3lk4

Crystal structure of CapZ bound to the uncapping motif from CD2AP

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

F-actin-capping protein subunit alpha-1

Gallus gallus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit beta isoforms 1 and 2 × 1 （P14315） CD2-associated protein × 1 （Q9Y5K6） water × 3	Consistent with protein count
10	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit beta isoforms 1 and 2 × 1 （P14315） CD2-associated protein × 1 （Q9Y5K6） water × 3	Consistent with protein count
11	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit beta isoforms 1 and 2 × 1 （P14315） CD2-associated protein × 1 （Q9Y5K6） water × 3	Consistent with protein count
12	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit beta isoforms 1 and 2 × 1 （P14315） CD2-associated protein × 1 （Q9Y5K6） water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit beta isoforms 1 and 2 × 1 （P14315） CD2-associated protein × 1 （Q9Y5K6） water × 3	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit beta isoforms 1 and 2 × 1 （P14315） CD2-associated protein × 1 （Q9Y5K6） water × 3	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit beta isoforms 1 and 2 × 1 （P14315） CD2-associated protein × 1 （Q9Y5K6） water × 3	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit beta isoforms 1 and 2 × 1 （P14315） CD2-associated protein × 1 （Q9Y5K6） water × 3	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit beta isoforms 1 and 2 × 1 （P14315） CD2-associated protein × 1 （Q9Y5K6） water × 3	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit beta isoforms 1 and 2 × 1 （P14315） CD2-associated protein × 1 （Q9Y5K6） water × 3	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit beta isoforms 1 and 2 × 1 （P14315） CD2-associated protein × 1 （Q9Y5K6） water × 3	Consistent with protein count
9	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit beta isoforms 1 and 2 × 1 （P14315） CD2-associated protein × 1 （Q9Y5K6） water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAZA1_CHICK
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 1； PDBConstruct 1–286； UniProt 1–286 Author chain 4； PDBConstruct 1–286； UniProt 1–286 Author chain 7； PDBConstruct 1–286； UniProt 1–286 Author chain A； PDBConstruct 1–286； UniProt 1–286 Author chain D； PDBConstruct 1–286； UniProt 1–286 Author chain G； PDBConstruct 1–286； UniProt 1–286 Author chain J； PDBConstruct 1–286； UniProt 1–286 Author chain M； PDBConstruct 1–286； UniProt 1–286 Author chain P； PDBConstruct 1–286； UniProt 1–286 Author chain S； PDBConstruct 1–286； UniProt 1–286 Author chain V； PDBConstruct 1–286； UniProt 1–286 Author chain Y； PDBConstruct 1–286； UniProt 1–286

F-actin-capping protein subunit beta isoforms 1 and 2

Gallus gallus

UniProt P14315

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit alpha-1 × 1 （P13127） CD2-associated protein × 1 （Q9Y5K6） water × 3	Consistent with protein count
10	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit alpha-1 × 1 （P13127） CD2-associated protein × 1 （Q9Y5K6） water × 3	Consistent with protein count
11	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit alpha-1 × 1 （P13127） CD2-associated protein × 1 （Q9Y5K6） water × 3	Consistent with protein count
12	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit alpha-1 × 1 （P13127） CD2-associated protein × 1 （Q9Y5K6） water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit alpha-1 × 1 （P13127） CD2-associated protein × 1 （Q9Y5K6） water × 3	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit alpha-1 × 1 （P13127） CD2-associated protein × 1 （Q9Y5K6） water × 3	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit alpha-1 × 1 （P13127） CD2-associated protein × 1 （Q9Y5K6） water × 3	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit alpha-1 × 1 （P13127） CD2-associated protein × 1 （Q9Y5K6） water × 3	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit alpha-1 × 1 （P13127） CD2-associated protein × 1 （Q9Y5K6） water × 3	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit alpha-1 × 1 （P13127） CD2-associated protein × 1 （Q9Y5K6） water × 3	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit alpha-1 × 1 （P13127） CD2-associated protein × 1 （Q9Y5K6） water × 3	Consistent with protein count
9	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit alpha-1 × 1 （P13127） CD2-associated protein × 1 （Q9Y5K6） water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAPZB_CHICK
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 2； PDBConstruct 1–277； UniProt 1–277 Author chain 5； PDBConstruct 1–277； UniProt 1–277 Author chain 8； PDBConstruct 1–277； UniProt 1–277 Author chain B； PDBConstruct 1–277； UniProt 1–277 Author chain E； PDBConstruct 1–277； UniProt 1–277 Author chain H； PDBConstruct 1–277； UniProt 1–277 Author chain K； PDBConstruct 1–277； UniProt 1–277 Author chain N； PDBConstruct 1–277； UniProt 1–277 Author chain Q； PDBConstruct 1–277； UniProt 1–277 Author chain T； PDBConstruct 1–277； UniProt 1–277 Author chain W； PDBConstruct 1–277； UniProt 1–277 Author chain Z； PDBConstruct 1–277； UniProt 1–277

CD2-associated protein

OrganismNot specified

UniProt Q9Y5K6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit alpha-1 × 1 （P13127） F-actin-capping protein subunit beta isoforms 1 and 2 × 1 （P14315） water × 3	Consistent with protein count
10	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit alpha-1 × 1 （P13127） F-actin-capping protein subunit beta isoforms 1 and 2 × 1 （P14315） water × 3	Consistent with protein count
11	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit alpha-1 × 1 （P13127） F-actin-capping protein subunit beta isoforms 1 and 2 × 1 （P14315） water × 3	Consistent with protein count
12	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit alpha-1 × 1 （P13127） F-actin-capping protein subunit beta isoforms 1 and 2 × 1 （P14315） water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit alpha-1 × 1 （P13127） F-actin-capping protein subunit beta isoforms 1 and 2 × 1 （P14315） water × 3	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit alpha-1 × 1 （P13127） F-actin-capping protein subunit beta isoforms 1 and 2 × 1 （P14315） water × 3	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit alpha-1 × 1 （P13127） F-actin-capping protein subunit beta isoforms 1 and 2 × 1 （P14315） water × 3	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit alpha-1 × 1 （P13127） F-actin-capping protein subunit beta isoforms 1 and 2 × 1 （P14315） water × 3	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit alpha-1 × 1 （P13127） F-actin-capping protein subunit beta isoforms 1 and 2 × 1 （P14315） water × 3	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit alpha-1 × 1 （P13127） F-actin-capping protein subunit beta isoforms 1 and 2 × 1 （P14315） water × 3	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit alpha-1 × 1 （P13127） F-actin-capping protein subunit beta isoforms 1 and 2 × 1 （P14315） water × 3	Consistent with protein count
9	Protein heterocomplex	Heteromer	Protein 3	F-actin-capping protein subunit alpha-1 × 1 （P13127） F-actin-capping protein subunit beta isoforms 1 and 2 × 1 （P14315） water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CD2AP_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 0； PDBConstruct 1–29； UniProt 475–503 Author chain 3； PDBConstruct 1–29； UniProt 475–503 Author chain 6； PDBConstruct 1–29； UniProt 475–503 Author chain 9； PDBConstruct 1–29； UniProt 475–503 Author chain C； PDBConstruct 1–29； UniProt 475–503 Author chain F； PDBConstruct 1–29； UniProt 475–503 Author chain I； PDBConstruct 1–29； UniProt 475–503 Author chain L； PDBConstruct 1–29； UniProt 475–503 Author chain O； PDBConstruct 1–29； UniProt 475–503 Author chain R； PDBConstruct 1–29； UniProt 475–503 Author chain U； PDBConstruct 1–29； UniProt 475–503 Author chain X； PDBConstruct 1–29； UniProt 475–503

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3lk4
Deposition date deposition_date	2010-01-27
Structure title title	Crystal structure of CapZ bound to the uncapping motif from CD2AP
Keywords keywords	;CapZ, CD2AP, actin filaments, uncapping, actin-filament regulators, protein-protein comple, Actin capping, Actin-binding, Cytoplasm, Cytoskeleton, PROTEIN BINDING ;; PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3lk4__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3lk4__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3lk4__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	27.64 Å
Rg (electron density)	26.91 Å
Total Rg	27.61 Å
Atom count	4288
Residues	536
Excluded volume	75666 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3lk4__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3lk4__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`3lk4__assembly_3__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`3lk4__assembly_4__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`3lk4__assembly_5__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`3lk4__assembly_6__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
7	1	`3lk4__assembly_7__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
8	1	`3lk4__assembly_8__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
9	1	`3lk4__assembly_9__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
10	1	`3lk4__assembly_10__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
11	1	`3lk4__assembly_11__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
12	1	`3lk4__assembly_12__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	F-actin-capping protein subunit alpha-1
Molecular weight formula_weight	33001.8 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D,G,J,M,P,S,V,Y,1,4,7
Atom count atom_count	54370

MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGYDDQVLITEHGDLGNGRFLDPRNKISFKFDHLRKEASDPQPEDTESALKQWRDACDSALRAYVKDHYPNGFCTVYGKSIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVAAVLKIQVHYYEDGNVQLVSHKDIQDSVQVSSDVQTAKEFIKIIENAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA

Source Source

Source organism organism	Gallus gallus
Common name common_name	bantam,chickens
NCBI taxonomy ID ncbi_taxonomy_id	9031
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	F-actin-capping protein subunit beta isoforms 1 and 2
Molecular weight formula_weight	31403.4 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,E,H,K,N,Q,T,W,Z,2,5,8

MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKYKQLQRELSQVLTQRQIYIQPDN

Source Source

Source organism organism	Gallus gallus
Common name common_name	chickens
NCBI taxonomy ID ncbi_taxonomy_id	9031
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	CD2-associated protein
Molecular weight formula_weight	3224.7 kDa
Source method src_method	syn
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,F,I,L,O,R,U,X,0,3,6,9

VNFDDIASSENLLHLTANRPKMPGRRLPG

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	2900

▼

6. Fold Classification (SCOP + CATH) 48 domains

CATH v4.4 (48 domains)

Domain ID domain_id	3lk4101
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1140 — Ribosomal protein S3 C-terminal domain
Homologous superfamily homologous superfamily	60 — F-actin capping protein, alpha subunit

Domain ID domain_id	3lk4102
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

Domain ID domain_id	3lk4201
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	570 — F-actin capping protein, alpha/beta subunit, N-terminal domain

Domain ID domain_id	3lk4202
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

Domain ID domain_id	3lk4401
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1140 — Ribosomal protein S3 C-terminal domain
Homologous superfamily homologous superfamily	60 — F-actin capping protein, alpha subunit

Domain ID domain_id	3lk4402
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

Domain ID domain_id	3lk4501
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	570 — F-actin capping protein, alpha/beta subunit, N-terminal domain

Domain ID domain_id	3lk4502
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

Domain ID domain_id	3lk4701
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1140 — Ribosomal protein S3 C-terminal domain
Homologous superfamily homologous superfamily	60 — F-actin capping protein, alpha subunit

Domain ID domain_id	3lk4702
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

Domain ID domain_id	3lk4801
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	570 — F-actin capping protein, alpha/beta subunit, N-terminal domain

Domain ID domain_id	3lk4802
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

Domain ID domain_id	3lk4A01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1140 — Ribosomal protein S3 C-terminal domain
Homologous superfamily homologous superfamily	60 — F-actin capping protein, alpha subunit

Domain ID domain_id	3lk4A02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

Domain ID domain_id	3lk4B01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	570 — F-actin capping protein, alpha/beta subunit, N-terminal domain

Domain ID domain_id	3lk4B02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

Domain ID domain_id	3lk4D01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1140 — Ribosomal protein S3 C-terminal domain
Homologous superfamily homologous superfamily	60 — F-actin capping protein, alpha subunit

Domain ID domain_id	3lk4D02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

Domain ID domain_id	3lk4E01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	570 — F-actin capping protein, alpha/beta subunit, N-terminal domain

Domain ID domain_id	3lk4E02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

Domain ID domain_id	3lk4G01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1140 — Ribosomal protein S3 C-terminal domain
Homologous superfamily homologous superfamily	60 — F-actin capping protein, alpha subunit

Domain ID domain_id	3lk4G02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

Domain ID domain_id	3lk4H01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	570 — F-actin capping protein, alpha/beta subunit, N-terminal domain

Domain ID domain_id	3lk4H02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

Domain ID domain_id	3lk4J01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1140 — Ribosomal protein S3 C-terminal domain
Homologous superfamily homologous superfamily	60 — F-actin capping protein, alpha subunit

Domain ID domain_id	3lk4J02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

Domain ID domain_id	3lk4K01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	570 — F-actin capping protein, alpha/beta subunit, N-terminal domain

Domain ID domain_id	3lk4K02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

Domain ID domain_id	3lk4M01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1140 — Ribosomal protein S3 C-terminal domain
Homologous superfamily homologous superfamily	60 — F-actin capping protein, alpha subunit

Domain ID domain_id	3lk4M02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

Domain ID domain_id	3lk4N01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	570 — F-actin capping protein, alpha/beta subunit, N-terminal domain

Domain ID domain_id	3lk4N02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

Domain ID domain_id	3lk4P01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1140 — Ribosomal protein S3 C-terminal domain
Homologous superfamily homologous superfamily	60 — F-actin capping protein, alpha subunit

Domain ID domain_id	3lk4P02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

Domain ID domain_id	3lk4Q01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	570 — F-actin capping protein, alpha/beta subunit, N-terminal domain

Domain ID domain_id	3lk4Q02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

Domain ID domain_id	3lk4S01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1140 — Ribosomal protein S3 C-terminal domain
Homologous superfamily homologous superfamily	60 — F-actin capping protein, alpha subunit

Domain ID domain_id	3lk4S02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

Domain ID domain_id	3lk4T01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	570 — F-actin capping protein, alpha/beta subunit, N-terminal domain

Domain ID domain_id	3lk4T02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

Domain ID domain_id	3lk4V01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1140 — Ribosomal protein S3 C-terminal domain
Homologous superfamily homologous superfamily	60 — F-actin capping protein, alpha subunit

Domain ID domain_id	3lk4V02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

Domain ID domain_id	3lk4W01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	570 — F-actin capping protein, alpha/beta subunit, N-terminal domain

Domain ID domain_id	3lk4W02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

Domain ID domain_id	3lk4Y01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1140 — Ribosomal protein S3 C-terminal domain
Homologous superfamily homologous superfamily	60 — F-actin capping protein, alpha subunit

Domain ID domain_id	3lk4Y02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

Domain ID domain_id	3lk4Z01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	570 — F-actin capping protein, alpha/beta subunit, N-terminal domain

Domain ID domain_id	3lk4Z02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1150 — Aspartate Aminotransferase, domain 1
Homologous superfamily homologous superfamily	210 — F-actin capping protein, beta subunit

▶

Unit-cell length a length_a	59.728 Å
Unit-cell length b length_b	142.341 Å
Unit-cell length c length_c	192.999 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	89.99 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	1.990 Å
Low-resolution limit resolution_low	19.984 Å
R factor r_factor	0.2277
R_work r_work	0.2253
R_free r_free	0.2722

Crystal structure of CapZ bound to the uncapping motif from CD2AP

1. Protein Identity and Related Structures Protein Identity & Related Structures

F-actin-capping protein subunit alpha-1

State in the Current Structure

Other States of the Same Protein in the Database

F-actin-capping protein subunit beta isoforms 1 and 2

State in the Current Structure

Other States of the Same Protein in the Database

CD2-associated protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3lk4__assembly_1__model_1

3lk4__assembly_1__model_1 | I(q)

3lk4__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 48 domains

CATH v4.4 (48 domains)

7. Citations (1)

Crystal structure of CapZ bound to the uncapping motif from CD2AP

1. Protein Identity and Related Structures Protein Identity & Related Structures

F-actin-capping protein subunit alpha-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

F-actin-capping protein subunit beta isoforms 1 and 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CD2-associated protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3lk4__assembly_1__model_1

3lk4__assembly_1__model_1 | I(q)

3lk4__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 48 domains

CATH v4.4 (48 domains)

7. Citations (1)