1fqk

CRYSTAL STRUCTURE OF THE HETERODIMERIC COMPLEX OF THE RGS DOMAIN OF RGS9, AND THE GT/I1 CHIMERA ALPHA SUBUNIT [(RGS9)-(GT/I1ALPHA)-(GDP)-(ALF4-)-(MG2+)]

Method: X-RAY DIFFRACTION D_max: 115.0 Å Quality: REASONABLE

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

;Guanine nucleotide-binding protein G(t) subunit alpha-1,Guanine nucleotide-binding protein G(i) subunit alpha-1,Guanine nucleotide-binding protein G(t) subunit alpha-1 ;

Bos taurus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 26–215 Chain A； UniProt 295–350	Fragment：UNP P04695 residues 26-215 and 295-350 linked via UNP P10824 residues 220-298	Regulator of G-protein signaling 9 × 1 （O46469） MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；10.5% PEG8000, 110mM magnesium acetate, 50mM Tris pH 8.5, 0.2% beta-ME, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.30 Å R-free 0.268
2	Insufficient information Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain C； UniProt 26–215 Chain C； UniProt 295–350	Fragment：UNP P04695 residues 26-215 and 295-350 linked via UNP P10824 residues 220-298	Regulator of G-protein signaling 9 × 1 （O46469） MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；10.5% PEG8000, 110mM magnesium acetate, 50mM Tris pH 8.5, 0.2% beta-ME, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.30 Å R-free 0.268

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1FQK	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1AQG NMR STRUCTURE OF THE RHODOPSIN-BOUND C-TERMINAL PEPTIDE OF THE TRANSDUCIN ALPHA-SUBUNIT, 20 STRUCTURES Deposited 1997-07-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 339–349（11 aa） Fragment：RHODOPSIN BINDING DOMAIN, RESIDUES 340-350	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.5；274 K；Ionic strength (raw mmCIF value) 120；Pressure AMBIENT NMR sample composition 20 mM sodium phosphate, 100 mM KCl, 0.1 mM EDTA, 1 mM DTT, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
1FQJ CRYSTAL STRUCTURE OF THE HETEROTRIMERIC COMPLEX OF THE RGS DOMAIN OF RGS9, THE GAMMA SUBUNIT OF PHOSPHODIESTERASE AND THE GT/I1 CHIMERA ALPHA SUBUNIT [(RGS9)-(PDEGAMMA)-(GT/I1ALPHA)-(GDP)-(ALF4-)-(MG2+)] Deposited 2000-09-05	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 26–215（190 aa） Fragment：UNP P04695 residues 26-215 and 295-350 linked via UNP P10824 residues 220-298 Chain A 295–350（56 aa） Fragment：UNP P04695 residues 26-215 and 295-350 linked via UNP P10824 residues 220-298	Not recorded	MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；277 K；15.0% PEG8000, 200mM Tris pH9.0, 0.2% beta-ME, 1mM (NH4)2WS4, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.02 Å R-free 0.265
1FQJ CRYSTAL STRUCTURE OF THE HETEROTRIMERIC COMPLEX OF THE RGS DOMAIN OF RGS9, THE GAMMA SUBUNIT OF PHOSPHODIESTERASE AND THE GT/I1 CHIMERA ALPHA SUBUNIT [(RGS9)-(PDEGAMMA)-(GT/I1ALPHA)-(GDP)-(ALF4-)-(MG2+)] Deposited 2000-09-05	Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 26–215（190 aa） Fragment：UNP P04695 residues 26-215 and 295-350 linked via UNP P10824 residues 220-298 Chain D 295–350（56 aa） Fragment：UNP P04695 residues 26-215 and 295-350 linked via UNP P10824 residues 220-298	Not recorded	MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；277 K；15.0% PEG8000, 200mM Tris pH9.0, 0.2% beta-ME, 1mM (NH4)2WS4, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.02 Å R-free 0.265
1GOT HETEROTRIMERIC COMPLEX OF A GT-ALPHA/GI-ALPHA CHIMERA AND THE GT-BETA-GAMMA SUBUNITS Deposited 1996-08-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–349（349 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；277 K；10 MG/ML OF HETEROTRIMERIC COMPLEX WERE MIXED 1:1 WITH WELL SOLUTION CONTAINING 10% PEG-8000, 50 MM TRIS, PH 8.0, 10% GLYCEROL, 50 MM NACL, .1 MM MERCAPTOETHANOL. MIXTURE EQUILIBRATED VS WELL SOLUTION IN HANGING DROPS AT 4 DEGREES C., vapor diffusion - hanging drop, temperature 277K	Resolution 2.00 Å R-free 0.295
1LVZ METARHODOPSIN II BOUND STRUCTURE OF C-TERMINAL PEPTIDE OF ALPHA-SUBUNIT OF TRANSDUCIN Deposited 2002-05-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 339–349（11 aa） Fragment：S2 Peptide, Residues 339-349	Mutation：K340R, C346S	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.6；283 K；Ionic strength (raw mmCIF value) 10 mM HEPES, 20 mM KCl；Pressure ambient NMR sample composition 2.6mM S2 peptide U-15N, 0.063mM rhodopsin as part of intact disk membranes from bovine retina; buffer: 10 mM HEPES, 20mM KCl, 0.05mM DTPA \| 90% H2O/10% D2O NMR sample composition 2.6mM S2 peptide U-15N, 13C, 0.063mM rhodopsin as part of intact disk membranes from bovine retina; buffer: 10 mM HEPES, 20mM KCl, 0.05mM DTPA \| 90% H2O/10% D2O	Resolution not provided
1TAD GTPASE MECHANISM OF GPROTEINS FROM THE 1.7-ANGSTROM CRYSTAL STRUCTURE OF TRANSDUCIN ALPHA-GDP-ALF4- Deposited 1995-01-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 26–349（324 aa）	Not recorded	CA CALCIUM ION × 1 CAC CACODYLATE ION × 2 ALF TETRAFLUOROALUMINATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.70 Å R-free 0.266
1TAD GTPASE MECHANISM OF GPROTEINS FROM THE 1.7-ANGSTROM CRYSTAL STRUCTURE OF TRANSDUCIN ALPHA-GDP-ALF4- Deposited 1995-01-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 26–349（324 aa）	Not recorded	CA CALCIUM ION × 1 CAC CACODYLATE ION × 2 ALF TETRAFLUOROALUMINATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.70 Å R-free 0.266
1TAD GTPASE MECHANISM OF GPROTEINS FROM THE 1.7-ANGSTROM CRYSTAL STRUCTURE OF TRANSDUCIN ALPHA-GDP-ALF4- Deposited 1995-01-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 26–349（324 aa）	Not recorded	CA CALCIUM ION × 1 CAC CACODYLATE ION × 2 ALF TETRAFLUOROALUMINATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.70 Å R-free 0.266
1TAG STRUCTURAL DETERMINANTS FOR ACTIVATION OF THE ALPHA-SUBUNIT OF A HETEROTRIMERIC G PROTEIN Deposited 1994-11-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 26–349（324 aa）	Not recorded	MG MAGNESIUM ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.80 Å R-free 0.211
1TND THE 2.2 ANGSTROMS CRYSTAL STRUCTURE OF TRANSDUCIN-ALPHA COMPLEXED WITH GTP GAMMA S Deposited 1994-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 26–349（324 aa）	Not recorded	MG MAGNESIUM ION × 1 CAC CACODYLATE ION × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.20 Å
1TND THE 2.2 ANGSTROMS CRYSTAL STRUCTURE OF TRANSDUCIN-ALPHA COMPLEXED WITH GTP GAMMA S Deposited 1994-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 26–349（324 aa）	Not recorded	MG MAGNESIUM ION × 1 CAC CACODYLATE ION × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.20 Å
1TND THE 2.2 ANGSTROMS CRYSTAL STRUCTURE OF TRANSDUCIN-ALPHA COMPLEXED WITH GTP GAMMA S Deposited 1994-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 26–349（324 aa）	Not recorded	MG MAGNESIUM ION × 1 CAC CACODYLATE ION × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.20 Å
2X72 CRYSTAL STRUCTURE OF THE CONSTITUTIVELY ACTIVE E113Q,D2C,D282C RHODOPSIN MUTANT WITH BOUND GALPHACT PEPTIDE. Deposited 2010-02-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 340–350（11 aa） Fragment：RESIDUES 340-350	Mutation：YES	PEF DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 2 BOG octyl beta-D-glucopyranoside × 2 PLM PALMITIC ACID × 4 RET RETINAL × 2 LPP 2-(HEXADECANOYLOXY)-1-[(PHOSPHONOOXY)METHYL]ETHYL HEXADECANOATE × 2 ACT ACETATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.5；3.0-3.4 M AMMONIUM SULFATE, 100 MM SODIUM ACETATE PH 4.5	Resolution 3.00 Å R-free 0.244
3DQB Crystal structure of the active G-protein-coupled receptor opsin in complex with a C-terminal peptide derived from the Galpha subunit of transducin Deposited 2008-07-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 340–350（11 aa） Fragment：C-terminal domain, UNP residues 340-350	Mutation：K341L	BOG octyl beta-D-glucopyranoside × 3 PLM PALMITIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；277 K；AMMONIUM SULFATE, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.20 Å R-free 0.248
3PQR Crystal structure of Metarhodopsin II in complex with a C-terminal peptide derived from the Galpha subunit of transducin Deposited 2010-11-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 340–350（11 aa） Fragment：C-terminal peptide (UNP residues 340-350)	Mutation：K341L,C347V	RET RETINAL × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 BOG octyl beta-D-glucopyranoside × 2 PLM PALMITIC ACID × 1 SO4 SULFATE ION × 1 ACT ACETATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.6；277 K；ammonium sulfate, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.85 Å R-free 0.250
3PQR Crystal structure of Metarhodopsin II in complex with a C-terminal peptide derived from the Galpha subunit of transducin Deposited 2010-11-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 340–350（11 aa） Fragment：C-terminal peptide (UNP residues 340-350)	Mutation：K341L,C347V	RET RETINAL × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 BOG octyl beta-D-glucopyranoside × 4 PLM PALMITIC ACID × 2 SO4 SULFATE ION × 2 ACT ACETATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.6；277 K；ammonium sulfate, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.85 Å R-free 0.250
3V00 Studies of a constitutively active G-alpha subunit provide insights into the mechanism of G protein activation. Deposited 2011-12-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1–215（215 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298 Chain C 295–350（56 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298	Mutation：G56P, K244H and D247N Mutation：G56P, K244H and D247N	GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.3；295 K；1.9 M Ammonium Sulphate in 0.05 M Sodium Cacodylate buffer, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.90 Å R-free 0.272
3V00 Studies of a constitutively active G-alpha subunit provide insights into the mechanism of G protein activation. Deposited 2011-12-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–215（215 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298 Chain B 295–350（56 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298	Mutation：G56P, K244H and D247N Mutation：G56P, K244H and D247N	GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.3；295 K；1.9 M Ammonium Sulphate in 0.05 M Sodium Cacodylate buffer, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.90 Å R-free 0.272
3V00 Studies of a constitutively active G-alpha subunit provide insights into the mechanism of G protein activation. Deposited 2011-12-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–215（215 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298 Chain A 295–350（56 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298	Mutation：G56P, K244H and D247N Mutation：G56P, K244H and D247N	GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.3；295 K；1.9 M Ammonium Sulphate in 0.05 M Sodium Cacodylate buffer, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.90 Å R-free 0.272
3V00 Studies of a constitutively active G-alpha subunit provide insights into the mechanism of G protein activation. Deposited 2011-12-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Insufficient information Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–215（215 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298 Chain A 295–350（56 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298 Chain B 1–215（215 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298 Chain B 295–350（56 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298 Chain C 1–215（215 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298 Chain C 295–350（56 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298	Mutation：G56P, K244H and D247N Mutation：G56P, K244H and D247N Mutation：G56P, K244H and D247N Mutation：G56P, K244H and D247N Mutation：G56P, K244H and D247N Mutation：G56P, K244H and D247N	GDP GUANOSINE-5'-DIPHOSPHATE × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.3；295 K；1.9 M Ammonium Sulphate in 0.05 M Sodium Cacodylate buffer, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.90 Å R-free 0.272
3V00 Studies of a constitutively active G-alpha subunit provide insights into the mechanism of G protein activation. Deposited 2011-12-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Insufficient information Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 1–215（215 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298 Chain A 295–350（56 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298 Chain B 1–215（215 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298 Chain B 295–350（56 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298 Chain C 1–215（215 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298 Chain C 295–350（56 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298	Mutation：G56P, K244H and D247N Mutation：G56P, K244H and D247N Mutation：G56P, K244H and D247N Mutation：G56P, K244H and D247N Mutation：G56P, K244H and D247N Mutation：G56P, K244H and D247N	GDP GUANOSINE-5'-DIPHOSPHATE × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.3；295 K；1.9 M Ammonium Sulphate in 0.05 M Sodium Cacodylate buffer, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.90 Å R-free 0.272
3V00 Studies of a constitutively active G-alpha subunit provide insights into the mechanism of G protein activation. Deposited 2011-12-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–215（215 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298 Chain A 295–350（56 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298 Chain C 1–215（215 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298 Chain C 295–350（56 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298	Mutation：G56P, K244H and D247N Mutation：G56P, K244H and D247N Mutation：G56P, K244H and D247N Mutation：G56P, K244H and D247N	GDP GUANOSINE-5'-DIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.3；295 K；1.9 M Ammonium Sulphate in 0.05 M Sodium Cacodylate buffer, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.90 Å R-free 0.272
3V00 Studies of a constitutively active G-alpha subunit provide insights into the mechanism of G protein activation. Deposited 2011-12-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 1–215（215 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298 Chain B 295–350（56 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298	Mutation：G56P, K244H and D247N Mutation：G56P, K244H and D247N	GDP GUANOSINE-5'-DIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.3；295 K；1.9 M Ammonium Sulphate in 0.05 M Sodium Cacodylate buffer, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.90 Å R-free 0.272
4BEY Night blindness causing G90D rhodopsin in complex with GaCT2 peptide Deposited 2013-03-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 340–350（11 aa） Fragment：RESIDUES 340-350	Mutation：YES	SO4 SULFATE ION × 1 ACT ACETATE ION × 1 PLM PALMITIC ACID × 1 BOG octyl beta-D-glucopyranoside × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å R-free 0.259
4J4Q Crystal structure of active conformation of GPCR opsin stabilized by octylglucoside Deposited 2013-02-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 340–350（11 aa） Fragment：C-terminal derived peptide, UNP RESIDUES 340-350	Mutation：K341L, C347V	BOG octyl beta-D-glucopyranoside × 4 PLM PALMITIC ACID × 1 SO4 SULFATE ION × 2 ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.6；277 K；AMMONIUM SULFATE, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.65 Å R-free 0.230
6OY9 Structure of the Rhodopsin-Transducin Complex Deposited 2019-05-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–201（201 aa）	Not recorded	RET RETINAL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
6OYA Structure of the Rhodopsin-Transducin-Nanobody Complex Deposited 2019-05-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 1–201（201 aa）	Not recorded	RET RETINAL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；Blot for 1 second before plunging; avoid light as much as possible.	Resolution 3.30 Å
7JSN Structure of the Visual Signaling Complex between Transducin and Phosphodiesterase 6 Deposited 2020-08-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–215（215 aa） Chain E 295–350（56 aa） Chain F 1–215（215 aa） Chain F 295–350（56 aa）	Mutation：R174C,Q200L Mutation：R174C,Q200L Mutation：R174C,Q200L Mutation：R174C,Q200L	ZN ZINC ION × 2 MG MAGNESIUM ION × 2 VDN 2-{2-ETHOXY-5-[(4-ETHYLPIPERAZIN-1-YL)SULFONYL]PHENYL}-5-METHYL-7-PROPYLIMIDAZO[5,1-F][1,2,4]TRIAZIN-4(1H)-ONE × 2 35G GUANOSINE-3',5'-MONOPHOSPHATE × 2 GTP GUANOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8；20 mM Tris pH 8.0, 5 mM MgCl2 and 1 uM vardenafil cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å

16 other PDB entries and 28 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	GNAT1_BOVIN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–190； UniProt 26–215 Author chain A； PDBConstruct 270–325； UniProt 295–350 Author chain C； PDBConstruct 1–190； UniProt 26–215 Author chain C； PDBConstruct 270–325； UniProt 295–350

;Guanine nucleotide-binding protein G(t) subunit alpha-1,Guanine nucleotide-binding protein G(i) subunit alpha-1,Guanine nucleotide-binding protein G(t) subunit alpha-1 ;

Bos taurus

UniProt P10824

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 220–298	Fragment：UNP P04695 residues 26-215 and 295-350 linked via UNP P10824 residues 220-298	Regulator of G-protein signaling 9 × 1 （O46469） MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；10.5% PEG8000, 110mM magnesium acetate, 50mM Tris pH 8.5, 0.2% beta-ME, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.30 Å R-free 0.268
2	Insufficient information Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain C； UniProt 220–298	Fragment：UNP P04695 residues 26-215 and 295-350 linked via UNP P10824 residues 220-298	Regulator of G-protein signaling 9 × 1 （O46469） MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；10.5% PEG8000, 110mM magnesium acetate, 50mM Tris pH 8.5, 0.2% beta-ME, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.30 Å R-free 0.268

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 1FQK	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1AGR COMPLEX OF ALF4-ACTIVATED GI-ALPHA-1 WITH RGS4 Deposited 1997-03-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–353（353 aa） Fragment：ALPHA-1	Not recorded	MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 CIT CITRIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.3；THE COMPLEX WAS CRYSTALLIZED IN HANGING DROPS USING PEG 10000 AS THE PRECIPITANT AND SODIUM CITRATE PH 5.3 AS THE BUFFER., vapor diffusion - hanging drop	Resolution 2.80 Å R-free 0.291
1AGR COMPLEX OF ALF4-ACTIVATED GI-ALPHA-1 WITH RGS4 Deposited 1997-03-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–353（353 aa） Fragment：ALPHA-1	Not recorded	MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 CIT CITRIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.3；THE COMPLEX WAS CRYSTALLIZED IN HANGING DROPS USING PEG 10000 AS THE PRECIPITANT AND SODIUM CITRATE PH 5.3 AS THE BUFFER., vapor diffusion - hanging drop	Resolution 2.80 Å R-free 0.291
1AS0 GTP-GAMMA-S BOUND G42V GIA1 Deposited 1997-08-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–353（353 aa）	Mutation：G42V	MG MAGNESIUM ION × 1 SO4 SULFATE ION × 1 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；THE PROTEIN WAS CRYSTALLIZED IN HANGING DROPS USING 4M (NH4)2SO3 AS THE PRECIPITANT. 50 MM HEPES, PH 8.0, 10 MM MGSO4, 10 MM DTT AND 0.2 MM GTP-GAMMA-S WAS THE BUFFER., vapor diffusion - hanging drop	Resolution 2.00 Å R-free 0.259
1AS2 GDP+PI BOUND G42V GIA1 Deposited 1997-08-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–353（353 aa）	Mutation：G42V	PO4 PHOSPHATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.6；THE PROTEIN WAS CRYSTALLIZED IN HANGING DROPS USING 3M (NH4)H2P04 AS THE PRECIPITANT (PH 5.6). 50 MM HEPES, PH 8.0, 10 MM MGSO4, 10 MM DTT AND 5 MM GDP WAS THE BUFFER, vapor diffusion - hanging drop	Resolution 2.80 Å R-free 0.250
1AS3 GDP BOUND G42V GIA1 Deposited 1997-08-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–353（353 aa）	Mutation：G42V	SO4 SULFATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；THE PROTEIN WAS CRYSTALLIZED IN HANGING DROPS USING 4M (NH4)2SO3 AS THE PRECIPITANT. 50 MM HEPES, PH 8.0, 10 MM MGSO4, 10 MM DTT AND 5 MM GDP WAS THE BUFFER., vapor diffusion - hanging drop	Resolution 2.40 Å R-free 0.274
1BH2 A326S MUTANT OF AN INHIBITORY ALPHA SUBUNIT Deposited 1998-06-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 31–345（315 aa）	Mutation：A326S	MG MAGNESIUM ION × 1 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；PROTEIN WAS CRYSTALLIZED FROM 0.1M SODIUM ACETATE, PH 6.0, 2.0-2.1 M AMMONIUM SULFITE	Resolution 2.10 Å R-free 0.250
1BOF GI-ALPHA-1 BOUND TO GDP AND MAGNESIUM Deposited 1998-08-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–353（353 aa）	Not recorded	SO4 SULFATE ION × 2 MG MAGNESIUM ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；pH 7.0	Resolution 2.20 Å R-free 0.268
1CIP GI-ALPHA-1 SUBUNIT OF GUANINE NUCLEOTIDE-BINDING PROTEIN COMPLEXED WITH A GTP ANALOGUE Deposited 1999-04-05	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–354（353 aa）	Not recorded	MG MAGNESIUM ION × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；PROTEIN BOUND TO GPPNHP WAS CRYSTALLIZED IN 1.8-2.0M (NH4)2SO3, 100MM SODIUM ACETATE, H 6.0, 1MM MGSO4, 1MM GPPNHP, AND 5MM DTT. PRIOR TO DATA COLLECTION CRYSTALS WERE TRANSFERED TO 2.0M LI2SO4, 1MM GPPNHP, 3MM DTT, 1MM MGSO4, 100MM BES, PH 7.0, AND 15% GLYCEROL. CRYSTALS WERE FLASH FROZEN IN LIQUID PROPANE.	Resolution 1.50 Å R-free 0.235
1FQJ CRYSTAL STRUCTURE OF THE HETEROTRIMERIC COMPLEX OF THE RGS DOMAIN OF RGS9, THE GAMMA SUBUNIT OF PHOSPHODIESTERASE AND THE GT/I1 CHIMERA ALPHA SUBUNIT [(RGS9)-(PDEGAMMA)-(GT/I1ALPHA)-(GDP)-(ALF4-)-(MG2+)] Deposited 2000-09-05	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 220–298（79 aa） Fragment：UNP P04695 residues 26-215 and 295-350 linked via UNP P10824 residues 220-298	Not recorded	MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；277 K；15.0% PEG8000, 200mM Tris pH9.0, 0.2% beta-ME, 1mM (NH4)2WS4, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.02 Å R-free 0.265
1FQJ CRYSTAL STRUCTURE OF THE HETEROTRIMERIC COMPLEX OF THE RGS DOMAIN OF RGS9, THE GAMMA SUBUNIT OF PHOSPHODIESTERASE AND THE GT/I1 CHIMERA ALPHA SUBUNIT [(RGS9)-(PDEGAMMA)-(GT/I1ALPHA)-(GDP)-(ALF4-)-(MG2+)] Deposited 2000-09-05	Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 220–298（79 aa） Fragment：UNP P04695 residues 26-215 and 295-350 linked via UNP P10824 residues 220-298	Not recorded	MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；277 K；15.0% PEG8000, 200mM Tris pH9.0, 0.2% beta-ME, 1mM (NH4)2WS4, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.02 Å R-free 0.265
1GDD TERTIARY AND QUATERNARY STRUCTURAL CHANGES IN GIA1 INDUCED BY GTP HYDROLYSIS Deposited 1995-07-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–353（353 aa）	Not recorded	SO4 SULFATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.20 Å R-free 0.291
1GFI STRUCTURES OF ACTIVE CONFORMATIONS OF GI ALPHA 1 AND THE MECHANISM OF GTP HYDROLYSIS Deposited 1994-11-11	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–353（353 aa）	Not recorded	MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.20 Å R-free 0.284
1GG2 G PROTEIN HETEROTRIMER MUTANT GI_ALPHA_1(G203A) BETA_1 GAMMA_2 WITH GDP BOUND Deposited 1996-11-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–353（353 aa） Fragment：ALPHA 1	Mutation：CHAIN A, G203A	GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；pH 7.0	Resolution 2.40 Å R-free 0.289
1GIA STRUCTURE OF ACTIVE CONFORMATIONS OF GIA1 AND THE MECHANISM OF GTP HYDROLYSIS Deposited 1994-07-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–353（353 aa）	Not recorded	MG MAGNESIUM ION × 1 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å R-free 0.228
1GIL STRUCTURE OF ACTIVE CONFORMATIONS OF GIA1 AND THE MECHANISM OF GTP HYDROLYSIS Deposited 1995-01-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–353（353 aa）	Not recorded	MG MAGNESIUM ION × 1 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.30 Å R-free 0.302
1GIT STRUCTURE OF GTP-BINDING PROTEIN Deposited 1996-10-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–353（353 aa） Fragment：ALPHA 1	Mutation：G203A	PO4 PHOSPHATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.60 Å R-free 0.279
1GP2 G PROTEIN HETEROTRIMER GI_ALPHA_1 BETA_1 GAMMA_2 WITH GDP BOUND Deposited 1996-11-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–353（353 aa） Fragment：ALPHA 1	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；pH 7.0	Resolution 2.30 Å R-free 0.307
1SHZ Crystal Structure of the p115RhoGEF rgRGS Domain in A Complex with Galpha(13):Galpha(i1) Chimera Deposited 2004-02-26	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 21–47（27 aa） Fragment：residues 21-47, 185-210, 213-230, 240-353 of Galpha(i1) and residues 64-207, 234-235, 254-262 of Galpha(13) Chain A 185–210（26 aa） Fragment：residues 21-47, 185-210, 213-230, 240-353 of Galpha(i1) and residues 64-207, 234-235, 254-262 of Galpha(13) Chain A 213–230（18 aa） Fragment：residues 21-47, 185-210, 213-230, 240-353 of Galpha(i1) and residues 64-207, 234-235, 254-262 of Galpha(13) Chain A 240–353（114 aa） Fragment：residues 21-47, 185-210, 213-230, 240-353 of Galpha(i1) and residues 64-207, 234-235, 254-262 of Galpha(13)	Not recorded	MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；289 K；Ammonium Sulfate, Tris, Ethylene glycol , pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 2.85 Å R-free 0.297
1SHZ Crystal Structure of the p115RhoGEF rgRGS Domain in A Complex with Galpha(13):Galpha(i1) Chimera Deposited 2004-02-26	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 21–47（27 aa） Fragment：residues 21-47, 185-210, 213-230, 240-353 of Galpha(i1) and residues 64-207, 234-235, 254-262 of Galpha(13) Chain D 185–210（26 aa） Fragment：residues 21-47, 185-210, 213-230, 240-353 of Galpha(i1) and residues 64-207, 234-235, 254-262 of Galpha(13) Chain D 213–230（18 aa） Fragment：residues 21-47, 185-210, 213-230, 240-353 of Galpha(i1) and residues 64-207, 234-235, 254-262 of Galpha(13) Chain D 240–353（114 aa） Fragment：residues 21-47, 185-210, 213-230, 240-353 of Galpha(i1) and residues 64-207, 234-235, 254-262 of Galpha(13)	Not recorded	MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；289 K；Ammonium Sulfate, Tris, Ethylene glycol , pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 2.85 Å R-free 0.297
1SHZ Crystal Structure of the p115RhoGEF rgRGS Domain in A Complex with Galpha(13):Galpha(i1) Chimera Deposited 2004-02-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 21–47（27 aa） Fragment：residues 21-47, 185-210, 213-230, 240-353 of Galpha(i1) and residues 64-207, 234-235, 254-262 of Galpha(13) Chain A 185–210（26 aa） Fragment：residues 21-47, 185-210, 213-230, 240-353 of Galpha(i1) and residues 64-207, 234-235, 254-262 of Galpha(13) Chain A 213–230（18 aa） Fragment：residues 21-47, 185-210, 213-230, 240-353 of Galpha(i1) and residues 64-207, 234-235, 254-262 of Galpha(13) Chain A 240–353（114 aa） Fragment：residues 21-47, 185-210, 213-230, 240-353 of Galpha(i1) and residues 64-207, 234-235, 254-262 of Galpha(13) Chain D 21–47（27 aa） Fragment：residues 21-47, 185-210, 213-230, 240-353 of Galpha(i1) and residues 64-207, 234-235, 254-262 of Galpha(13) Chain D 185–210（26 aa） Fragment：residues 21-47, 185-210, 213-230, 240-353 of Galpha(i1) and residues 64-207, 234-235, 254-262 of Galpha(13) Chain D 213–230（18 aa） Fragment：residues 21-47, 185-210, 213-230, 240-353 of Galpha(i1) and residues 64-207, 234-235, 254-262 of Galpha(13) Chain D 240–353（114 aa） Fragment：residues 21-47, 185-210, 213-230, 240-353 of Galpha(i1) and residues 64-207, 234-235, 254-262 of Galpha(13)	Not recorded	MG MAGNESIUM ION × 2 ALF TETRAFLUOROALUMINATE ION × 2 GDP GUANOSINE-5'-DIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；289 K；Ammonium Sulfate, Tris, Ethylene glycol , pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 2.85 Å R-free 0.297
1SVK Structure of the K180P mutant of Gi alpha subunit bound to AlF4 and GDP Deposited 2004-03-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–353（353 aa）	Mutation：K180P	MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；293.16 K；Ammonium Sulphite, Sodium Acetate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293.16K, pH 6.50	Resolution 2.00 Å R-free 0.239
1SVS Structure of the K180P mutant of Gi alpha subunit bound to GppNHp. Deposited 2004-03-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–353（353 aa）	Mutation：K180P	MG MAGNESIUM ION × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；293.16 K；Ammonium Sulphite, Sodium Acetate, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 293.16K	Resolution 1.50 Å R-free 0.209
2BCJ Crystal Structure of G Protein-Coupled Receptor Kinase 2 in Complex with Galpha-q and Gbetagamma Subunits Deposited 2005-10-19	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain Q 1–28（28 aa）	Not recorded	MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；9% PEG8000, 1M NaCl, 0.1M MES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.06 Å R-free 0.292
2RGN Crystal Structure of p63RhoGEF complex with Galpha-q and RhoA Deposited 2007-10-04	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–28（28 aa） Fragment：;Chimeric protein of rat Guanine nucleotide-binding protein G(i) subunit alpha-1 N-terminal helix residues 1-28 and mouse Guanine nucleotide-binding protein G(q) subunit alpha residues 31-353,Chimeric protein of rat Guanine nucleotide-binding protein G(i) subunit alpha-1 N-terminal helix residues 1-28 and mouse Guanine nucleotide-binding protein G(q) subunit alpha residues 31-353 ;	Not recorded	ALF TETRAFLUOROALUMINATE ION × 1 MG MAGNESIUM ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM HEPES pH 6.5, 14.5% PEG 3350, 400 mM KCl. Drops were microseeded to obtain large crystals, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.50 Å R-free 0.299
2RGN Crystal Structure of p63RhoGEF complex with Galpha-q and RhoA Deposited 2007-10-04	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 1–28（28 aa） Fragment：;Chimeric protein of rat Guanine nucleotide-binding protein G(i) subunit alpha-1 N-terminal helix residues 1-28 and mouse Guanine nucleotide-binding protein G(q) subunit alpha residues 31-353,Chimeric protein of rat Guanine nucleotide-binding protein G(i) subunit alpha-1 N-terminal helix residues 1-28 and mouse Guanine nucleotide-binding protein G(q) subunit alpha residues 31-353 ;	Not recorded	ALF TETRAFLUOROALUMINATE ION × 1 MG MAGNESIUM ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM HEPES pH 6.5, 14.5% PEG 3350, 400 mM KCl. Drops were microseeded to obtain large crystals, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.50 Å R-free 0.299
2ZJY Structure of the K349P mutant of Gi alpha 1 subunit bound to ALF4 and GDP Deposited 2008-03-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–354（354 aa）	Mutation：K349P	ALF TETRAFLUOROALUMINATE ION × 1 MG MAGNESIUM ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.80 Å R-free 0.260
2ZJZ Structure of the K349P mutant of Gi alpha 1 subunit bound to GDP Deposited 2008-03-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–354（354 aa） Chain B 1–354（354 aa）	Mutation：K349P Mutation：K349P	GDP GUANOSINE-5'-DIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；pH 8.00, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.60 Å R-free 0.282
3AH8 Structure of heterotrimeric G protein Galpha-q beta gamma in complex with an inhibitor YM-254890 Deposited 2010-04-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 2–28（27 aa） Fragment：UNP entry P10824 residues 2-28, UNP entry P21279 residues 37-359	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.1；293 K；7% PEG 4000, 30% (v/v) glycerol, 70 mM acetate-NaOH, pH 5.1, VAPOR DIFFUSION, temperature 293K	Resolution 2.90 Å R-free 0.315
3D7M Crystal Structure of the G Protein Fast-Exchange Double Mutant I56C/Q333C Deposited 2008-05-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–354（354 aa）	Mutation：I56C, Q333C	MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；16% PEG 3350, 0.24 M Li(CH3COO), 0.1 M Bis-Tris, 0.01 M SrCl2, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.90 Å R-free 0.294
3FFA Crystal Structure of a fast activating G protein mutant Deposited 2008-12-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 33–348（316 aa）	Mutation：T329A	GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MG MAGNESIUM ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6；293 K；100 mM Sodium Acetate pH 5.9-6.3, 1.8-2.1 M Ammonium Sulphate, VAPOR DIFFUSION, temperature 293K, pH 6.0	Resolution 2.30 Å R-free 0.252
3FFB Gi-alpha-1 mutant in GDP bound form Deposited 2008-12-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 6–354（349 aa）	Mutation：T329A	GDP GUANOSINE-5'-DIPHOSPHATE × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6；293 K；100 mM Sodium Acetate pH 5.9-6.3, 1.8-2.1 M Ammonium Sulphate, VAPOR DIFFUSION, temperature 293K, pH 6.0	Resolution 2.57 Å R-free 0.226
3V00 Studies of a constitutively active G-alpha subunit provide insights into the mechanism of G protein activation. Deposited 2011-12-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain C 220–298（79 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298	Mutation：G56P, K244H and D247N	GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.3；295 K；1.9 M Ammonium Sulphate in 0.05 M Sodium Cacodylate buffer, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.90 Å R-free 0.272
3V00 Studies of a constitutively active G-alpha subunit provide insights into the mechanism of G protein activation. Deposited 2011-12-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 220–298（79 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298	Mutation：G56P, K244H and D247N	GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.3；295 K；1.9 M Ammonium Sulphate in 0.05 M Sodium Cacodylate buffer, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.90 Å R-free 0.272
3V00 Studies of a constitutively active G-alpha subunit provide insights into the mechanism of G protein activation. Deposited 2011-12-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 220–298（79 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298	Mutation：G56P, K244H and D247N	GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.3；295 K；1.9 M Ammonium Sulphate in 0.05 M Sodium Cacodylate buffer, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.90 Å R-free 0.272
3V00 Studies of a constitutively active G-alpha subunit provide insights into the mechanism of G protein activation. Deposited 2011-12-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Insufficient information Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 220–298（79 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298 Chain B 220–298（79 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298 Chain C 220–298（79 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298	Mutation：G56P, K244H and D247N Mutation：G56P, K244H and D247N Mutation：G56P, K244H and D247N	GDP GUANOSINE-5'-DIPHOSPHATE × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.3；295 K；1.9 M Ammonium Sulphate in 0.05 M Sodium Cacodylate buffer, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.90 Å R-free 0.272
3V00 Studies of a constitutively active G-alpha subunit provide insights into the mechanism of G protein activation. Deposited 2011-12-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Insufficient information Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 220–298（79 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298 Chain B 220–298（79 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298 Chain C 220–298（79 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298	Mutation：G56P, K244H and D247N Mutation：G56P, K244H and D247N Mutation：G56P, K244H and D247N	GDP GUANOSINE-5'-DIPHOSPHATE × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.3；295 K；1.9 M Ammonium Sulphate in 0.05 M Sodium Cacodylate buffer, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.90 Å R-free 0.272
3V00 Studies of a constitutively active G-alpha subunit provide insights into the mechanism of G protein activation. Deposited 2011-12-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 220–298（79 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298 Chain C 220–298（79 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298	Mutation：G56P, K244H and D247N Mutation：G56P, K244H and D247N	GDP GUANOSINE-5'-DIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.3；295 K；1.9 M Ammonium Sulphate in 0.05 M Sodium Cacodylate buffer, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.90 Å R-free 0.272
3V00 Studies of a constitutively active G-alpha subunit provide insights into the mechanism of G protein activation. Deposited 2011-12-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 220–298（79 aa） Fragment：UNP P04695 1-215 & 295-350, UNP P10824 220-298	Mutation：G56P, K244H and D247N	GDP GUANOSINE-5'-DIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.3；295 K；1.9 M Ammonium Sulphate in 0.05 M Sodium Cacodylate buffer, pH 6.3, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.90 Å R-free 0.272
4N0D Crystal structure of the K345L variant of the Gi alpha1 subunit bound to GTPgammaS Deposited 2013-10-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–354（354 aa）	Mutation：K345L	SO3 SULFITE ION × 1 MG MAGNESIUM ION × 1 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；2.2 M ammonium sulfite, pH 8.0, 20 mM magnesium sulfate, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.55 Å R-free 0.187
4N0E Crystal structure of the K345L variant of the Gi alpha1 subunit bound to GDP Deposited 2013-10-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–354（354 aa）	Mutation：K345L	GDP GUANOSINE-5'-DIPHOSPHATE × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；2.0 ammonium sulfite, pH 8.0, 5 mM MgSO4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.10 Å R-free 0.220
4PAM A conserved phenylalanine as relay between the 5 helix and the GDP binding region of heterotrimeric G protein Deposited 2014-04-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–354（354 aa）	Mutation：F336C	GDP GUANOSINE-5'-DIPHOSPHATE × 1 SO3 SULFITE ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；(NH4)2SO3, Sodium acetate	Resolution 2.10 Å R-free 0.218
4PAN A conserved phenylalanine as relay between the 5 helix and the GDP binding region of heterotrimeric G protein Deposited 2014-04-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–354（354 aa）	Mutation：F336Y	GDP GUANOSINE-5'-DIPHOSPHATE × 1 SO3 SULFITE ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；(NH4)2SO3, Sodium acetate	Resolution 2.40 Å R-free 0.232
4PAO A conserved phenylalanine as relay between the 5 helix and the GDP binding region of heterotrimeric G protein Deposited 2014-04-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–354（354 aa）	Mutation：F336C	GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；(NH4)2SO3, Sodium acetate	Resolution 2.00 Å R-free 0.208
4PAQ A conserved phenylalanine as relay between the 5 helix and the GDP binding region of heterotrimeric G protein Deposited 2014-04-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–354（354 aa）	Mutation：F336Y	GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；(NH4)2SO3, Sodium acetate	Resolution 2.00 Å R-free 0.207
5KDL Crystal structure of the 4 alanine insertion variant of the Gi alpha1 subunit bound to GTPgammaS Deposited 2016-06-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–354（354 aa）	Not recorded	MG MAGNESIUM ION × 1 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；12-16 % polyethylene glycol (PEG) 2000 monomethyl ether, 18% 2-propanol and 100 mM MES (pH 6.0)	Resolution 2.67 Å R-free 0.265
5KDL Crystal structure of the 4 alanine insertion variant of the Gi alpha1 subunit bound to GTPgammaS Deposited 2016-06-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–354（354 aa）	Not recorded	MG MAGNESIUM ION × 1 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；12-16 % polyethylene glycol (PEG) 2000 monomethyl ether, 18% 2-propanol and 100 mM MES (pH 6.0)	Resolution 2.67 Å R-free 0.265
5KDO Heterotrimeric complex of the 4 alanine insertion variant of the Gi alpha1 subunit and the Gbeta1-Ggamma1 Deposited 2016-06-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–354（354 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；294 K；19-24 % PEG 8000, 1-5% 2-propanolol, 1% OG, 100 mM HEPES (pH 7.0) and 100 mM NaOAc (pH 6.4)	Resolution 1.90 Å R-free 0.208
6M8H Crystal Structure of the R208Q mutant of G(i) subunit alpha-1 Deposited 2018-08-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–354（354 aa）	Mutation：R208Q	GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；297 K；2.0 M (NH4)2SO3 pH 8.0	Resolution 2.07 Å R-free 0.197
6TYL Crystal structure of mammalian Ric-8A:Galpha(i):nanobody complex Deposited 2019-08-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 1–354（354 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；285 K；1.2-1.4M Sodium Malonate	Resolution 3.30 Å R-free 0.287
6TYL Crystal structure of mammalian Ric-8A:Galpha(i):nanobody complex Deposited 2019-08-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain G 1–354（354 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；285 K；1.2-1.4M Sodium Malonate	Resolution 3.30 Å R-free 0.287
6UKT Cryo-EM structure of mammalian Ric-8A:Galpha(i):nanobody complex Deposited 2019-10-05	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 32–354（323 aa） Fragment：UNP residues 32-354	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.87 Å
6VMS Structure of a D2 dopamine receptor-G-protein complex in a lipid membrane Deposited 2020-01-28	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 1–354（354 aa）	Not recorded	08Y bromoergocryptine × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
7S0F Isoproterenol bound beta1 adrenergic receptor in complex with heterotrimeric Gi protein Deposited 2021-08-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–354（354 aa）	Mutation：G203A	5FW ISOPRENALINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.96 Å
7S0G Isoproterenol bound beta1 adrenergic receptor in complex with heterotrimeric Gi/s chimera protein Deposited 2021-08-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–343（343 aa）	Mutation：G203A	5FW ISOPRENALINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.86 Å
9CBL Cryo-EM structure of epinephrine-bound alpha-2A-adrenergic receptor in complex with heterotrimeric Gi-protein Deposited 2024-06-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–354（354 aa）	Mutation：G203A	ALE L-EPINEPHRINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9CBM Cryo-EM structure of dexmedetomidine-bound alpha-2A-adrenergic receptor in complex with heterotrimeric Gi-protein Deposited 2024-06-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–354（354 aa）	Mutation：G203A	CZX 4-[(1~{S})-1-(2,3-dimethylphenyl)ethyl]-1~{H}-imidazole × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å

43 other PDB entries and 56 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	GNAI1_RAT
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 191–269； UniProt 220–298 Author chain C； PDBConstruct 191–269； UniProt 220–298

Regulator of G-protein signaling 9

Bos taurus

UniProt O46469

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 276–422	Fragment：RGS DOMAIN, UNP RESIDUES 276-422	;Guanine nucleotide-binding protein G(t) subunit alpha-1,Guanine nucleotide-binding protein G(i) subunit alpha-1,Guanine nucleotide-binding protein G(t) subunit alpha-1 ; × 1 （P04695,P10824） MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；10.5% PEG8000, 110mM magnesium acetate, 50mM Tris pH 8.5, 0.2% beta-ME, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.30 Å R-free 0.268
2	Insufficient information Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain D； UniProt 276–422	Fragment：RGS DOMAIN, UNP RESIDUES 276-422	;Guanine nucleotide-binding protein G(t) subunit alpha-1,Guanine nucleotide-binding protein G(i) subunit alpha-1,Guanine nucleotide-binding protein G(t) subunit alpha-1 ; × 1 （P04695,P10824） MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；10.5% PEG8000, 110mM magnesium acetate, 50mM Tris pH 8.5, 0.2% beta-ME, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.30 Å R-free 0.268

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 1FQK	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1FQI RGS9 RGS DOMAIN Deposited 2000-09-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 276–422（147 aa） Fragment：RGS DOMAIN (RESIDUES 276-422)	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；277 K；15.5% PEG8000, 50mM Tris pH8.0, 5% Ethylene Glycol, 75mM NaCl, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.94 Å R-free 0.250
1FQJ CRYSTAL STRUCTURE OF THE HETEROTRIMERIC COMPLEX OF THE RGS DOMAIN OF RGS9, THE GAMMA SUBUNIT OF PHOSPHODIESTERASE AND THE GT/I1 CHIMERA ALPHA SUBUNIT [(RGS9)-(PDEGAMMA)-(GT/I1ALPHA)-(GDP)-(ALF4-)-(MG2+)] Deposited 2000-09-05	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 276–422（147 aa） Fragment：RGS DOMAIN UNP RESIDUES 276-422	Not recorded	MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；277 K；15.0% PEG8000, 200mM Tris pH9.0, 0.2% beta-ME, 1mM (NH4)2WS4, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.02 Å R-free 0.265
1FQJ CRYSTAL STRUCTURE OF THE HETEROTRIMERIC COMPLEX OF THE RGS DOMAIN OF RGS9, THE GAMMA SUBUNIT OF PHOSPHODIESTERASE AND THE GT/I1 CHIMERA ALPHA SUBUNIT [(RGS9)-(PDEGAMMA)-(GT/I1ALPHA)-(GDP)-(ALF4-)-(MG2+)] Deposited 2000-09-05	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 276–422（147 aa） Fragment：RGS DOMAIN UNP RESIDUES 276-422	Not recorded	MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；277 K；15.0% PEG8000, 200mM Tris pH9.0, 0.2% beta-ME, 1mM (NH4)2WS4, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.02 Å R-free 0.265

2 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RGS9_BOVIN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–147； UniProt 276–422 Author chain D； PDBConstruct 1–147； UniProt 276–422

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1fqk
Deposition date deposition_date	2000-09-05
Structure title title	CRYSTAL STRUCTURE OF THE HETERODIMERIC COMPLEX OF THE RGS DOMAIN OF RGS9, AND THE GT/I1 CHIMERA ALPHA SUBUNIT [(RGS9)-(GT/I1ALPHA)-(GDP)-(ALF4-)-(MG2+)]
Keywords keywords	RGS9, transducin, G Protein, Phototransduction, rod, RGS, GAP, SIGNALING PROTEIN; SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	33.83 Å
Radius of gyration Rg (electron density) rg_electron	33.78 Å
Forward intensity I(0) i0	176464000.00
Molecular weight molecular_weight	107180.0 kDa
Excluded volume excluded_volume	134410 Å³
Envelope volume envelope_volume	175770 Å³
Hydration-shell volume shell_volume	43894 Å³
Envelope diameter envelope_diameter	125.9 Å
Shell Rg shell_rg	39.93 Å
Envelope Rg envelope_rg	33.82 Å
Shape Rg shape_rg	33.79 Å
Total Rg total_rg	34.18 Å
Total atoms total_atoms	7518
Residues n_residues	914
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	115.0 Å
Rg (real space) rg_real	33.91 Å
Rg uncertainty (real space) rg_real_error	0.95 Å
I(0) (real space) i0_real	1.7650e+08
I(0) uncertainty (real space) i0_real_error	2.8690e+06
Rg (reciprocal space) rg_reciprocal	33.86 Å
I(0) (reciprocal space) i0_reciprocal	176500000.0000
Solution quality estimate total_estimate	0.6879
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	36.7 Å
Skewness Skewness skewness	0.436
Kurtosis Kurtosis kurtosis	-0.297
Angular range angular_range	— – 0.2350 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	30620000.0000
Real-space data points n_real_points	48
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.818; Stabil: 1.000; Sysdev: 0.214; Positv: 1.000; Valcen: 0.930; Smooth: 0.912

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	;Guanine nucleotide-binding protein G(t) subunit alpha-1,Guanine nucleotide-binding protein G(i) subunit alpha-1,Guanine nucleotide-binding protein G(t) subunit alpha-1 ;
Molecular weight formula_weight	37361.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	7634

DARTVKLLLLGAGESGKSTIVKQMKIIHQDGYSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFDRASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTTGIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAGNYIKVQFLELNMRRDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF

来源 Source

来源生物 organism	Bos taurus
通用名 common_name	Bovine
NCBI Class编号 ncbi_taxonomy_id	9913
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Regulator of G-protein signaling 9
Molecular weight formula_weight	17419.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

QFWDLNAKLVDIPTKMRVERWAFNFSELIRDPKGRQSFQHFLRKEFSGENLGFWEACEDLKYGDQSKVKEKAEEIYKLFLAPGARRWINIDGKTMDITVKGLKHPHRYVLDAAQTHIYMLMKKDSYARYLKSPIYKEMLAKAIEPQG

来源 Source

来源生物 organism	Bos taurus
通用名 common_name	Bovine
NCBI Class编号 ncbi_taxonomy_id	9913
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 non-polymer

Description description	TETRAFLUOROALUMINATE ION
Molecular weight formula_weight	103.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 non-polymer

Description description	GUANOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	443.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	116

▼

7. Fold Classification (SCOP + CATH) 14 domains

SCOP 2.08 (6 domains)

Domain ID domain_id	d1fqka1
Class class	a — All alpha proteins
Fold Fold fold	a.66 — Transducin (alpha subunit), insertion domain
Superfamily Superfamily superfamily	a.66.1 — Transducin (alpha subunit), insertion domain
Family Family family	a.66.1.1 — Transducin (alpha subunit), insertion domain

Domain ID domain_id	d1fqka2
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.8 — G proteins

Domain ID domain_id	d1fqkb_
Class class	a — All alpha proteins
Fold Fold fold	a.91 — Regulator of G-protein signaling, RGS
Superfamily Superfamily superfamily	a.91.1 — Regulator of G-protein signaling, RGS
Family Family family	a.91.1.1 — Regulator of G-protein signaling, RGS

Domain ID domain_id	d1fqkc1
Class class	a — All alpha proteins
Fold Fold fold	a.66 — Transducin (alpha subunit), insertion domain
Superfamily Superfamily superfamily	a.66.1 — Transducin (alpha subunit), insertion domain
Family Family family	a.66.1.1 — Transducin (alpha subunit), insertion domain

Domain ID domain_id	d1fqkc2
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.8 — G proteins

Domain ID domain_id	d1fqkd_
Class class	a — All alpha proteins
Fold Fold fold	a.91 — Regulator of G-protein signaling, RGS
Superfamily Superfamily superfamily	a.91.1 — Regulator of G-protein signaling, RGS
Family Family family	a.91.1.1 — Regulator of G-protein signaling, RGS

CATH v4.4 (8 domains)

Domain ID domain_id	1fqkA01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	1fqkA02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	400 — GI Alpha 1, domain 2-like
Homologous superfamily homologous superfamily	10 — GI Alpha 1, domain 2-like

Domain ID domain_id	1fqkB01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	196 — Regulator of G-protein Signalling 4; domain 1
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	1fqkB02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	167 — Regulator of G-protein Signalling 4; domain 2
Homologous superfamily homologous superfamily	10 — Regulator of G-protein Signalling 4, domain 2

Domain ID domain_id	1fqkC01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	1fqkC02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	400 — GI Alpha 1, domain 2-like
Homologous superfamily homologous superfamily	10 — GI Alpha 1, domain 2-like

Domain ID domain_id	1fqkD01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	196 — Regulator of G-protein Signalling 4; domain 1
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	1fqkD02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	167 — Regulator of G-protein Signalling 4; domain 2
Homologous superfamily homologous superfamily	10 — Regulator of G-protein Signalling 4, domain 2

▶

8. Citations (1)

▶

Unit-cell length a length_a	96.785 Å
Unit-cell length b length_b	115.073 Å
Unit-cell length c length_c	136.460 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.300 Å
Low-resolution limit resolution_low	50.000 Å
R factor r_factor	0.2310
R_work r_work	0.2310
R_free r_free	0.2680

fit	/app/data/saxs_computation/fq/1fqk/1fqk.fit
pddf	/app/data/pr_computation/fq/1fqk/1fqk.pr.out
profile	/app/data/saxs_computation/fq/1fqk/1fqk.dat

CRYSTAL STRUCTURE OF THE HETERODIMERIC COMPLEX OF THE RGS DOMAIN OF RGS9, AND THE GT/I1 CHIMERA ALPHA SUBUNIT [(RGS9)-(GT/I1ALPHA)-(GDP)-(ALF4-)-(MG2+)]

1. Protein Identity and Related Structures Protein Identity & Related Structures

;Guanine nucleotide-binding protein G(t) subunit alpha-1,Guanine nucleotide-binding protein G(i) subunit alpha-1,Guanine nucleotide-binding protein G(t) subunit alpha-1 ;

State in the Current Structure

Other States of the Same Protein in the Database

;Guanine nucleotide-binding protein G(t) subunit alpha-1,Guanine nucleotide-binding protein G(i) subunit alpha-1,Guanine nucleotide-binding protein G(t) subunit alpha-1 ;

State in the Current Structure

Other States of the Same Protein in the Database

Regulator of G-protein signaling 9

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Fold Classification (SCOP + CATH) 14 domains

SCOP 2.08 (6 domains)

CATH v4.4 (8 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)