEGYPAFRRPYMTALDLGVPGFFPPQERVTTRKDDGRFTTTCHYAYPASLALYLAQQDPYWLHQRADFPCLMEPERQPAPEVGKGYLLLPGCLCDHHQRVKVPILNRWGPLMPFYQ

Entity 40 Entity 40 polymer

Description description	Tektin bundle-interacting protein 1
Molecular weight formula_weight	23987.3 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q1,Q2,Q3,Q4

MENVRREATRPSVPSGTLELYFPDHLYRNDYVSLEGPRWAPAIKQAVRWKFTPMGRDAAGQVWFTGLTNSEPGDAWYKLPRALDTPYREAHTRWHGCFQSRQRGLPPAYTQHLREMAFWDPAITAQYLNSGPRWGCMQWRDRQIRGKEFVVTRNQFGAKLPWRSDYVPLLSLPQRPRFTAQDFRQRGLQRPCPAIGQPPPAFTPAL

Entity 41 Entity 41 polymer

Description description	RIB43A-like with coiled-coils protein 2
Molecular weight formula_weight	45328.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R,S

MEVAMSKDLQQEANLAKKRYIDLCRQGRIFDARNRIIGGDTQAWDFQVRDQKIKEITDKARHEAFAAEMKHNDKVMCMAHDREQRHRKQLCRAINDFQQNFQKPETRREFDLSDPLALQKELPARISDNDMRNTISGMQKFMGEDLNFQERRRFQKEQSREWFLQQHGEREKARADHLLAEHLHTQTRLKFDETARELMKLEGSTRKEVCAAVKAFNKNQVVELTERKRQEKQQEQEDNMTEITNLLHGDLLSENPRPVASSFGSHRVVLDRWKGMNREQLEEIWFTQKRQIQEKLRLQEEERQHSMDWDLRRIRKAHASLLHERQQQRLLREQRRALDCSNLNLARQQYLQKKQMNTASSSQPTEDYFSQFNTRSR

Entity 42 Entity 42 polymer

Description description	Tektin-5
Molecular weight formula_weight	62817.5 kDa
Source method src_method	nat
Copy count entity_count	26

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U0,U1,U2,U3,U4,U5,U6,U7,U8,U9,V0,V1,V2,V3,V4,V5,V6,V7,V8,V9,W0,W2,W4,W5,W6,W7

MEFLGTTQTASFCGPKKGCGLQALPPAGQEPVVQECYQPFHLPGYRYLNAWRPSVFHKIATSQTIPEECSGIRRPPTILPSLRSALFCRYTPRDWDRSNDLQIRNAEASRLWASRLTGDSLRIMQDKDQLIHQMQEGTSRNLGQRLSDLGFWKSELCYELDRLLTENSSMDTLKRRLECAAEEVNCPLQVALECLYNREKRIGIDLVHDNVEKNLIREVDLLKCCQDQMRKLAKRIDFQIRDNRDAQHSLERDIEDKSSAQYIDENCFNLRSTSDSISFFHGVEKFDGTVSIPETWAKFSNDNIRHAQNMRANSIRLREEAEHLFETLSDQMWKQFTNTNLAFNARISEETDVKNKLQTQLAKILQEIFQAENTIMLLERAIVAKEYPLKMAQTMLACRTRRPNVELCRDVPQFRLVNEVFTIDDTLQTLKLRLRETQDTLQLLVMTKSRLEHELAIKANTLCIDKDKCMSMRKSFPSTPRLTGYTCSAIGSGPYANHAPRISSGPCSGSALCKGPASCGGGASCGGGASCGGHAPCGSALCSHSVSRSGPGFAPVC

Entity 43 Entity 43 polymer

Description description	EF-hand domain-containing family member C2
Molecular weight formula_weight	87758.0 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W,X,Y,Z

MALPFLPGNSFNRNIGKERFHKSQHWGFCNNVRMLVSENKPGVGGDLLYGQKIKPKHSVFPKGDGTDAPSWVAFDKQVLSFDAYLEDEISDKRQEIFRIRYYKIYFYLEDDTIQVNEPEVINSGLPQGTSIRRQRIPYPPPNDDQFYTVYDFNINISVVFYGRTFKIYDCDPFTKNFLKKIGIKLNPPGQCPLDPYMKMRRETLEFVDPFRPYQSFDTLKRFIQYDGKVLRFFCLWDDSTSLFGDRREFVLHYFLCDGTVEIREVLPSNSGRDAMSSFLRRGKLPKYGPPGIYQPGQITDRAVLNVYGGLSEWRADGYLLDKYQLGKVEQDFYTDQDLSIGATINVWGRKVLLCDCDEFTKTYYRTKYGVDNFTPISCKPPHLPKIERKYPPYTGFGSEEDSFRSCVGLKPTPHRKNFKKFMELDSFGNISNILRYFGKLITHKCADVDRIFVIAFYLSDDTISVFEPIENNSGNAGGMFLKRSRVKKPGQEVFKSEFSEYIKAEELYIGATVNINGYLFILLNADEYTLNYMENNTDKFPYSNFELAIQKLKQEKSKSREITQVFAAADYNHTKVVPYNTFRDILMSITMGKLIDQELITIARHYRVPEIMDPDLAYLIARAHEKFKKNIFENFDMFIYNCVYEDREKKGVLPTKDIRRMCKSSRLPLDDDFLDCLLSRFEDKDHQINYEIFFSVLNWRMNPTPDLQAPPYLKEKCEDVWVGMPSPIPVKYVRYLDFLIDVYGLEDNML

Entity 44 Entity 44 polymer

Description description	Stabilizer of axonemal microtubules 4
Molecular weight formula_weight	47873.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X4,X5

MMGKLPLGVVSPYVKMSSGGCSDPLKFYATSYCTAYGREEFKPRLGSHVGTGYKSNYRPLVSYQPHLDTLDNPAIGQQIRDTSKSVTSQSYSPLEVPDGKQPLPWNLHQTTSSYGREKLNPGPHSKEVRKVHFDTQDHGPQTITGLEPKEVPLIHQQQGKGSTEWENSHYGPRFMTSEYNSKYIKESPNHPDLLLKKTIGSKEETGFTEESTKNPIVFQPPSQAFPGDPVLHPGRSITKSDYLPVTHPQGSDFLPVLSRGSDRDTGFSRVNERTLNPRVPTPAPQPASMSHRSYQPPQRMQQTNVALLGRESVGNKEPTGFTLNNPSYVRSSYEQDRDQRYLTTYNQGYFENIPKGLDREGWTRGGIQPQKAGAYALSELNNHTLMDSTPNPTETLRHLHPHVGRTLASVDPFYRDMPHSSRYPASS

Entity 45 Entity 45 polymer

Description description	Testis-specific serine/threonine-protein kinase 6
Molecular weight formula_weight	30332.9 kDa
EC 编号 ec_number	2.7.11.1
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X6,X7,X8

MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRELSILRGVRHPHIVHVFEFIEVCNGKLYIVMEAAATDLLQAVQRNGRIPGSQARELFSQIAGAVRYLHDHHLVHRDLKCENVLLSPDERRVKITDFGFGRQAHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSLGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPDGLELSERCKSLIAELLQFSPSARPSAGQVARNGWLRAGDSG

Entity 46 Entity 46 polymer

Description description	Cilia- and flagella-associated protein 20
Molecular weight formula_weight	22781.4 kDa
Source method src_method	nat
Copy count entity_count	7

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	XB,XC,XD,XE,XF,XG,XH

MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLSDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ

Entity 47 Entity 47 polymer

Description description	Ciliary microtubule associated protein 1A
Molecular weight formula_weight	27691.0 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y0,Y1,Y2,Y3,Y4,Y5,Y6,Y7

MAEEVWMGTWRPHRPRGPIMALYSSPGPKYLIPPTTGFVKHTPTKLRAPAYSFRGAPMLLAENCSPGPRYSVNPKILKTGKDLGPAYSILGRYHTKTLLTPGPGDYFPEKSTKYVFDSAPSHSISARTKTFRVDSTPGPAAYMLPVVMGPHTVGKVSQPSFSIKGRSKLGSFSDDLHKTPGPAAYRQTEVQVTKFKAPQYTMAARVEPPGDKTLKPGPGAHSPEKVTLNKPCAPTVTFGIKHSDYMTPLVVDVE

Entity 48 Entity 48 polymer

Description description	Parkin coregulated gene protein homolog
Molecular weight formula_weight	27763.3 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	YA,YB,YC,YD,YE,YF,YG,YH

MPKRTKLLPQQTFQVHQPRSLVSEGFTVKAMMKNSVVRGPPVAGAFKERPAKPTTFRKCYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLSEMTFPYEFFARRGIHDMLEHGGNKILPVIPQLIIPIKNALNLRNRQIICVTLKVLQHLVVSSEMVGEALLPYYRQILPILNIFKNMNVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGEDAFINIKYMVPTYESCLLN

Entity 49 Entity 49 polymer

Description description	Cilia- and flagella-associated protein 45
Molecular weight formula_weight	65962.0 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,a6,b,c,d

MPLRPGDASSSASTASNRSRTRTRYRTKAMNSEVDESLFGGVKPSSQGKSDSPIVVIHDKHAIRKTLSALGLEHKTETIQLITRDMVRELIVPTEDPSGESLIISPEEFERIKWASQVLTKEELNAREQALKKEKEGILEAVTIRKKIMKQKEMTWNNNKKLSDLEEVARERAQNLLQRADKLRMEQEEELKDMSKIILNAKCHAIRDAQILEKQQIQKELDEEERRLDHMMEIDRRESLQRQEDRERKRREERVRGKRHIVEQIKKNEEERSLQAEHREQEKEQMLAYLDRLQEEDLQDLERRHQEKLKMQAEIKRINDENQRQKAEMLAQERLADQMVMEFTKKKMAREAEYEAEQEKIRREKEKEIARLRALQEKAQDYQAEQDALRAKRNQEVADREWRRKEKENAQKKIETEEKLRKSRLEQVAFKEHTLAVQVQRDRDEFERILRAQREQIEREKQEQEKKAKGCLQHANELRRQVRENQQKHVQNRLATFEEGRRLKEEAEKRRERIEDIKKQKLEELRATGLPEKYCIEVERKANILPATSVN

Entity 50 Entity 50 polymer

Description description	Sperm-associated microtubule inner protein 5
Molecular weight formula_weight	25847.5 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a1,a2,a3,a4

MESPKTFMRKLPITPGYCGFIPWLSCQESSSEDRMNPCVKAFQERTQRYKEDQQGLNCSVANTPPLKPICSEDTVLWVLHEYAKKYHPLTLECKNEKKPLQEPPIPGWAGYLPRARVTEFGYATRYTIMAKKCYKDFLDLVEQAKRAQLKPYEQTYDVRAAQPLSPSSKILQLQGLSPAFPEFSGPGQTPPSEDPQAPRPCGCAQWSSQSCSRNVYGEPPSLAKAFAES

Entity 51 Entity 51 polymer

Description description	Tektin-like protein 1
Molecular weight formula_weight	57406.5 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b1,b2,b3,b4,b5

MPVLLPSTDPGQDSRVGAPEWRQAAKATSRKAHLLTDRCGQEAVTMWQPKDSVLDPNVAHHLGRAAYMEPWRFRVEMLKGGGTLEKPPPGEGVTLWKGKMKPPAWYARLPLPMHRDARAQQTAEVVHAHARGARLTAARLGRAQHQINGQLRLLLRQREATDRRLSEVRKGLLINQQSVKLRGYRPKCEKIPDKADSLLVWEKKELKSMKRKMEKDMEISEDLLKALASCRDTLDFYCQERLQAVELMNQPLDKVLEQAGRHSWVDITRPPTPRTQGLKTPPPDPIGTYTPACAKALFEAKRLLMESKDILTEMAKNEVDIQNQQQEISNRVCSSLAQKMRETLELKERMTMTLGLMRGTIHRCMKFNQEMYVTRGIIKGPLLKRNLEAREKLNRPLVRMYQRHVGTQLPEATRLAQGTDLLTRHNLHMEKNLKELRTTHDNLAWGLNCKKIGHDVDYDVVRLRLRQRHPHVCYEQAQRLVNDWDPPTPARSQTNTASK

Entity 52 Entity 52 polymer

Description description	Cilia- and flagella-associated protein 52
Molecular weight formula_weight	68322.2 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e,f,g

MEEQVLPELDVAELELQAVIGFNGHVPNGLKCHPDQEHLIYPLGCTVLIQAINTNEQNFLHGHGNNVSCVTISKEGDYIASGQVTFMGFKADIILWDFKKRELIARLSLHKGKIEALAFSPNDLYLVSLGGPDDGSVVVWSIAKRDAICGSPAAGLNVGNATSVVFSRCRDEMFVTAGNGTIRVWELDLPNRKIWPTECQTGQMKRIVLSTGMADDDSFFYLGTTTGDILKMNPKTKLLADTGPVKDKFSLGVSALRCLKMGGLLVGSGAGLLIFCKSPSYKPIKKVQLQGGITSITLRGEGHQFFVGTEESHIYRVNFTDFKETLIATCHFEAVQDIVFPFGTAELFATCAKKDIRVWHTMSKRELLRITVPNMTCHGIDFMRDGKSIISAWDDGKIRAFAPESGRLMYTINSAHRIGVTAIATTSDCKRIISGGGEGEVRVWQVGCQTQKLEEALKEHKSSVSCIRVKKNNEECVTASTDGTCIIWDLVRLRRNQMILANTLFQCVCYHPEEFQIITSGTDRKIAYWEVFDGSVIRELEGSLSGSINGMDITQEGGHFVTGGHDHLVKVWDYNEGEVTHVGVGHSGNIMAMRISPGNQYIVSVSADGAILRWKYPFAS

Entity 53 Entity 53 polymer

Description description	Enkurin
Molecular weight formula_weight	29587.5 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h,i,j,k

MDSPCTSESIYNLIPSDLKEPPQHPRYTSLFRATIKNDMKKFKTAMKTMGPAKVEIPSPKDFLKKHSKEKTLPPKKKFNRCSPKKPAVPLRTDHPVMGIQSGKNFINTNAADVIMGVAKKPKPIYVDKRTGDKHDLETSGLFPKYINKKDYGITPEYICKRNEDVKKAQEEYDNYIQENLKKAAMKRLSDEEREAVLQGLKKNWEEVHKEFQSLSVFIDSVPKKIRKQKLEKEMKQLEHDISVIEKHKIIYIANK

Entity 54 Entity 54 polymer

Description description	Sperm-associated microtubule inner protein 10
Molecular weight formula_weight	16305.6 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h1,h2,h3,h4

MASEKDDGPALPKLDDDNQTAENTCKPAEEQPQQLRWDDIHLPRFSLKQGMIPTRYVMPWKENMKFRNVNLQQAEACGIYAGPLEDSLFWGYSERLCHGEDRKAVLKKGLPEIKITDMPLHSPLSRYQSTVISHGFRRRLI

Entity 55 Entity 55 polymer

Description description	Protein Flattop
Molecular weight formula_weight	20575.1 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i1,l,m,n

MATNYSANQYEKAYLPTYLQNWSPARPTKEKIAAHEGYTQIIANDRGHLLPSVPRSKASPWGSFMGTWQMPLKIPPAKVTLTARTTTAADNLTKWIHKNPDLLNACNGLRPEISGKPFDPDSQTKQKKSVTKTVQQAPNPTIIPSSPVIQGDNPDEPQSSHPSAGHTPGPQTPVNSPNNPPPSPCKSTK

Entity 56 Entity 56 polymer

Description description	EF-hand calcium-binding domain-containing protein 6
Molecular weight formula_weight	176028.3 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i2,i3,i4

MKRNGTRLNFAKANSTKSGSTRARDLMNKMSIIPEWHSLYSNTRKLPCSRPHSSPCKMQRTIFQDLCRPSSSTTAIANPVLSYLDIERILAQKISSRRDDIKKVFQILDRNHNQMVTKGDLKRVITAFLIPLTKDQFQDLLAQIPISSLGNVPYLEFLSRFGGGIDININGIKRVNENEVDNRRTVKEVQLTEKIFRNMRSIRKVFQVMDVNNTGLVQPQELRRVLETFCLRMQDGDYEKFLEQYNIDKTTAVDYNAFLKNLSVKNDASFKYLLSNAAELSRETQQGKNGKRLLDTGSSEDVWKNYSLDDLEKTFCQEFSKSYEKIEKALSAGDPSKGGYISLNYLKVVLDTFIYRLPRRIFIQLIRRFGLKTSTKINWKQFLTAIYERQKLEVSKTLPLKKRSSTEARNRSRKENIIKKLFKYSEDRYTALKKTLLIISSTPSGHITWEELRHILNCMVAKLNDSEFSELKQTFDPEGTGAVRVNSLLDVLDDSTKVRKMSPSTDTKTPLPVAWDSVEELVLDSITRNLQAFYSMLQSYDLRDTGTIGKNNFRKVMRVFCPYLSNEHLVRFSSKFQEAGSGRILYKKFLLSIGVGIPPPTPPLSSPKVQLSDQFQIEEPGQQDERTQPSGEKTSEINNMTKEEVIDGLKHRIQQKDPVFRKQFLSISKEPDVKINQEEFRKVLERSGMPMNDCQYAMLASKLGFKNEEGMSYQDFTMGFEDCMLSGLETVPLQSRTASRTNMDEHFISAEECLRIFPKKLKESFRDVYSAFFRIDLDRDGIISMHDFHRLLQYLQLNMVDLEFERFLSLLGLRLSVTLNFREFQNLCEKRPWKSDEAPQRLIRCKQKVADSELACEQAHQYLIMKAKTRWADLSKNFIETDNEGNGILRRRDIKNSLYGFDIPLTPREFEKLWQNYDTEGRGYITYQEFLHRLGIRYSPKVHRPYKEDYFNFLGHFTKPKQVQEEIQELQQISEREKLMNHYEEISKAFNAMEKSKPVALCRVQKVLQECGCPLKEEELISLLKSLDVSVHNNHIDPVEFLRALEISWASKARPKEKEESSPPPISFSKVTPDEVIKTMQEVVESSQPALVEAFSALDKEDTGFVKAMEFGDVLRSVCQKLTDNQYHYFLRRLRLHLTPNIHWKYFLENFSTFQDETADDWAENMPKAPPPMSPKETAHRDIVARVQKAVASHYHTIVQEFENFDTLKSNTVSRDEFRSICTRHIQILTDEQFDRLWSELPVNAKGRLKYQDFLSKLSIERVPSPPMAAGDSGESTMAQRGSSAPEFSQGTRSNLYSPPRDSRVGLKSRSHPCTPVGTPPLQNCEPIESRLRKQIQGCWRELLRECKEKDTDKQGTISAAEFLALVEKFKLDISREESQQLIVKYDLKNNGKFAYCDFIQSCVLLLKAKETSLMRRMRIQNADKMKEAGMETPSFYSALLRIQPKIVHCWRPMRRSFKTYDKNGTGLLSVADFRKVLRQYSINLSEEEFFHVLEYYDKSLSSKISYNDFLRAFLQ

Entity 57 Entity 57 polymer

Description description	Cilia- and flagella- associated protein 210
Molecular weight formula_weight	65266.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o,p

MQVRFGRRSGQAKESQGMDCFEKEEIPYPPLLPSKVDLQQITIIPHAEWERIRDSLNRLTREAAVLRAERAAKKKMHVKSQELVKHWTNTYAGMKEQKLKAKQKRDEEIEAERKVLDLEEEIYKEGERKKAIESARQCQFHQTERVKRFHSGLLLSRVMKERDVQIQYKKNAVKSDKKWEEQVKLNDEKAFKEDQEKEEKRRRERVALAEDHLKQIEEHKEEEEARKKSEEKDAEEMKRQNLLYEIEMKKNLSKKQEEIDTNRKLLLDNMHNKNIIRAVEQQQQEEEDEKIRKFIKAKKRLIQMRMDKDAETHRLMEERRERINNFLSKLIKEKLDTEDLIIARDISEADAELEKREKEKHEKNQADLKAIAEYRASVMKNKEEEERQRKIEAKEQLQAVLKADKIFQELEKEKSLKVTREKLEIQDAHIQQIAINKYNAKQMKEEELDYWRLTDALTVEKEKEFEKYAREVINFESESTKKYAYPMVKAVQEGVGGGRGPPFVGRGGIRPSYQATDATGVQLPCFKSQGSKYNDFQKSKRRLGFTW

Entity 58 Entity 58 polymer

Description description	Cilia- and flagella-associated protein 276
Molecular weight formula_weight	18960.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q,r,s

MLQPQETFSNPALRDEDKHLGNLWASKKSLYKNPAHLAQQQDPWSRLSSTPTATSRSRDTFFDSKIPKDDLDFRLATLYNHHTGAFKNKTEILLHQETIEDIQGTKIQFPGECFHAPSAPITSRTTIRHWINPKKESIHSIQGSIVSPHTAATNGGYSRKNDGGFFST

Entity 59 Entity 59 polymer

Description description	Piercer of microtubule wall 1 protein
Molecular weight formula_weight	18862.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	y

MSEEKPQQSAEEPEPGEPKAKPAPEEPEPGEPKAKPAPEEPEPGEPKAKPAPEKTSDYYRISEKLPVRFNNPGWFHGYGTKEAVSMYRTSNQTYGSRAPTVHEMPKVFYPSSNKFSRQHAAFGMFQSHNINVTLEKSLVTGPDNHITHYDRLNFHPSYNVNRPSICD

Entity 60 Entity 60 polymer

Description description	Sperm microtubule inner protein 2
Molecular weight formula_weight	22372.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	ke

MALSHREPHCETVGKRMIVTGPDYVKDHLPKVHQHTAYIGEKRPALEKTGDLRYLWRPASNRSLPAKYKHEYTCGIGWGIPQYSFFNRSRVESGFHIQHGELSLRAMDKITHRYQNPWQPKAFVLNKQLGYSRGFLAWNMSDYEDIEQRNSKRAILVKQSKLIRSNLPSRLPKLQEKKKWKFNSQDKYF

Entity 61 Entity 61 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	167

Entity 62 Entity 62 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	170

Entity 63 Entity 63 non-polymer

Description description	GUANOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	443.2 kDa
Source method src_method	syn
Copy count entity_count	170

Entity 64 Entity 64 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	3

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.70 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	83043

Cryo-EM structure of the 48-nm repeat doublet microtubule from mouse sperm

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cilia- and flagella-associated protein 95

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

EF-hand domain-containing family member B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cilia- and flagella-associated protein 53

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Nucleoside diphosphate kinase homolog 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cilia- and flagella-associated protein 107

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cilia- and flagella-associated protein 141

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tektin-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tubulin alpha-3 chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tubulin beta-4B chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Sperm axonemal maintenance protein CFAP97D1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer