1z1d

Structural Model for the interaction between RPA32 C-terminal domain and SV40 T antigen origin binding domain.

Method: SOLUTION NMR D_max: 74.2 Å Quality: REASONABLE

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Replication protein A 32 kDa subunit

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 172–270	Fragment：RPA32 C-terminal domain	Large T antigen × 1 （P03070）	SOLUTION NMR NMR measurement conditions：pH 7；298 K；Ionic strength (raw mmCIF value) 0.03 M；Pressure ambient NMR sample composition：0.2mM RPA32C U-15N, 0.6mM Tag-OBD, 20mM Tris buffer pH 7.0, 2 mM DTT, 5mM MgCl2, 90% H2O, 10% D2O \| 90% H2O/10% D2O NMR sample composition：0.2mM Tag-OBD U-15N, 0.6mM RPA32C, 20mM Tris buffer pH 7.0, 2mM DTT, 5mM MgCl2, 90% H2O, 10% D2O \| 90% H2O/10% D2O	Resolution not provided

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1Z1D	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1DPU SOLUTION STRUCTURE OF THE C-TERMINAL DOMAIN OF HUMAN RPA32 COMPLEXED WITH UNG2(73-88) Deposited 1999-12-27	Different construct Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 202–270（69 aa） Fragment：C-TERMINAL DOMAIN (RESIDUES 172-270)	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 25mM PHOSPHATE, 50mM NACL；Pressure AMBIENT NMR sample composition 1MM RPA32(172-270) U- 15N,13C; 1.2 MM UNG2(73- 88) NA; 25MM PHOSPHATE BUFFER NA; 50MM NACL; 5 MM DTT NA	Resolution not provided
1L1O Structure of the human Replication Protein A (RPA) trimerization core Deposited 2002-02-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 44–171（128 aa） Fragment：RPA32 central domain (residues 44-171) Chain E 44–171（128 aa） Fragment：RPA32 central domain (residues 44-171)	Not recorded	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.8；300 K；0.1 M Hepes, 9% glycerol, and 1.6 M ammonium sulfate, pH 7.8, VAPOR DIFFUSION, SITTING DROP, temperature 300K	Resolution 2.80 Å R-free 0.282
1QUQ COMPLEX OF REPLICATION PROTEIN A SUBUNITS RPA14 AND RPA32 Deposited 1999-07-02	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 43–171（129 aa） Fragment：CENTRAL DOMAIN, RESIDUES 43-171 Chain C 43–171（129 aa） Fragment：CENTRAL DOMAIN, RESIDUES 43-171	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；0.1 M MES, 0.75 M AMMONIUM SULPHATE, 20% PEG 8K, 10 MM DTT., pH 6.50	Resolution 2.50 Å R-free 0.291
1QUQ COMPLEX OF REPLICATION PROTEIN A SUBUNITS RPA14 AND RPA32 Deposited 1999-07-02	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 43–171（129 aa） Fragment：CENTRAL DOMAIN, RESIDUES 43-171	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；0.1 M MES, 0.75 M AMMONIUM SULPHATE, 20% PEG 8K, 10 MM DTT., pH 6.50	Resolution 2.50 Å R-free 0.291
1QUQ COMPLEX OF REPLICATION PROTEIN A SUBUNITS RPA14 AND RPA32 Deposited 1999-07-02	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 43–171（129 aa） Fragment：CENTRAL DOMAIN, RESIDUES 43-171	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；0.1 M MES, 0.75 M AMMONIUM SULPHATE, 20% PEG 8K, 10 MM DTT., pH 6.50	Resolution 2.50 Å R-free 0.291
2PI2 Full-length Replication protein A subunits RPA14 and RPA32 Deposited 2007-04-12	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–270（270 aa）	Not recorded	DIO 1,4-DIETHYLENE DIOXIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；10% dioxane, 0.1 M MES pH 6.5, 39% saturated ammonium sulfate, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.00 Å R-free 0.255
2PI2 Full-length Replication protein A subunits RPA14 and RPA32 Deposited 2007-04-12	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–270（270 aa）	Not recorded	DIO 1,4-DIETHYLENE DIOXIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；10% dioxane, 0.1 M MES pH 6.5, 39% saturated ammonium sulfate, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.00 Å R-free 0.255
2PI2 Full-length Replication protein A subunits RPA14 and RPA32 Deposited 2007-04-12	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–270（270 aa）	Not recorded	DIO 1,4-DIETHYLENE DIOXIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；10% dioxane, 0.1 M MES pH 6.5, 39% saturated ammonium sulfate, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.00 Å R-free 0.255
2PI2 Full-length Replication protein A subunits RPA14 and RPA32 Deposited 2007-04-12	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–270（270 aa）	Not recorded	DIO 1,4-DIETHYLENE DIOXIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；10% dioxane, 0.1 M MES pH 6.5, 39% saturated ammonium sulfate, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.00 Å R-free 0.255
2PQA Crystal Structure of Full-length Human RPA 14/32 Heterodimer Deposited 2007-05-01	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 42–172（131 aa） Fragment：UNP residues 42-172	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；293 K；0.1 M Bicine pH 9, 20% saturated ammonium sulfate, 10% acetonitrile, VAPOR DIFFUSION, HANGING DROP, temperature 293K, pH 9.0	Resolution 2.50 Å R-free 0.280
2PQA Crystal Structure of Full-length Human RPA 14/32 Heterodimer Deposited 2007-05-01	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 42–172（131 aa） Fragment：UNP residues 42-172	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；293 K；0.1 M Bicine pH 9, 20% saturated ammonium sulfate, 10% acetonitrile, VAPOR DIFFUSION, HANGING DROP, temperature 293K, pH 9.0	Resolution 2.50 Å R-free 0.280
2Z6K Crystal structure of full-length human RPA14/32 heterodimer Deposited 2007-08-03	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–270（270 aa） Fragment：residues 42-175	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 5.9；293 K；0.95M KNa tartrate, 0.1M MES, 10mM DTT, pH 5.9, EVAPORATION, temperature 293K	Resolution 3.00 Å R-free 0.269
2Z6K Crystal structure of full-length human RPA14/32 heterodimer Deposited 2007-08-03	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–270（270 aa） Fragment：residues 42-175	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 5.9；293 K；0.95M KNa tartrate, 0.1M MES, 10mM DTT, pH 5.9, EVAPORATION, temperature 293K	Resolution 3.00 Å R-free 0.269
3KDF X-ray Crystal Structure of the Human Replication Protein A Complex from Wheat Germ Cell Free Expression Deposited 2009-10-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 41–172（132 aa） Fragment：Residues 41-172 Chain D 41–172（132 aa） Fragment：Residues 41-172	Mutation：A41S Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：A41S Non-standard monomer：Yes (specific site not provided by mmCIF)	EDO 1,2-ETHANEDIOL × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；11% PEG 8000, 50 mM BisTris-propane pH 7.0, 50 mM NaCl, 5 mM HEPES pH 7.0, 0.3 mM TCEP, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 1.98 Å R-free 0.206
3KDF X-ray Crystal Structure of the Human Replication Protein A Complex from Wheat Germ Cell Free Expression Deposited 2009-10-22	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 41–172（132 aa） Fragment：Residues 41-172	Mutation：A41S Non-standard monomer：Yes (specific site not provided by mmCIF)	EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；11% PEG 8000, 50 mM BisTris-propane pH 7.0, 50 mM NaCl, 5 mM HEPES pH 7.0, 0.3 mM TCEP, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 1.98 Å R-free 0.206
3KDF X-ray Crystal Structure of the Human Replication Protein A Complex from Wheat Germ Cell Free Expression Deposited 2009-10-22	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 41–172（132 aa） Fragment：Residues 41-172	Mutation：A41S Non-standard monomer：Yes (specific site not provided by mmCIF)	EDO 1,2-ETHANEDIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；11% PEG 8000, 50 mM BisTris-propane pH 7.0, 50 mM NaCl, 5 mM HEPES pH 7.0, 0.3 mM TCEP, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 1.98 Å R-free 0.206
4MQV Crystal complex of Rpa32c and Smarcal1 N-terminus Deposited 2013-09-16	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 202–270（69 aa） Fragment：C-Terminal domain, UNP residues 202-270	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8；298 K；25% PEG 4000, 0.2M Sodium Acetate, pH 8.0, VAPOR DIFFUSION, temperature 298K	Resolution 1.95 Å R-free 0.220
4MQV Crystal complex of Rpa32c and Smarcal1 N-terminus Deposited 2013-09-16	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 202–270（69 aa） Fragment：C-Terminal domain, UNP residues 202-270	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8；298 K；25% PEG 4000, 0.2M Sodium Acetate, pH 8.0, VAPOR DIFFUSION, temperature 298K	Resolution 1.95 Å R-free 0.220
4OU0 Crystal Structure of RPA32C Deposited 2014-02-14	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 202–270（69 aa） Fragment：UNP RESIDUES 202-270	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；294 K；50 mM Sodium Acetate, 20% PEG 3350, pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 294K	Resolution 1.40 Å R-free 0.238
8RK2 Human Replication protein A (RPA; trimeric core) - ssDNA complex Deposited 2023-12-22	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–270（270 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9MJ5 Catalytic domain of human DNA polymerase alpha in complex with DNA and RPA Deposited 2024-12-13	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 4 PDB declaration: hexameric	Chain B 35–270（236 aa）	Not recorded	ZN ZINC ION × 1 MG MAGNESIUM ION × 1 DCP 2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
9PD3 NER dual incision complex - DuIS Deposited 2025-06-30	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 15 PDB declaration: 17-meric	Chain O 1–270（270 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9PD4 NER dual incision complex - DuIM Deposited 2025-06-30	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 14 PDB declaration: hexadecameric	Chain O 1–270（270 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 1 ZN ZINC ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å

13 other PDB entries and 23 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RFA2_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–103； UniProt 172–270

Large T antigen

Simian virus 40

UniProt P03070

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 131–259	Fragment：SV40 T antigen Origin binding domain	Replication protein A 32 kDa subunit × 1 （P15927）	SOLUTION NMR NMR measurement conditions：pH 7；298 K；Ionic strength (raw mmCIF value) 0.03 M；Pressure ambient NMR sample composition：0.2mM RPA32C U-15N, 0.6mM Tag-OBD, 20mM Tris buffer pH 7.0, 2 mM DTT, 5mM MgCl2, 90% H2O, 10% D2O \| 90% H2O/10% D2O NMR sample composition：0.2mM Tag-OBD U-15N, 0.6mM RPA32C, 20mM Tris buffer pH 7.0, 2mM DTT, 5mM MgCl2, 90% H2O, 10% D2O \| 90% H2O/10% D2O	Resolution not provided

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 1Z1D	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1EJL MOUSE IMPORTIN ALPHA-SV40 LARGE T ANTIGEN NLS PEPTIDE COMPLEX Deposited 2000-03-03	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 126–132（7 aa） Fragment：NLS (NUCLEAR LOCALIZATION SIGNAL) MONOPARTITE PEPTIDE, RESIDUES 126-132 Chain B 126–132（7 aa） Fragment：NLS (NUCLEAR LOCALIZATION SIGNAL) MONOPARTITE PEPTIDE, RESIDUES 126-132	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；sodium citrate, Hepes, DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.80 Å R-free 0.254
1GH6 RETINOBLASTOMA POCKET COMPLEXED WITH SV40 LARGE T ANTIGEN Deposited 2000-11-15	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 7–117（111 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.2；pH 7.2	Resolution 3.20 Å R-free 0.314
1N25 Crystal structure of the SV40 Large T antigen helicase domain Deposited 2002-10-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 260–627（368 aa） Fragment：helicase domain Chain B 260–627（368 aa） Fragment：helicase domain	Not recorded	ZN ZINC ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.6；291 K；glycerol, DTT, Hepes, NaCl, EtOH, EDTA, pH 7.6, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.80 Å R-free 0.276
1Q1S Mouse Importin alpha- phosphorylated SV40 CN peptide complex Deposited 2003-07-22	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 110–133（24 aa） Fragment：CN peptide - Ser112 chemically phosphorylated Chain B 110–133（24 aa） Fragment：CN peptide - Ser112 chemically phosphorylated Chain C 70–529（460 aa） Fragment：NLS binding domain (70-529)	Mutation：S120A, S123A, T124A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：S120A, S123A, T124A Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；Sodium Citrate, DTT, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.30 Å R-free 0.221
1Q1T Mouse Importin alpha: non-phosphorylated SV40 CN peptide complex Deposited 2003-07-22	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 110–133（24 aa） Fragment：CN peptide Chain B 110–133（24 aa） Fragment：CN peptide Chain C 70–529（460 aa） Fragment：NLS binding domain (70-529)	Mutation：S120A, S123A, T124A Mutation：S120A, S123A, T124A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.25；293 K；Sodium Citrate, DTT, pH 6.25, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.50 Å R-free 0.233
1SVL Co-crystal structure of SV40 large T antigen helicase domain and ADP Deposited 2004-03-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 251–627（377 aa） Fragment：HELICASE DOMAIN Chain B 251–627（377 aa） Fragment：HELICASE DOMAIN Chain C 251–627（377 aa） Fragment：HELICASE DOMAIN	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 6 ADP ADENOSINE-5'-DIPHOSPHATE × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.25；277 K；Tris, magnesium chloride, PEG 8000, DTT, pH 7.25, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.95 Å R-free 0.264
1SVM Co-crystal structure of SV40 large T antigen helicase domain and ATP Deposited 2004-03-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 251–627（377 aa） Fragment：HELICASE DOMAIN Chain B 251–627（377 aa） Fragment：HELICASE DOMAIN Chain C 251–627（377 aa） Fragment：HELICASE DOMAIN Chain D 251–627（377 aa） Fragment：HELICASE DOMAIN Chain E 251–627（377 aa） Fragment：HELICASE DOMAIN Chain F 251–627（377 aa） Fragment：HELICASE DOMAIN	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 6 ATP ADENOSINE-5'-TRIPHOSPHATE × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.25；277 K；Tris, magnesium chloride, PEG 8000, DTT, pH 7.25, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.94 Å R-free 0.241
1SVO Structure of SV40 large T antigen helicase domain Deposited 2004-03-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 251–627（377 aa） Fragment：HELICASE DOMAIN Chain B 251–627（377 aa） Fragment：HELICASE DOMAIN	Not recorded	ZN ZINC ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.6；277 K；HEPES, NACL, ETHANOL, EDTA, DTT, pH 7.6, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.60 Å R-free 0.271
1TBD SOLUTION STRUCTURE OF THE ORIGIN DNA BINDING DOMAIN OF SV40 T-ANTIGEN, NMR, MINIMIZED AVERAGE STRUCTURE Deposited 1996-11-04	Different construct Different oligomeric state Different experimental conditions	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 131–260（130 aa） Fragment：DNA BINDING DOMAIN	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 5.5；303 K	Resolution not provided
2FUF Crystal structure of the SV40 large T antigen origin-binding domain Deposited 2006-01-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 131–260（130 aa） Fragment：DNA binding domain (residues 131-259)	Non-standard monomer：Yes (specific site not provided by mmCIF)	FLC CITRATE ANION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.7；298 K；1.6 M Sodium citrate, pH 6.7, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.45 Å R-free 0.189
2IF9 Crystal Structure of SV40 T-antigen origin binding domain disulfide-linked dimer Deposited 2006-09-20	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 131–260（130 aa） Fragment：origin binding domain Chain B 131–260（130 aa） Fragment：origin binding domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.6；293 K；30 % peg 4000, 0.1M sodium citrate (pH 5.6), 0.2 M ammonium acetate, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.59 Å R-free 0.296
2IPR Origin binding domain of the SV40 large T antigen (residues 131-259). P21 crystal form Deposited 2006-10-12	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 131–259（129 aa） Fragment：Origin binding domain (residues 131-259) Chain B 131–259（129 aa） Fragment：Origin binding domain (residues 131-259)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.1；300 K；20 mM NaSCN, 10% P4K, 0.1 Tris, pH 8.1, VAPOR DIFFUSION, HANGING DROP, temperature 300K	Resolution 1.50 Å R-free 0.204
2ITJ Origin binding domain of the SV40 large T antigen (residues 131-259). P212121 crystal form Deposited 2006-10-19	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 131–259（129 aa） Fragment：Origin binding domain (residues 131-259) Chain B 131–259（129 aa） Fragment：Origin binding domain (residues 131-259)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；297 K；20 mM NaAc, 20% PEG4K, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 297K	Resolution 2.50 Å R-free 0.289
2ITL The origin binding domain of the SV40 large T antigen bound to the functional pen palindrome DNA (23 bp) Deposited 2006-10-19	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: octameric	Chain A 131–259（129 aa） Fragment：Origin binding domain (residues 131-259) Chain B 131–259（129 aa） Fragment：Origin binding domain (residues 131-259)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；297 K；20 mM di-ammonium hydrogen citrate, 20% PEG 3000, and 10 mM MgCl2, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 297K	Resolution 1.65 Å R-free 0.251
2NL8 The origin binding domain of the SV40 large T antigen bound non specifically to a 17 bp palindrome DNA (sites 1 and 3) Deposited 2006-10-19	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 131–259（129 aa） Fragment：Origin binding domain (residues 131-259)	Mutation：CYS216SER	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；297 K；20 mM NaAcetate, 20% PEG 3000 + 4% PEG 600, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 297K	Resolution 2.30 Å R-free 0.299
2NTC Crystal Structure of sv40 large T antigen origin binding domain with DNA Deposited 2006-11-07	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 131–260（130 aa） Fragment：Origin binding domain (residues 131-259) Chain B 131–260（130 aa） Fragment：Origin binding domain (residues 131-259)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；273 K；0.1 M sodium cacodylate pH 6.5, 0.1 M calcium acetate, 30 % v/v peg 8000, 20 % glycerol, VAPOR DIFFUSION, temperature 273K	Resolution 2.40 Å R-free 0.287
2TBD SV40 T ANTIGEN DNA-BINDING DOMAIN, NMR, 30 STRUCTURES Deposited 1997-01-09	Different construct Different oligomeric state Different experimental conditions	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 131–260（130 aa） Fragment：DNA BINDING DOMAIN, RESIDUES 131 - 260	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 5.5；303 K	Resolution not provided
3QK2 Structure-Based Analysis of the Interaction between the Simian Virus 40 T-Antigen Origin Binding Domain and Single-Stranded DNA Deposited 2011-01-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 131–260（130 aa） Fragment：origin binding domain	Non-standard monomer：Yes (specific site not provided by mmCIF)	SCN THIOCYANATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；278 K；0.2 M thiocyanate [SCN], 17.5% PEG 3350, 5% glycerol, VAPOR DIFFUSION, temperature 278K	Resolution 1.64 Å R-free 0.187
3QN2 Structure-based design of a disulfide-linked oligomeric form of the Simian Virus 40 (SV40) large T antigen DNA binding domain Deposited 2011-02-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 131–260（130 aa） Fragment：origin binding domain	Mutation：F151C, C216A, D256C	FLC CITRATE ANION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；295 K；1.6 M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.66 Å R-free 0.191
4FGN Crystal structure of the SV40 large T-antigen origin bining domain bound to Site I DNA Deposited 2012-06-04	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 131–260（130 aa） Fragment：origin binding domain, UNP residues 131-260 Chain B 131–260（130 aa） Fragment：origin binding domain, UNP residues 131-260	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；291 K；0.1M sodium acetate pH 4.6, .2M ammonium sulfate, 30 % Peg 4000, 10 mM CaCl2, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.20 Å R-free 0.267
4RXH Crystal Structure of Importin-alpha from Neurospora crassa complexed with SV40NLS Deposited 2014-12-11	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 125–132（8 aa） Chain C 125–132（8 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；297 K；20 Mm Bicine pH 8.5, 20%(w/v) PEG 6000, VAPOR DIFFUSION, SITTING DROP, temperature 297K	Resolution 1.76 Å R-free 0.211
5D9I SV40 Large T antigen origin binding domain bound to artificial DNA fork Deposited 2015-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: tetrameric	Chain A 131–260（130 aa） Fragment：unp residues 131-260 Chain B 131–260（130 aa） Fragment：unp residues 131-260	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	EDO 1,2-ETHANEDIOL × 2 CA CALCIUM ION × 2 ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；100 mM Tris, 300 mM NH4Cl, 28% polyethylene glycol [PEG] 4000, 20 mM CaCl2	Resolution 1.70 Å R-free 0.223
9EVH SV40 large T antigen assembly with DNA in presence of ADP Deposited 2024-03-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 1–708（708 aa） Chain B 1–708（708 aa） Chain C 1–708（708 aa） Chain D 1–708（708 aa） Chain E 1–708（708 aa） Chain F 1–708（708 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8；200 mM NaCl, 50 mM Tris-HCl (pH 8.0), 1 mM ADP. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.38 Å
9EVP SV40 LTAg assembly with DNA in presence of AMPPNP and Mg2+. Deposited 2024-04-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 6 MG MAGNESIUM ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM TrisHCl (pH 7.5), 1 mM DTT, 100 mM NaCl, 5 mM MgCl, 3 mM AMP-PMP. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.12 Å
9EXD SV40 LTAg assembly in presence of ATP. Deposited 2024-04-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–708（708 aa） Chain B 1–708（708 aa） Chain C 1–708（708 aa） Chain D 1–708（708 aa） Chain E 1–708（708 aa） Chain F 1–708（708 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8；200 mM NaCl, 50 mM Tris-HCl (pH 8.0), 1 mM ATP. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9F3T Active SV40 LTAg complex with DNA (3D variability component_000, frame_010). Deposited 2024-04-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9F3U Active SV40 LTAg complex with DNA (3D variability component_001, frame_010). Deposited 2024-04-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9F5I Active SV40 LTAg complex with DNA (3D variability component_000, frame_005). Deposited 2024-04-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9F73 Active SV40 LTAg complex with DNA (3D variability component_002, frame_015). Deposited 2024-05-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9F74 Active SV40 LTAg complex with DNA (3D variability component_000, frame_015). Deposited 2024-05-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9F75 Active SV40 LTAg complex with DNA (3D variability component_000, frame_019). Deposited 2024-05-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9F7N Active SV40 LTAg complex with DNA (3D variability component_000, frame_000). Deposited 2024-05-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9F9N Active SV40 LTAg complex with DNA (3D variability component_001, frame_005). Deposited 2024-05-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9F9O Active SV40 LTAg complex with DNA (3D variability component_001, frame_015). Deposited 2024-05-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9F9W Active SV40 LTAg complex with DNA (3D variability component_001, frame_019). Deposited 2024-05-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9F9X Active SV40 LTAg complex with DNA (3D variability component_001, frame_000). Deposited 2024-05-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9FA1 Active SV40 LTAg complex with DNA (3D variability component_002, frame_010). Deposited 2024-05-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9FA2 Active SV40 LTAg complex with DNA (3D variability component_002, frame_005). Deposited 2024-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9FB0 Active SV40 LTAg complex with DNA (3D variability component_002, frame_019). Deposited 2024-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9FB4 SV40 large T antigen assembly with DNA in presence of ATP. Deposited 2024-05-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: octameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8；200 mM NaCl, 50 mM Tris-HCl (pH 8.0), 1 mM ATP. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.13 Å
9FB5 Active SV40 LTAg complex with DNA (3D variability component_002, frame_000). Deposited 2024-05-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: heptameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；50 mM HEPES (pH 7.5), 1 mM ATP, 3 mM MgCl2, 1 mM DTT and 50 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9FB6 SV40 large T antigen assembly with DNA in presence of ATP. Deposited 2024-05-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: octameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8；200 mM NaCl, 50 mM Tris-HCl (pH 8.0), 1 mM ATP. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.13 Å
9KAE CryoEM structure of LTag bound to SV40 EP half origin DNA Deposited 2024-10-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: octameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 6 MG MAGNESIUM ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9KAK CryoEM structure of LTag bound to SV40 AT half origin DNA Deposited 2024-10-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 6 PDB declaration: octameric	Chain A 266–627（362 aa） Chain B 266–627（362 aa） Chain C 266–627（362 aa） Chain D 266–627（362 aa） Chain E 266–627（362 aa） Chain F 266–627（362 aa）	Not recorded	ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 6 MG MAGNESIUM ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å

44 other PDB entries and 44 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TALA_SV40
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 3–131； UniProt 131–259

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1z1d
Deposition date deposition_date	2005-03-03
Structure title title	Structural Model for the interaction between RPA32 C-terminal domain and SV40 T antigen origin binding domain.
Keywords keywords	Winged Helix-turn-Helix motif, Origin binding domain, Protein-Protein Complex, REPLICATION; REPLICATION
Experimental Method method	SOLUTION NMR

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	18.37 Å
Radius of gyration Rg (electron density) rg_electron	18.30 Å
Forward intensity I(0) i0	2774530000.00
Molecular weight molecular_weight	454660.0 kDa
Excluded volume excluded_volume	571100 Å³
Envelope volume envelope_volume	58792 Å³
Hydration-shell volume shell_volume	23416 Å³
Envelope diameter envelope_diameter	79.5 Å
Shell Rg shell_rg	28.28 Å
Envelope Rg envelope_rg	21.57 Å
Shape Rg shape_rg	18.25 Å
Total Rg total_rg	18.61 Å
Total atoms total_atoms	63860
Residues n_residues	4000
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	74.2 Å
Rg (real space) rg_real	18.47 Å
Rg uncertainty (real space) rg_real_error	0.58 Å
I(0) (real space) i0_real	2.7750e+09
I(0) uncertainty (real space) i0_real_error	3.7630e+07
Rg (reciprocal space) rg_reciprocal	18.45 Å
I(0) (reciprocal space) i0_reciprocal	2775000000.0000
Solution quality estimate total_estimate	0.6646
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	19.1 Å
Skewness Skewness skewness	0.577
Kurtosis Kurtosis kurtosis	0.034
Angular range angular_range	— – 0.4350 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	11080000.0000
Real-space data points n_real_points	75
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.361; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.554; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Replication protein A 32 kDa subunit
Molecular weight formula_weight	10999.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	63860

GSHMANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Large T antigen
Molecular weight formula_weight	15111.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

GSKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSVTFISRHNSYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTRDPFSVIEESLPGGLKEHDFNP

来源 Source

来源生物 organism	Simian virus 40
NCBI Class编号 ncbi_taxonomy_id	10633
宿主生物 host_organism	Escherichia coli BL21(DE3)

▼

7. Fold Classification (SCOP + CATH) 5 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d1z1da_
Class class	a — All alpha proteins
Fold Fold fold	a.4 — DNA/RNA-binding 3-helical bundle
Superfamily Superfamily superfamily	a.4.5 — 'Winged helix' DNA-binding domain
Family Family family	a.4.5.16 — C-terminal domain of RPA32

Domain ID domain_id	d1z1db2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.89 — Origin of replication-binding domain, RBD-like
Superfamily Superfamily superfamily	d.89.1 — Origin of replication-binding domain, RBD-like
Family Family family	d.89.1.1 — The origin DNA-binding domain of SV40 T-antigen

Domain ID domain_id	d1z1db3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (2 domains)

Domain ID domain_id	1z1dA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	10 — Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain

Domain ID domain_id	1z1dB00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1310 — Replication Protein E1; Chain: A,
Homologous superfamily homologous superfamily	20 —

▶

8. Citations (3)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

fit	/app/data/saxs_computation/z1/1z1d/1z1d.fit
pddf	/app/data/pr_computation/z1/1z1d/1z1d.pr.out
profile	/app/data/saxs_computation/z1/1z1d/1z1d.dat

Structural Model for the interaction between RPA32 C-terminal domain and SV40 T antigen origin binding domain.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Replication protein A 32 kDa subunit

State in the Current Structure

Other States of the Same Protein in the Database

Large T antigen

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

7. Fold Classification (SCOP + CATH) 5 domains

SCOP 2.08 (3 domains)

CATH v4.4 (2 domains)

8. Citations (3)

9. Files and Curves (10)

Files (7)

Curves (3)