2pkg

Structure of a complex between the A subunit of protein phosphatase 2A and the small t antigen of SV40

Method: X-RAY DIFFRACTION D_max: 129.2 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 10–589	Not recorded	Small T antigen × 1 （P03081） ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；290 K；0.2 M MgCl2, 4.5% PEG10000 (w/v), 0.1 M HEPES pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 290K	Resolution 3.30 Å R-free 0.312
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 10–589	Not recorded	Small T antigen × 1 （P03081） ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；290 K；0.2 M MgCl2, 4.5% PEG10000 (w/v), 0.1 M HEPES pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 290K	Resolution 3.30 Å R-free 0.312

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2PKG	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1B3U CRYSTAL STRUCTURE OF CONSTANT REGULATORY DOMAIN OF HUMAN PP2A, PR65ALPHA Deposited 1998-12-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–588（588 aa） Fragment：65 KD REGULATORY SUBUNIT	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.5；pH 5.5	Resolution 2.30 Å R-free 0.268
1B3U CRYSTAL STRUCTURE OF CONSTANT REGULATORY DOMAIN OF HUMAN PP2A, PR65ALPHA Deposited 1998-12-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain not uniquely mapped Reference range not declared Fragment：65 KD REGULATORY SUBUNIT	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.5；pH 5.5	Resolution 2.30 Å R-free 0.268
3C5W Complex between PP2A-specific methylesterase PME-1 and PP2A core enzyme Deposited 2008-02-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 9–46（38 aa） Chain A 400–589（190 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；290 K；25% w/v PEG3350, 100 mM ammonium citrate, and 5 mM DTT, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 290K	Resolution 2.80 Å R-free 0.263
3DW8 Structure of a Protein Phosphatase 2A Holoenzyme with B55 subunit Deposited 2008-07-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 9–589（581 aa） Fragment：A delta 8: Residues 9-589	Not recorded	MN MANGANESE (II) ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；290 K；7-10% PEG 35000, 0.10-0.15 M Sodium citrate pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 290K	Resolution 2.85 Å R-free 0.285
3DW8 Structure of a Protein Phosphatase 2A Holoenzyme with B55 subunit Deposited 2008-07-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 9–589（581 aa） Fragment：A delta 8: Residues 9-589	Not recorded	MN MANGANESE (II) ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；290 K；7-10% PEG 35000, 0.10-0.15 M Sodium citrate pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 290K	Resolution 2.85 Å R-free 0.285
3K7V Protein phosphatase 2A core complex bound to dinophysistoxin-1 Deposited 2009-10-13	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–589（589 aa）	Not recorded	SO4 SULFATE ION × 3 XT1 (2R)-3-[(2S,5R,6R,8S)-8-{(1R,2E)-3-[(2R,4a'R,5R,6'S,8'R,8a'S)-6'-{(1S,3S)-3-[(2S,3R,6R,11R)-3,11-dimethyl-1,7-dioxaspiro[5.5]undec-2-yl]-1-hydroxybutyl}-8'-hydroxy-7'-methylideneoctahydro-3H,3'H-spiro[furan-2,2'-pyrano[3,2-b]pyran]-5-yl]-1-methylprop-2-en-1-yl}-5-hydroxy-10-methyl-1,7-dioxaspiro[5.5]undec-10-en-2-yl]-2-hydroxy-2-methylpropanoic acid × 1 MN MANGANESE (II) ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；0.2 M LITHIUM SULFATE, 1.5 M AMMONIUM SULFATE, 0.1 M TRIS-CL, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.85 Å R-free 0.262
3K7W Protein phosphatase 2A core complex bound to dinophysistoxin-2 Deposited 2009-10-13	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–589（589 aa）	Not recorded	SO4 SULFATE ION × 3 XT2 (2R)-2-hydroxy-3-[(2S,5R,6R,8S)-5-hydroxy-8-{(1R,2E)-3-[(2R,4a'R,5R,6'S,8'R,8a'S)-8'-hydroxy-6'-{(1S,3S)-1-hydroxy-3-[( 2S,6R,11S)-11-methyl-1,7-dioxaspiro[5.5]undec-2-yl]butyl}-7'-methylideneoctahydro-3H,3'H-spiro[furan-2,2'-pyrano[3,2-b]p yran]-5-yl]-1-methylprop-2-en-1-yl}-10-methyl-1,7-dioxaspiro[5.5]undec-10-en-2-yl]-2-methylpropanoic acid × 1 MN MANGANESE (II) ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；0.2 M LITHIUM SULFATE, 1.5 M AMMONIUM SULFATE, 0.1 M TRIS-CL, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.96 Å R-free 0.263
4I5L Structural mechanism of trimeric PP2A holoenzyme involving PR70: insight for Cdc6 dephosphorylation Deposited 2012-11-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 9–589（581 aa） Fragment：PP2A A alpha subunit (9-589)	Not recorded	PEG DI(HYDROXYETHYL)ETHER × 8 CA CALCIUM ION × 2 MN MANGANESE (II) ION × 2 MLI MALONATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；292 K；0.1M Na Malonate, 12% PEG 3350 + 6.2mg/mL protein in buffer Tris, 150mM NaCl , pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 292K	Resolution 2.43 Å R-free 0.228
4I5L Structural mechanism of trimeric PP2A holoenzyme involving PR70: insight for Cdc6 dephosphorylation Deposited 2012-11-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 9–589（581 aa） Fragment：PP2A A alpha subunit (9-589)	Not recorded	PEG DI(HYDROXYETHYL)ETHER × 3 CA CALCIUM ION × 2 MN MANGANESE (II) ION × 2 MLI MALONATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；292 K；0.1M Na Malonate, 12% PEG 3350 + 6.2mg/mL protein in buffer Tris, 150mM NaCl , pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 292K	Resolution 2.43 Å R-free 0.228
4I5N Structural mechanism of trimeric PP2A holoenzyme involving PR70: insight for Cdc6 dephosphorylation Deposited 2012-11-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 9–589（581 aa） Fragment：PP2A A alpha subunit (9-589)	Non-standard monomer：Yes (specific site not provided by mmCIF)	CA CALCIUM ION × 2 MN MANGANESE (II) ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.75；296 K；0.03M Succinic acid with 7% PEG 3350. Protein (6.2mg/mL) in 10mM tris pH 8.0, 150mM NaCl, 5mM DTT, 1mM CaCl2, VAPOR DIFFUSION, HANGING DROP, temperature 296K	Resolution 2.80 Å R-free 0.250
4I5N Structural mechanism of trimeric PP2A holoenzyme involving PR70: insight for Cdc6 dephosphorylation Deposited 2012-11-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 9–589（581 aa） Fragment：PP2A A alpha subunit (9-589)	Non-standard monomer：Yes (specific site not provided by mmCIF)	CA CALCIUM ION × 2 MN MANGANESE (II) ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.75；296 K；0.03M Succinic acid with 7% PEG 3350. Protein (6.2mg/mL) in 10mM tris pH 8.0, 150mM NaCl, 5mM DTT, 1mM CaCl2, VAPOR DIFFUSION, HANGING DROP, temperature 296K	Resolution 2.80 Å R-free 0.250
5W0W Crystal structure of Protein Phosphatase 2A bound to TIPRL Deposited 2017-06-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 9–589（581 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	MN MANGANESE (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.2；292 K；0.1M citric acid pH 5.2, 9% PEG4000, 0.2M sodium acetate	Resolution 3.80 Å R-free 0.246
5W0W Crystal structure of Protein Phosphatase 2A bound to TIPRL Deposited 2017-06-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 9–589（581 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	MN MANGANESE (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.2；292 K；0.1M citric acid pH 5.2, 9% PEG4000, 0.2M sodium acetate	Resolution 3.80 Å R-free 0.246
5W0W Crystal structure of Protein Phosphatase 2A bound to TIPRL Deposited 2017-06-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain G 9–589（581 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	MN MANGANESE (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.2；292 K；0.1M citric acid pH 5.2, 9% PEG4000, 0.2M sodium acetate	Resolution 3.80 Å R-free 0.246
5W0W Crystal structure of Protein Phosphatase 2A bound to TIPRL Deposited 2017-06-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain J 9–589（581 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	MN MANGANESE (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.2；292 K；0.1M citric acid pH 5.2, 9% PEG4000, 0.2M sodium acetate	Resolution 3.80 Å R-free 0.246
6IUR A phosphatase complex STRN3-PP2Aa Deposited 2018-11-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 8–589（582 aa） Fragment：UNP residues 8-589 Chain B 8–589（582 aa） Fragment：UNP residues 8-589	Not recorded	TME PROPANE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；0.1M BIS-TRIS propane pH 9.0, 8.5% PEG20000	Resolution 3.33 Å R-free 0.249
6IUR A phosphatase complex STRN3-PP2Aa Deposited 2018-11-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 8–589（582 aa） Fragment：UNP residues 8-589 Chain F 8–589（582 aa） Fragment：UNP residues 8-589	Not recorded	TME PROPANE × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；0.1M BIS-TRIS propane pH 9.0, 8.5% PEG20000	Resolution 3.33 Å R-free 0.249
6NTS Protein Phosphatase 2A (Aalpha-B56alpha-Calpha) holoenzyme in complex with a Small Molecule Activator of PP2A (SMAP) Deposited 2019-01-30	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–589（589 aa）	Not recorded	L2J N-[(1R,2R,3S)-2-hydroxy-3-(10H-phenoxazin-10-yl)cyclohexyl]-4-(trifluoromethoxy)benzene-1-sulfonamide × 1 MN MANGANESE (II) ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.02 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.63 Å
7CUN The structure of human Integrator-PP2A complex Deposited 2020-08-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain P 1–589（589 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	ZN ZINC ION × 2 MN MANGANESE (II) ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7K36 Cryo-EM structure of STRIPAK complex Deposited 2020-09-10	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 1–589（589 aa）	Not recorded	MN MANGANESE (II) ION × 2 ZN ZINC ION × 2 IHP INOSITOL HEXAKISPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
7PKS Structural basis of Integrator-mediated transcription regulation Deposited 2021-08-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 30 PDB declaration: 31-meric	Chain p 1–589（589 aa）	Not recorded	MG MAGNESIUM ION × 1 ZN ZINC ION × 10 MN MANGANESE (II) ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7SOY The structure of the PP2A-B56gamma1 holoenzyme-PME-1 complex Deposited 2021-11-01	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–589（589 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
7YCX The structure of INTAC-PEC complex Deposited 2022-07-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 31 PDB declaration: 34-meric	Chain P 1–589（589 aa）	Not recorded	ZN ZINC ION × 10 MN MANGANESE (II) ION × 2 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.18 Å
8RBX Structure of Integrator-PP2A bound to a paused RNA polymerase II-DSIF-NELF-nucleosome complex Deposited 2023-12-05	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 43 PDB declaration: 46-meric	Chain p 1–589（589 aa）	Not recorded	ZN ZINC ION × 10 MG MAGNESIUM ION × 1 MN MANGANESE (II) ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
8RBZ Structure of Integrator-PP2A-SOSS-CTD post-termination complex Deposited 2023-12-05	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain p 1–589（589 aa）	Not recorded	ZN ZINC ION × 2 MN MANGANESE (II) ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
8RC4 Structure of Integrator-PP2A complex Deposited 2023-12-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: 16-meric	Chain p 1–589（589 aa）	Not recorded	MN MANGANESE (II) ION × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
8SO0 Cryo-EM structure of the PP2A:B55-FAM122A complex Deposited 2023-04-28	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 9–589（581 aa）	Not recorded	FE FE (III) ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；CHAPSO was added only immediately prior to vitrification cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
8TTB Cryo-EM structure of the PP2A:B55-ARPP19 complex Deposited 2023-08-13	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 9–589（581 aa）	Not recorded	FE FE (III) ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；CHAPSO was added only immediately prior to vitrification cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.77 Å
8TWE Cryo-EM structure of the PP2A:B55-FAM122A complex, B55 body Deposited 2023-08-21	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 9–589（581 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；CHAPSO was added only immediately prior to vitrification cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.55 Å
8TWI Cryo-EM structure of the PP2A:B55-FAM122A complex, PP2Ac body Deposited 2023-08-21	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 9–589（581 aa）	Not recorded	FE FE (III) ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8；CHAPSO was added only immediately prior to vitrification cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.69 Å
8U1X The structure of the PP2A-B56Delta holoenzyme mutant - E197K Deposited 2023-09-04	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–589（589 aa）	Not recorded	MN MANGANESE (II) ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
8U89 The structure of the PP2A-B56Delta holoenzyme mutant - E197K Deposited 2023-09-16	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–589（589 aa）	Not recorded	MN MANGANESE (II) ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
8UO5 Protein Phosphatase 2A B55 subunit in complex with IER5 Deposited 2023-10-19	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–589（589 aa）	Not recorded	FE FE (III) ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.27 Å
8UWB Crystal structure of PP2A PPP2R1A-PPP2CA-PPP2R5E phosphatase. Deposited 2023-11-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–589（589 aa） Chain D 1–589（589 aa）	Not recorded	MN MANGANESE (II) ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.77；297 K；23% (w/v) PEG 20k, 0.1 M BIS-TRIS pH 5.77	Resolution 3.15 Å R-free 0.263
8UWB Crystal structure of PP2A PPP2R1A-PPP2CA-PPP2R5E phosphatase. Deposited 2023-11-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–589（589 aa） Chain D 1–589（589 aa）	Not recorded	MN MANGANESE (II) ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.77；297 K；23% (w/v) PEG 20k, 0.1 M BIS-TRIS pH 5.77	Resolution 3.15 Å R-free 0.263
8YJB Cryo-EM structure of the human DSS1-INTAC complex Deposited 2024-03-01	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain P 1–589（589 aa）	Not recorded	ZN ZINC ION × 2 MN MANGANESE (II) ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
9C6B PP2A:B55-p107 substrate complex Deposited 2024-06-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 9–589（581 aa） Fragment：residues 9-589	Not recorded	FE2 FE (II) ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9C7T PP2A:B55-Eya3 substrate complex Deposited 2024-06-11	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 9–589（581 aa） Fragment：residues 9-589	Not recorded	FE2 FE (II) ION × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
9MIP CryoEM structure of the Protein Phasphatase 2A (Aalpha-B56gamma-Calpha) holoenzyme complex Deposited 2024-12-13	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–589（589 aa）	Not recorded	MN MANGANESE (II) ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9MZW PP2A-B55 holoenzyme Deposited 2025-01-23	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 9–589（581 aa） Fragment：residues 9-589	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.16 Å
9N0Y PP2A-B55 Holoenzyme with Eya3 Deposited 2025-01-24	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 9–589（581 aa） Fragment：residues 9-589	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.71 Å
9N0Z PP2A-B55 Holoenzyme with B55i Deposited 2025-01-24	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 9–589（581 aa） Fragment：residues 9-589	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
9VD9 Cryo-EM structure of the human DSS1-INTAC-PEC complex Deposited 2025-06-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 35 PDB declaration: 38-meric	Chain P 1–589（589 aa）	Not recorded	ZN ZINC ION × 10 MN MANGANESE (II) ION × 2 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å

34 other PDB entries and 43 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	2AAA_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–580； UniProt 10–589 Author chain B； PDBConstruct 1–580； UniProt 10–589

Small T antigen

Simian virus 40

UniProt P03081

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain C； UniProt 87–174	Fragment：residues 87-174	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform × 1 （P30153） ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；290 K；0.2 M MgCl2, 4.5% PEG10000 (w/v), 0.1 M HEPES pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 290K	Resolution 3.30 Å R-free 0.312
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain D； UniProt 87–174	Fragment：residues 87-174	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform × 1 （P30153） ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；290 K；0.2 M MgCl2, 4.5% PEG10000 (w/v), 0.1 M HEPES pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 290K	Resolution 3.30 Å R-free 0.312

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	TASM_SV40
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–88； UniProt 87–174 Author chain D； PDBConstruct 1–88； UniProt 87–174

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2pkg
Deposition date deposition_date	2007-04-17
Structure title title	Structure of a complex between the A subunit of protein phosphatase 2A and the small t antigen of SV40
Keywords keywords	Protein phosphatase 2A, small t antigen, SV40, regulation, Hydrolase REGULATOR-VIRAL PROTEIN COMPLEX; Hydrolase REGULATOR/VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	39.47 Å
Radius of gyration Rg (electron density) rg_electron	39.00 Å
Forward intensity I(0) i0	319511000.00
Molecular weight molecular_weight	148100.0 kDa
Excluded volume excluded_volume	186750 Å³
Envelope volume envelope_volume	261500 Å³
Hydration-shell volume shell_volume	57094 Å³
Envelope diameter envelope_diameter	133.4 Å
Shell Rg shell_rg	44.19 Å
Envelope Rg envelope_rg	38.26 Å
Shape Rg shape_rg	39.01 Å
Total Rg total_rg	39.28 Å
Total atoms total_atoms	10358
Residues n_residues	1318
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	129.2 Å
Rg (real space) rg_real	39.45 Å
Rg uncertainty (real space) rg_real_error	0.92 Å
I(0) (real space) i0_real	3.1950e+08
I(0) uncertainty (real space) i0_real_error	5.1620e+06
Rg (reciprocal space) rg_reciprocal	39.46 Å
I(0) (reciprocal space) i0_reciprocal	319500000.0000
Solution quality estimate total_estimate	0.8891
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	45.2 Å
Skewness Skewness skewness	0.312
Kurtosis Kurtosis kurtosis	-0.424
Angular range angular_range	— – 0.2000 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	23620000.0000
Real-space data points n_real_points	41
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.892; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 1.000; Smooth: 0.879

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
Molecular weight formula_weight	64544.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	10358

LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Small T antigen
Molecular weight formula_weight	10464.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

SLNPGVDAMYCKQWPECAKKMSANCICLLCLLRMKHENRKLYRKDPLVWVDCYCFDCFRMWFGLDLCEGTLLLWCDIIGQTTYRDLKL

来源 Source

来源生物 organism	Simian virus 40
NCBI Class编号 ncbi_taxonomy_id	10633
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	4

▼

7. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d2pkga1
Class class	a — All alpha proteins
Fold Fold fold	a.118 — alpha-alpha superhelix
Superfamily Superfamily superfamily	a.118.1 — ARM repeat
Family Family family	a.118.1.2 — HEAT repeat

Domain ID domain_id	d2pkgb1
Class class	a — All alpha proteins
Fold Fold fold	a.118 — alpha-alpha superhelix
Superfamily Superfamily superfamily	a.118.1 — ARM repeat
Family Family family	a.118.1.2 — HEAT repeat

Domain ID domain_id	d2pkgc1
Class class	g — Small proteins
Fold Fold fold	g.92 — T-antigen specific domain-like
Superfamily Superfamily superfamily	g.92.1 — T-antigen specific domain-like
Family Family family	g.92.1.1 — T-antigen specific domain-like

Domain ID domain_id	d2pkgd1
Class class	g — Small proteins
Fold Fold fold	g.92 — T-antigen specific domain-like
Superfamily Superfamily superfamily	g.92.1 — T-antigen specific domain-like
Family Family family	g.92.1.1 — T-antigen specific domain-like

CATH v4.4 (2 domains)

Domain ID domain_id	2pkgA00
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	10 — Leucine-rich Repeat Variant
Homologous superfamily homologous superfamily	10 — Leucine-rich Repeat Variant

Domain ID domain_id	2pkgB00
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	10 — Leucine-rich Repeat Variant
Homologous superfamily homologous superfamily	10 — Leucine-rich Repeat Variant

▶

8. Citations (1)

▶

Unit-cell length a length_a	137.700 Å
Unit-cell length b length_b	147.790 Å
Unit-cell length c length_c	209.650 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	—

Resolution resolution	3.300 Å
Low-resolution limit resolution_low	60.400 Å
R factor r_factor	0.2470
R_work r_work	0.2470
R_free r_free	0.3120

fit	/app/data/saxs_computation/pk/2pkg/2pkg.fit
pddf	/app/data/pr_computation/pk/2pkg/2pkg.pr.out
profile	/app/data/saxs_computation/pk/2pkg/2pkg.dat

Structure of a complex between the A subunit of protein phosphatase 2A and the small t antigen of SV40

1. Protein Identity and Related Structures Protein Identity & Related Structures

Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform

State in the Current Structure

Other States of the Same Protein in the Database

Small T antigen

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

7. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

CATH v4.4 (2 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)