1gh6

RETINOBLASTOMA POCKET COMPLEXED WITH SV40 LARGE T ANTIGEN

Method: X-RAY DIFFRACTION D_max: 104.7 Å Quality: REASONABLE

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Large T antigen

Simian virus 40

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 7–117	Not recorded	Retinoblastoma-associated protein × 1 （P06400）	X-RAY DIFFRACTION X-ray crystallization conditions：pH 7.2；pH 7.2	Resolution 3.20 Å R-free 0.314

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1GH6	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1EJL MOUSE IMPORTIN ALPHA-SV40 LARGE T ANTIGEN NLS PEPTIDE COMPLEX Deposited 2000-03-03	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 126–132（7 aa） Fragment：NLS (NUCLEAR LOCALIZATION SIGNAL) MONOPARTITE PEPTIDE, RESIDUES 126-132 Chain B 126–132（7 aa） Fragment：NLS (NUCLEAR LOCALIZATION SIGNAL) MONOPARTITE PEPTIDE, RESIDUES 126-132	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；sodium citrate, Hepes, DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.80 Å R-free 0.254
1N25 Crystal structure of the SV40 Large T antigen helicase domain Deposited 2002-10-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 260–627（368 aa） Fragment：helicase domain Chain B 260–627（368 aa） Fragment：helicase domain	Not recorded	ZN ZINC ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.6；291 K；glycerol, DTT, Hepes, NaCl, EtOH, EDTA, pH 7.6, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.80 Å R-free 0.276
1Q1S Mouse Importin alpha- phosphorylated SV40 CN peptide complex Deposited 2003-07-22	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 110–133（24 aa） Fragment：CN peptide - Ser112 chemically phosphorylated Chain B 110–133（24 aa） Fragment：CN peptide - Ser112 chemically phosphorylated Chain C 70–529（460 aa） Fragment：NLS binding domain (70-529)	Mutation：S120A, S123A, T124A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：S120A, S123A, T124A Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；Sodium Citrate, DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.30 Å R-free 0.221
1Q1T Mouse Importin alpha: non-phosphorylated SV40 CN peptide complex Deposited 2003-07-22	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 110–133（24 aa） Fragment：CN peptide Chain B 110–133（24 aa） Fragment：CN peptide Chain C 70–529（460 aa） Fragment：NLS binding domain (70-529)	Mutation：S120A, S123A, T124A Mutation：S120A, S123A, T124A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.25；293 K；Sodium Citrate, DTT, pH 6.25, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.50 Å R-free 0.233
1SVL Co-crystal structure of SV40 large T antigen helicase domain and ADP Deposited 2004-03-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 251–627（377 aa） Fragment：HELICASE DOMAIN Chain B 251–627（377 aa） Fragment：HELICASE DOMAIN Chain C 251–627（377 aa） Fragment：HELICASE DOMAIN	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 6 ADP ADENOSINE-5'-DIPHOSPHATE × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.25；277 K；Tris, magnesium chloride, PEG 8000, DTT, pH 7.25, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.95 Å R-free 0.264
1SVM Co-crystal structure of SV40 large T antigen helicase domain and ATP Deposited 2004-03-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 251–627（377 aa） Fragment：HELICASE DOMAIN Chain B 251–627（377 aa） Fragment：HELICASE DOMAIN Chain C 251–627（377 aa） Fragment：HELICASE DOMAIN Chain D 251–627（377 aa） Fragment：HELICASE DOMAIN Chain E 251–627（377 aa） Fragment：HELICASE DOMAIN Chain F 251–627（377 aa） Fragment：HELICASE DOMAIN	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 6 ATP ADENOSINE-5'-TRIPHOSPHATE × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.25；277 K；Tris, magnesium chloride, PEG 8000, DTT, pH 7.25, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.94 Å R-free 0.241
1SVO Structure of SV40 large T antigen helicase domain Deposited 2004-03-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 251–627（377 aa） Fragment：HELICASE DOMAIN Chain B 251–627（377 aa） Fragment：HELICASE DOMAIN	Not recorded	ZN ZINC ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.6；277 K；HEPES, NACL, ETHANOL, EDTA, DTT, pH 7.6, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.60 Å R-free 0.271
1TBD SOLUTION STRUCTURE OF THE ORIGIN DNA BINDING DOMAIN OF SV40 T-ANTIGEN, NMR, MINIMIZED AVERAGE STRUCTURE Deposited 1996-11-04	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 131–260（130 aa） Fragment：DNA BINDING DOMAIN	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 5.5；303 K	Resolution not provided
1Z1D Structural Model for the interaction between RPA32 C-terminal domain and SV40 T antigen origin binding domain. Deposited 2005-03-03	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 131–259（129 aa） Fragment：SV40 T antigen Origin binding domain	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 0.03 M；Pressure ambient NMR sample composition 0.2mM RPA32C U-15N, 0.6mM Tag-OBD, 20mM Tris buffer pH 7.0, 2 mM DTT, 5mM MgCl2, 90% H2O, 10% D2O \| 90% H2O/10% D2O NMR sample composition 0.2mM Tag-OBD U-15N, 0.6mM RPA32C, 20mM Tris buffer pH 7.0, 2mM DTT, 5mM MgCl2, 90% H2O, 10% D2O \| 90% H2O/10% D2O	Resolution not provided
2FUF Crystal structure of the SV40 large T antigen origin-binding domain Deposited 2006-01-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 131–260（130 aa） Fragment：DNA binding domain (residues 131-259)	Non-standard monomer：Yes (specific site not provided by mmCIF)	FLC CITRATE ANION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.7；298 K；1.6 M Sodium citrate, pH 6.7, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.45 Å R-free 0.189
2IF9 Crystal Structure of SV40 T-antigen origin binding domain disulfide-linked dimer Deposited 2006-09-20	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 131–260（130 aa） Fragment：origin binding domain Chain B 131–260（130 aa） Fragment：origin binding domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.6；293 K；30 % peg 4000, 0.1M sodium citrate (pH 5.6), 0.2 M ammonium acetate, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.59 Å R-free 0.296
2IPR Origin binding domain of the SV40 large T antigen (residues 131-259). P21 crystal form Deposited 2006-10-12	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 131–259（129 aa） Fragment：Origin binding domain (residues 131-259) Chain B 131–259（129 aa） Fragment：Origin binding domain (residues 131-259)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.1；300 K；20 mM NaSCN, 10% P4K, 0.1 Tris, pH 8.1, VAPOR DIFFUSION, HANGING DROP, temperature 300K	Resolution 1.50 Å R-free 0.204
2ITJ Origin binding domain of the SV40 large T antigen (residues 131-259). P212121 crystal form Deposited 2006-10-19	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 131–259（129 aa） Fragment：Origin binding domain (residues 131-259) Chain B 131–259（129 aa） Fragment：Origin binding domain (residues 131-259)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；297 K；20 mM NaAc, 20% PEG4K, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 297K	Resolution 2.50 Å R-free 0.289
2ITL The origin binding domain of the SV40 large T antigen bound to the functional pen palindrome DNA (23 bp) Deposited 2006-10-19	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: octameric	Chain A 131–259（129 aa） Fragment：Origin binding domain (residues 131-259) Chain B 131–259（129 aa） Fragment：Origin binding domain (residues 131-259)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；297 K；20 mM di-ammonium hydrogen citrate, 20% PEG 3000, and 10 mM MgCl2, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 297K	Resolution 1.65 Å R-free 0.251
2NL8 The origin binding domain of the SV40 large T antigen bound non specifically to a 17 bp palindrome DNA (sites 1 and 3) Deposited 2006-10-19	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 131–259（129 aa） Fragment：Origin binding domain (residues 131-259)	Mutation：CYS216SER	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；297 K；20 mM NaAcetate, 20% PEG 3000 + 4% PEG 600, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 297K	Resolution 2.30 Å R-free 0.299
2NTC Crystal Structure of sv40 large T antigen origin binding domain with DNA Deposited 2006-11-07	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 131–260（130 aa） Fragment：Origin binding domain (residues 131-259) Chain B 131–260（130 aa） Fragment：Origin binding domain (residues 131-259)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；273 K；0.1 M sodium cacodylate pH 6.5, 0.1 M calcium acetate, 30 % v/v peg 8000, 20 % glycerol, VAPOR DIFFUSION, temperature 273K	Resolution 2.40 Å R-free 0.287
2TBD SV40 T ANTIGEN DNA-BINDING DOMAIN, NMR, 30 STRUCTURES Deposited 1997-01-09	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 131–260（130 aa） Fragment：DNA BINDING DOMAIN, RESIDUES 131 - 260	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 5.5；303 K	Resolution not provided
3QK2 Structure-Based Analysis of the Interaction between the Simian Virus 40 T-Antigen Origin Binding Domain and Single-Stranded DNA Deposited 2011-01-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 131–260（130 aa） Fragment：origin binding domain	Non-standard monomer：Yes (specific site not provided by mmCIF)	SCN THIOCYANATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；278 K；0.2 M thiocyanate [SCN], 17.5% PEG 3350, 5% glycerol, VAPOR DIFFUSION, temperature 278K	Resolution 1.64 Å R-free 0.187
3QN2 Structure-based design of a disulfide-linked oligomeric form of the Simian Virus 40 (SV40) large T antigen DNA binding domain Deposited 2011-02-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 131–260（130 aa） Fragment：origin binding domain	Mutation：F151C, C216A, D256C	FLC CITRATE ANION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；295 K；1.6 M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.66 Å R-free 0.191
4FGN Crystal structure of the SV40 large T-antigen origin bining domain bound to Site I DNA Deposited 2012-06-04	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 131–260（130 aa） Fragment：origin binding domain, UNP residues 131-260 Chain B 131–260（130 aa） Fragment：origin binding domain, UNP residues 131-260	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；291 K；0.1M sodium acetate pH 4.6, .2M ammonium sulfate, 30 % Peg 4000, 10 mM CaCl2, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.20 Å R-free 0.267
4RXH Crystal Structure of Importin-alpha from Neurospora crassa complexed with SV40NLS Deposited 2014-12-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 125–132（8 aa） Chain C 125–132（8 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；297 K；20 Mm Bicine pH 8.5, 20%(w/v) PEG 6000, VAPOR DIFFUSION, SITTING DROP, temperature 297K	Resolution 1.76 Å R-free 0.211
5D9I SV40 Large T antigen origin binding domain bound to artificial DNA fork Deposited 2015-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 131–260（130 aa） Fragment：unp residues 131-260 Chain B 131–260（130 aa） Fragment：unp residues 131-260	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	EDO 1,2-ETHANEDIOL × 2 CA CALCIUM ION × 2 ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；100 mM Tris, 300 mM NH4Cl, 28% polyethylene glycol [PEG] 4000, 20 mM CaCl2	Resolution 1.70 Å R-free 0.223
9EVH SV40 large T antigen assembly with DNA in presence of ADP Deposited 2024-03-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 1–708（708 aa） Chain B 1–708（708 aa） Chain C 1–708（708 aa） Chain D 1–708（708 aa） Chain E 1–708（708 aa） Chain F 1–708（708 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8；200 mM NaCl, 50 mM Tris-HCl (pH 8.0), 1 mM ADP. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.38 Å
9EVP SV40 LTAg assembly with DNA in presence of AMPPNP and Mg2+. Deposited 2024-04-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 6 MG MAGNESIUM ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM TrisHCl (pH 7.5), 1 mM DTT, 100 mM NaCl, 5 mM MgCl, 3 mM AMP-PMP. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.12 Å
9EXD SV40 LTAg assembly in presence of ATP. Deposited 2024-04-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–708（708 aa） Chain B 1–708（708 aa） Chain C 1–708（708 aa） Chain D 1–708（708 aa） Chain E 1–708（708 aa） Chain F 1–708（708 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8；200 mM NaCl, 50 mM Tris-HCl (pH 8.0), 1 mM ATP. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9F3T Active SV40 LTAg complex with DNA (3D variability component_000, frame_010). Deposited 2024-04-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9F3U Active SV40 LTAg complex with DNA (3D variability component_001, frame_010). Deposited 2024-04-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9F5I Active SV40 LTAg complex with DNA (3D variability component_000, frame_005). Deposited 2024-04-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9F73 Active SV40 LTAg complex with DNA (3D variability component_002, frame_015). Deposited 2024-05-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9F74 Active SV40 LTAg complex with DNA (3D variability component_000, frame_015). Deposited 2024-05-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9F75 Active SV40 LTAg complex with DNA (3D variability component_000, frame_019). Deposited 2024-05-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9F7N Active SV40 LTAg complex with DNA (3D variability component_000, frame_000). Deposited 2024-05-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9F9N Active SV40 LTAg complex with DNA (3D variability component_001, frame_005). Deposited 2024-05-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9F9O Active SV40 LTAg complex with DNA (3D variability component_001, frame_015). Deposited 2024-05-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9F9W Active SV40 LTAg complex with DNA (3D variability component_001, frame_019). Deposited 2024-05-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9F9X Active SV40 LTAg complex with DNA (3D variability component_001, frame_000). Deposited 2024-05-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9FA1 Active SV40 LTAg complex with DNA (3D variability component_002, frame_010). Deposited 2024-05-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9FA2 Active SV40 LTAg complex with DNA (3D variability component_002, frame_005). Deposited 2024-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9FB0 Active SV40 LTAg complex with DNA (3D variability component_002, frame_019). Deposited 2024-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9FB4 SV40 large T antigen assembly with DNA in presence of ATP. Deposited 2024-05-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: octameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8；200 mM NaCl, 50 mM Tris-HCl (pH 8.0), 1 mM ATP. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.13 Å
9FB5 Active SV40 LTAg complex with DNA (3D variability component_002, frame_000). Deposited 2024-05-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9FB6 SV40 large T antigen assembly with DNA in presence of ATP. Deposited 2024-05-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: octameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8；200 mM NaCl, 50 mM Tris-HCl (pH 8.0), 1 mM ATP. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.13 Å
9KAE CryoEM structure of LTag bound to SV40 EP half origin DNA Deposited 2024-10-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: octameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 6 MG MAGNESIUM ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9KAK CryoEM structure of LTag bound to SV40 AT half origin DNA Deposited 2024-10-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: octameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 6 MG MAGNESIUM ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å

44 other PDB entries and 44 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	LT_SV40
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–114； UniProt 7–117

Retinoblastoma-associated protein

Homo sapiens

UniProt P06400

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 379–577 Chain B； UniProt 645–772	Fragment：UNP residues 379-577 and 645-772	Large T antigen × 1 （P03070）	X-RAY DIFFRACTION X-ray crystallization conditions：pH 7.2；pH 7.2	Resolution 3.20 Å R-free 0.314

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 1GH6	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1AD6 DOMAIN A OF HUMAN RETINOBLASTOMA TUMOR SUPPRESSOR Deposited 1997-02-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 378–562（185 aa） Fragment：DOMAIN A	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；pH 6.0	Resolution 2.30 Å R-free 0.240
1GUX RB POCKET BOUND TO E7 LXCXE MOTIF Deposited 1997-11-15	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 372–589（218 aa） Fragment：POCKET DOMAIN Chain B 636–787（152 aa） Fragment：POCKET DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；3.5 M SODIUM FORMATE, 0.1M NA HEPES PH 7.5, 20 MIROMOLAR CDCL2	Resolution 1.85 Å R-free 0.289
1H25 CDK2/Cyclin A in complex with an 11-residue recruitment peptide from retinoblastoma-associated protein Deposited 2002-07-31	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 868–878（11 aa） Fragment：RESIDUES 869-878	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；0.8M KCL, 1.2M (NH4)2SO4, 40MM HEPES PH 7.0. PROTEIN CONCENTRATION = 10MG/ML	Resolution 2.50 Å R-free 0.266
1O9K Crystal structure of the retinoblastoma tumour suppressor protein bound to E2F peptide Deposited 2002-12-16	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 372–589（218 aa） Fragment：DOMAIN A, RESIDUES 372-589 Chain B 636–787（152 aa） Fragment：DOMAIN B, RESIDUES 636-787	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.8；pH 7.80	Resolution 2.60 Å R-free 0.285
1O9K Crystal structure of the retinoblastoma tumour suppressor protein bound to E2F peptide Deposited 2002-12-16	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 372–589（218 aa） Fragment：DOMAIN A, RESIDUES 372-589 Chain D 636–787（152 aa） Fragment：DOMAIN B, RESIDUES 636-787	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.8；pH 7.80	Resolution 2.60 Å R-free 0.285
1O9K Crystal structure of the retinoblastoma tumour suppressor protein bound to E2F peptide Deposited 2002-12-16	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 372–589（218 aa） Fragment：DOMAIN A, RESIDUES 372-589 Chain F 636–787（152 aa） Fragment：DOMAIN B, RESIDUES 636-787	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.8；pH 7.80	Resolution 2.60 Å R-free 0.285
1O9K Crystal structure of the retinoblastoma tumour suppressor protein bound to E2F peptide Deposited 2002-12-16	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain G 372–589（218 aa） Fragment：DOMAIN A, RESIDUES 372-589 Chain H 636–787（152 aa） Fragment：DOMAIN B, RESIDUES 636-787	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.8；pH 7.80	Resolution 2.60 Å R-free 0.285
1PJM Mouse Importin alpha-bipartite NLS from human retinoblastoma protein Complex Deposited 2003-06-03	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 857–876（20 aa） Fragment：NLS (nuclear localization signal) bipartite peptide	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；293 K；Sodium Citrate, DTT, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.50 Å R-free 0.239
2AZE Structure of the Rb C-terminal domain bound to an E2F1-DP1 heterodimer Deposited 2005-09-10	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 829–874（46 aa） Fragment：C-terminal core domain (residues 829-874)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；298 K；Sodium Citrate, Ammonium Sulfate, PEG 400, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.55 Å R-free 0.262
2AZE Structure of the Rb C-terminal domain bound to an E2F1-DP1 heterodimer Deposited 2005-09-10	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 829–874（46 aa） Fragment：C-terminal core domain (residues 829-874)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；298 K；Sodium Citrate, Ammonium Sulfate, PEG 400, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.55 Å R-free 0.262
2QDJ Crystal structure of the Retinoblastoma protein N-domain provides insight into tumor suppression, ligand interaction and holoprotein architecture Deposited 2007-06-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 52–355（304 aa） Fragment：N-terminal domain	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；277 K；0.2 M Na acetate, 25% (w/v) PEG 4000, 0.1 M Tris, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.00 Å R-free 0.276
2R7G Structure of the retinoblastoma protein pocket domain in complex with adenovirus E1A CR1 domain Deposited 2007-09-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 380–581（202 aa） Fragment：Pocket domain, deletion of residues 582-642 Chain A 643–787（145 aa） Fragment：Pocket domain, deletion of residues 582-642 Chain C 380–581（202 aa） Fragment：Pocket domain, deletion of residues 582-642 Chain C 643–787（145 aa） Fragment：Pocket domain, deletion of residues 582-642	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6；293 K；15mM magnesium acetate tetrahydrate, 50mM sodium cacodylate trihydrate, pH 6.0 and 1.7M ammonium sulfate, VAPOR DIFFUSION, temperature 293K	Resolution 1.67 Å R-free 0.218
3N5U Crystal structure of an Rb C-terminal peptide bound to the catalytic subunit of PP1 Deposited 2010-05-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 870–882（13 aa） Fragment：UNP residues 870-882	Not recorded	MN MANGANESE (II) ION × 4 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions hanging drop；pH 7.5；298 K；100mM HEPES, 200mM MgCl2, 18% PEG 4000, pH 7.5, hanging drop, temperature 298K	Resolution 3.20 Å R-free 0.261
3N5U Crystal structure of an Rb C-terminal peptide bound to the catalytic subunit of PP1 Deposited 2010-05-25	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 870–882（13 aa） Fragment：UNP residues 870-882	Not recorded	MN MANGANESE (II) ION × 2 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions hanging drop；pH 7.5；298 K；100mM HEPES, 200mM MgCl2, 18% PEG 4000, pH 7.5, hanging drop, temperature 298K	Resolution 3.20 Å R-free 0.261
3POM Crystal Structure of the Unliganded Retinoblastoma Protein Pocket Domain Deposited 2010-11-23	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 380–577（198 aa） Fragment：Pocket Domain, Domain A, UNP residues 380-577, Domain B, UNP residues 643-787 Chain A 643–783（141 aa） Fragment：Pocket Domain, Domain A, UNP residues 380-577, Domain B, UNP residues 643-787	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 10.6；277 K；100 mM CAPS, 10% PEG 3350, pH 10.6, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.50 Å R-free 0.262
3POM Crystal Structure of the Unliganded Retinoblastoma Protein Pocket Domain Deposited 2010-11-23	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 380–577（198 aa） Fragment：Pocket Domain, Domain A, UNP residues 380-577, Domain B, UNP residues 643-787 Chain B 643–783（141 aa） Fragment：Pocket Domain, Domain A, UNP residues 380-577, Domain B, UNP residues 643-787	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 10.6；277 K；100 mM CAPS, 10% PEG 3350, pH 10.6, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.50 Å R-free 0.262
4ELJ Crystal structure of the inactive retinoblastoma protein phosphorylated at T373 Deposited 2012-04-10	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 53–244（192 aa） Fragment：UNP residues 53-244, 268-582, 642-787 Chain A 268–582（315 aa） Fragment：UNP residues 53-244, 268-582, 642-787 Chain A 642–787（146 aa） Fragment：UNP residues 53-244, 268-582, 642-787	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；277.15 K；100mM HEPES, 100mM Ammonium Fluoride, 16% PEG4K, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 277.15K	Resolution 2.70 Å R-free 0.266
4ELL Structure of the inactive retinoblastoma protein pocket domain Deposited 2012-04-10	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 380–787（408 aa） Fragment：POCKET DOMAIN, UNP residues 380-787	Mutation：S608E, L561F	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；277.15 K；100mM sodium citrate, 1mM LiCl, 18% PEG 8K., pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 277.15K	Resolution 1.98 Å R-free 0.238
4ELL Structure of the inactive retinoblastoma protein pocket domain Deposited 2012-04-10	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 380–787（408 aa） Fragment：POCKET DOMAIN, UNP residues 380-787	Mutation：S608E, L561F	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；277.15 K；100mM sodium citrate, 1mM LiCl, 18% PEG 8K., pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 277.15K	Resolution 1.98 Å R-free 0.238
9DGK The Retinoblastoma Protein with Mutation M704V Deposited 2024-09-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 380–793（414 aa）	Mutation：M704V, S608E, S612A, S780A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277.15 K；18% PEG 8K, 0.1M sodium citrate, 0.1M succinate pH 5.5, 1M lithium chloride	Resolution 2.38 Å R-free 0.277
9DGK The Retinoblastoma Protein with Mutation M704V Deposited 2024-09-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 380–793（414 aa）	Mutation：M704V, S608E, S612A, S780A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277.15 K；18% PEG 8K, 0.1M sodium citrate, 0.1M succinate pH 5.5, 1M lithium chloride	Resolution 2.38 Å R-free 0.277
9DHC The Retinoblastoma Protein with Mutation S751Y Deposited 2024-09-03	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 380–793（414 aa）	Mutation：S751Y, S608E, S612A, S780A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277.15 K；18% PEG 8K, 0.1M sodium citrate, 0.1M succinate pH5.5, 1M lithium chloride	Resolution 2.32 Å R-free 0.263
9DHC The Retinoblastoma Protein with Mutation S751Y Deposited 2024-09-03	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 380–793（414 aa）	Mutation：S751Y, S608E, S612A, S780A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277.15 K；18% PEG 8K, 0.1M sodium citrate, 0.1M succinate pH5.5, 1M lithium chloride	Resolution 2.32 Å R-free 0.263
9DHF The Retinoblastoma Protein with Mutation E554K Deposited 2024-09-03	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 380–793（414 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277.15 K；18% PEG8K, 0.1M sodium citrate, 0.1M succinate pH 5.5, 1M lithium chloride	Resolution 2.26 Å R-free 0.265
9DHF The Retinoblastoma Protein with Mutation E554K Deposited 2024-09-03	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 380–793（414 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277.15 K；18% PEG8K, 0.1M sodium citrate, 0.1M succinate pH 5.5, 1M lithium chloride	Resolution 2.26 Å R-free 0.265
9DHU The Retinoblastoma Protein with Mutation E533K Deposited 2024-09-04	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 380–786（407 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；277.15 K；PEG 8K (18%), 0.1M sodium citrate, 0.1M succinate pH 5.5, 1M lithium chloride	Resolution 2.16 Å R-free 0.263
9DHU The Retinoblastoma Protein with Mutation E533K Deposited 2024-09-04	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 380–786（407 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；277.15 K；PEG 8K (18%), 0.1M sodium citrate, 0.1M succinate pH 5.5, 1M lithium chloride	Resolution 2.16 Å R-free 0.263

16 other PDB entries and 27 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RB_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–199； UniProt 379–577 Author chain B； PDBConstruct 206–333； UniProt 645–772

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1gh6
Deposition date deposition_date	2000-11-15
Structure title title	RETINOBLASTOMA POCKET COMPLEXED WITH SV40 LARGE T ANTIGEN
Keywords keywords	TUMOR SUPPRESSOR, ONCOPROTEIN, ANTITUMOR PROTEIN; ANTITUMOR PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	30.46 Å
Radius of gyration Rg (electron density) rg_electron	30.07 Å
Forward intensity I(0) i0	42422300.00
Molecular weight molecular_weight	51691.0 kDa
Excluded volume excluded_volume	65135 Å³
Envelope volume envelope_volume	87015 Å³
Hydration-shell volume shell_volume	26627 Å³
Envelope diameter envelope_diameter	109.5 Å
Shell Rg shell_rg	33.88 Å
Envelope Rg envelope_rg	30.43 Å
Shape Rg shape_rg	30.05 Å
Total Rg total_rg	30.54 Å
Total atoms total_atoms	3627
Residues n_residues	440
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	104.7 Å
Rg (real space) rg_real	30.84 Å
Rg uncertainty (real space) rg_real_error	1.02 Å
I(0) (real space) i0_real	4.2420e+07
I(0) uncertainty (real space) i0_real_error	7.1340e+05
Rg (reciprocal space) rg_reciprocal	30.68 Å
I(0) (reciprocal space) i0_reciprocal	42420000.0000
Solution quality estimate total_estimate	0.5989
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	28.2 Å
Skewness Skewness skewness	0.613
Kurtosis Kurtosis kurtosis	-0.245
Angular range angular_range	— – 0.2600 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	9171000.0000
Real-space data points n_real_points	53
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.708; Stabil: 1.000; Sysdev: 0.077; Positv: 1.000; Valcen: 0.629; Smooth: 0.798

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Large T antigen
Molecular weight formula_weight	13437.0 kDa
EC 编号 ec_number	3.6.4.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	3627

SHMREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYKKMEDGVKYAHQPDFGGFWDATEIPTYGTDEWEQWWNAFNEENLFCSEEMPSSDDEAT

来源 Source

来源生物 organism	Simian virus 40
通用名 common_name	SV40
NCBI Class编号 ncbi_taxonomy_id	1891767
宿主生物 host_organism	Escherichia coli BL21

Entity 2 Entity 2 polymer

Description description	Retinoblastoma-associated protein
Molecular weight formula_weight	39026.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGAGCVAIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKLVPRGSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYA

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21

▼

7. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d1gh6a1
Class class	a — All alpha proteins
Fold Fold fold	a.2 — Long alpha-hairpin
Superfamily Superfamily superfamily	a.2.3 — Chaperone J-domain
Family Family family	a.2.3.1 — Chaperone J-domain

Domain ID domain_id	d1gh6a2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1gh6b1
Class class	a — All alpha proteins
Fold Fold fold	a.74 — Cyclin-like
Superfamily Superfamily superfamily	a.74.1 — Cyclin-like
Family Family family	a.74.1.3 — Retinoblastoma tumor suppressor domains

Domain ID domain_id	d1gh6b2
Class class	a — All alpha proteins
Fold Fold fold	a.74 — Cyclin-like
Superfamily Superfamily superfamily	a.74.1 — Cyclin-like
Family Family family	a.74.1.3 — Retinoblastoma tumor suppressor domains

CATH v4.4 (3 domains)

Domain ID domain_id	1gh6A01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	110 — DnaJ domain

Domain ID domain_id	1gh6B01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	472 — Cyclin A; domain 1
Homologous superfamily homologous superfamily	10 — Cyclin-like

Domain ID domain_id	1gh6B02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	472 — Cyclin A; domain 1
Homologous superfamily homologous superfamily	10 — Cyclin-like

▶

8. Citations (1)

▶

Unit-cell length a length_a	127.130 Å
Unit-cell length b length_b	127.130 Å
Unit-cell length c length_c	96.190 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	I 4
Space-group number int_tables_number	79
Crystal system crystal_system	—

Resolution resolution	3.200 Å
Low-resolution limit resolution_low	19.920 Å
R factor r_factor	0.2480
R_work r_work	0.2480
R_free r_free	0.3140

fit	/app/data/saxs_computation/gh/1gh6/1gh6.fit
pddf	/app/data/pr_computation/gh/1gh6/1gh6.pr.out
profile	/app/data/saxs_computation/gh/1gh6/1gh6.dat

RETINOBLASTOMA POCKET COMPLEXED WITH SV40 LARGE T ANTIGEN

1. Protein Identity and Related Structures Protein Identity & Related Structures

Large T antigen

State in the Current Structure

Other States of the Same Protein in the Database

Retinoblastoma-associated protein

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

7. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (4 domains)

CATH v4.4 (3 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)