2r1g

Coordinates of the thermus thermophilus 30S components neighboring RbfA as obtained by fitting into the CRYO-EM map of A 30S-RBFA complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

30S ribosomal protein S9

Thermus thermophilus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 3 RNA 7	16S RIBOSOMAL RNA HELIX 1 × 1 16S RIBOSOMAL RNA HELIX 18 × 1 16S RIBOSOMAL RNA HELIX 27 × 1 16S RIBOSOMAL RNA HELIX 28 × 1 16S RIBOSOMAL RNA HELIX 44 × 1 16S RIBOSOMAL RNA HELIX 44 × 1 16S RIBOSOMAL RNA HELIX 45 × 1 30S ribosomal protein S12 × 1 （P17293） 30S ribosomal protein S13 × 1 （P62655）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS9_THET2
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain G； PDBConstruct 1–127； UniProt 2–128

30S ribosomal protein S12

Thermus thermophilus

UniProt P17293

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 3 RNA 7	16S RIBOSOMAL RNA HELIX 1 × 1 16S RIBOSOMAL RNA HELIX 18 × 1 16S RIBOSOMAL RNA HELIX 27 × 1 16S RIBOSOMAL RNA HELIX 28 × 1 16S RIBOSOMAL RNA HELIX 44 × 1 16S RIBOSOMAL RNA HELIX 44 × 1 16S RIBOSOMAL RNA HELIX 45 × 1 30S ribosomal protein S9 × 1 （P62669） 30S ribosomal protein S13 × 1 （P62655）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS12_THETH
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain H； PDBConstruct 1–124； UniProt 2–125

30S ribosomal protein S13

Thermus thermophilus

UniProt P62655

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 3 RNA 7	16S RIBOSOMAL RNA HELIX 1 × 1 16S RIBOSOMAL RNA HELIX 18 × 1 16S RIBOSOMAL RNA HELIX 27 × 1 16S RIBOSOMAL RNA HELIX 28 × 1 16S RIBOSOMAL RNA HELIX 44 × 1 16S RIBOSOMAL RNA HELIX 44 × 1 16S RIBOSOMAL RNA HELIX 45 × 1 30S ribosomal protein S9 × 1 （P62669） 30S ribosomal protein S12 × 1 （P17293）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS13_THET2
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain I； PDBConstruct 1–125； UniProt 2–126

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2r1g
Deposition date deposition_date	2007-08-22
Structure title title	Coordinates of the thermus thermophilus 30S components neighboring RbfA as obtained by fitting into the CRYO-EM map of A 30S-RBFA complex
Keywords keywords	;30S RIBOSOME MATURATION PROTEIN RbfA, COLD SHOCK RESPONSE PROTEIN RbfA, 30S-RbfA COMPLEX, RbfA BINDING SITE ON THE 30S, Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding, tRNA-binding, Antibiotic resistance, RIBOSOMAL PROTEIN-RNA COMPLEX ;; RIBOSOMAL PROTEIN/RNA
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2r1g__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2r1g__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2r1g__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	53.21 Å
Rg (electron density)	55.86 Å
Total Rg	55.70 Å
Atom count	180
Residues	180
Excluded volume	53201 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2r1g__assembly_1__model_1`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (10)

Entity 1 Entity 1 polymer

Description description	16S RIBOSOMAL RNA HELIX 1
Molecular weight formula_weight	7781.6 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	A
Atom count atom_count	556

GGAGAGUUUGAUCCUGGCUCAGGG

Entity 2 Entity 2 polymer

Description description	16S RIBOSOMAL RNA HELIX 18
Molecular weight formula_weight	15544.4 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	B

GCGCCGGCCAACUCCGUGCCAGCAGCCGCGGUAAUACGGAGGGCGCGA

Entity 3 Entity 3 polymer

Description description	16S RIBOSOMAL RNA HELIX 27
Molecular weight formula_weight	9440.7 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	C

GGGGAGUACGGCCGCAAGGCUGAAACUCA

Entity 4 Entity 4 polymer

Description description	16S RIBOSOMAL RNA HELIX 28
Molecular weight formula_weight	8969.4 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	D

AAUUGACGGGGGCCGCCUUGUACACACC

Entity 5 Entity 5 polymer

Description description	16S RIBOSOMAL RNA HELIX 44
Molecular weight formula_weight	3457.1 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	E

CGCCCGUCACG

Entity 6 Entity 6 polymer

Description description	16S RIBOSOMAL RNA HELIX 44
Molecular weight formula_weight	3530.2 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	X

CGAAGUCGUAA

Entity 7 Entity 7 polymer

Description description	16S RIBOSOMAL RNA HELIX 45
Molecular weight formula_weight	9434.7 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	F

CAAGGUAGCUGUACCGGAAGGUGCGGCUG

Entity 8 Entity 8 polymer

Description description	30S ribosomal protein S9
Molecular weight formula_weight	14298.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR

Source Source

Source organism organism	Thermus thermophilus
NCBI taxonomy ID ncbi_taxonomy_id	262724
Host organism host_organism	Escherichia coli

Entity 9 Entity 9 polymer

Description description	30S ribosomal protein S12
Molecular weight formula_weight	13804.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA

Source Source

Source organism organism	Thermus thermophilus
NCBI taxonomy ID ncbi_taxonomy_id	262724
Host organism host_organism	Escherichia coli

Entity 10 Entity 10 polymer

Description description	30S ribosomal protein S13
Molecular weight formula_weight	14207.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK

Source Source

Source organism organism	Thermus thermophilus
NCBI taxonomy ID ncbi_taxonomy_id	262724
Host organism host_organism	Escherichia coli

▼

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d2r1gg1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.14 — Ribosomal protein S5 domain 2-like
Superfamily Superfamily superfamily	d.14.1 — Ribosomal protein S5 domain 2-like
Family Family family	d.14.1.1 — Translational machinery components

Domain ID domain_id	d2r1gh1
Class class	i — Low resolution protein structures
Fold Fold fold	i.1 — Ribosome and ribosomal fragments
Superfamily Superfamily superfamily	i.1.1 — Ribosome and ribosomal fragments
Family Family family	i.1.1.1 — Ribosome complexes

Domain ID domain_id	d2r1gi1
Class class	a — All alpha proteins
Fold Fold fold	a.156 — S13-like H2TH domain
Superfamily Superfamily superfamily	a.156.1 — S13-like H2TH domain
Family Family family	a.156.1.1 — Ribosomal protein S13

▶

Resolution resolution	12.50 Å
Resolution测定Method resolution_method	CRYO-ELECTRON MICROSCOPY AND 3D IMAGE PROCESSING
颗粒数 num_particles	61207

Coordinates of the thermus thermophilus 30S components neighboring RbfA as obtained by fitting into the CRYO-EM map of A 30S-RBFA complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

30S ribosomal protein S9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S13

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2r1g__assembly_1__model_1

2r1g__assembly_1__model_1 | I(q)

2r1g__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (10)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

Source Source

Entity 9 Entity 9 polymer

Polymer Polymer

Source Source

Entity 10 Entity 10 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (3 domains)

7. Citations (2)