SAXSdb — 4rxh

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Importin subunit alpha

Neurospora crassa

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Large T antigen × 2 （P03070） water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9C2K9_NEUCS
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 22–495； UniProt 75–548

Large T antigen

OrganismNot specified

UniProt P03070

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Importin subunit alpha × 1 （Q9C2K9） water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LT_SV40
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–8； UniProt 125–132 Author chain C； PDBConstruct 1–8； UniProt 125–132

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4rxh
Deposition date deposition_date	2014-12-11
Structure title title	Crystal Structure of Importin-alpha from Neurospora crassa complexed with SV40NLS
Keywords keywords	ARM repeat, NLS, nuclear import, importin-alpha, TRANSPORT PROTEIN; TRANSPORT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4rxh__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4rxh__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4rxh__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	28.24 Å
Rg (electron density)	28.33 Å
Total Rg	28.72 Å
Atom count	3277
Residues	434
Excluded volume	59043 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4rxh__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Importin subunit alpha
Molecular weight formula_weight	53602.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B
Atom count atom_count	3626

MGSSHHHHHHSSGLVPRGSHMTESQLSEDLPKMVEGVFSSEIDKQIQATTKFRKLLSKERNPPIEEVIKTGVVGRFVEFLRSPHTLVQFEAAWALTNIASGSATQTQVVIEAGAVPIFVELLGSPEPDVREQAVWALGNIAGDSPQCRDYVLSCGALRPLLTLLGDSRKLSMLRNATWTLSNFCRGKTPQPDWNTIAPALPVLAKLVYSLDDEVLIDACWAISYLSDGSNDKIQAVIEAGIPRRLVELLMHASTSVQTPALRSVGNIVTGDDVQTQVIINCGALPCLLSLLSSNKDGIRKEACWTISNITAGNSAQIQSVIDANIIPPLIHLLSHADLKTRKEACWAISNATSGGLQKPDQIRYLVAQGCIKPLCDLLACPDNKIIQVALDGLENILKVGELDKNAAGDGPDSINRYALFIEECGGMEKIHDCQTNANEEIYMKAYNIIEKYFSDEDEAGDEAMGAQQQFGFGASGGAQQGGFNFGANGTESMDM

Source Source

Source organism organism	Neurospora crassa
NCBI taxonomy ID ncbi_taxonomy_id	5141
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Large T antigen
Molecular weight formula_weight	985.3 kDa
EC 编号 ec_number	3.6.4.-
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C

PPKKKRKV

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	349

▼

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	4rxhB00
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	10 — Leucine-rich Repeat Variant
Homologous superfamily homologous superfamily	10 — Leucine-rich Repeat Variant

▶

Unit-cell length a length_a	45.127 Å
Unit-cell length b length_b	64.494 Å
Unit-cell length c length_c	185.650 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.755 Å
Low-resolution limit resolution_low	36.975 Å
R factor r_factor	0.1840
R_work r_work	0.1830
R_free r_free	0.2109

Crystal Structure of Importin-alpha from Neurospora crassa complexed with SV40NLS

1. Protein Identity and Related Structures Protein Identity & Related Structures

Importin subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Large T antigen

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4rxh__assembly_1__model_1

4rxh__assembly_1__model_1 | I(q)

4rxh__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)

Crystal Structure of Importin-alpha from Neurospora crassa complexed with SV40NLS

1. Protein Identity and Related Structures Protein Identity & Related Structures

Importin subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large T antigen

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4rxh__assembly_1__model_1

4rxh__assembly_1__model_1 | I(q)

4rxh__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)