SAXSdb — 3mud

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA repair protein XRCC4,Tropomyosin alpha-1 chain

Gallus gallus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 4	Tropomyosin alpha-1 chain,Microtubule-associated protein RP/EB family member 1 × 2 （P09493,Q15691） 1,2-ETHANEDIOL × 1 SULFATE ION × 1 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TPM1_CHICK
Isoform	P04268-2
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 141–175； UniProt 250–284 Author chain B； PDBConstruct 141–175； UniProt 250–284

DNA repair protein XRCC4,Tropomyosin alpha-1 chain

Gallus gallus

UniProt Q13426

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 4	Tropomyosin alpha-1 chain,Microtubule-associated protein RP/EB family member 1 × 2 （P09493,Q15691） 1,2-ETHANEDIOL × 1 SULFATE ION × 1 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	XRCC4_HUMAN
Isoform	Q13426-2
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–140； UniProt 2–137 Author chain B； PDBConstruct 5–140； UniProt 2–137

Tropomyosin alpha-1 chain,Microtubule-associated protein RP/EB family member 1

Homo sapiens

UniProt P09493

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 4	DNA repair protein XRCC4,Tropomyosin alpha-1 chain × 2 （P04268,Q13426） 1,2-ETHANEDIOL × 1 SULFATE ION × 1 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TPM1_HUMAN
Isoform	P09493-3
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 4–32； UniProt 1–29 Author chain D； PDBConstruct 4–32； UniProt 1–29

Tropomyosin alpha-1 chain,Microtubule-associated protein RP/EB family member 1

Homo sapiens

UniProt Q15691

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 4	DNA repair protein XRCC4,Tropomyosin alpha-1 chain × 2 （P04268,Q13426） 1,2-ETHANEDIOL × 1 SULFATE ION × 1 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MARE1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 33–75； UniProt 215–257 Author chain D； PDBConstruct 33–75； UniProt 215–257

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3mud
Deposition date deposition_date	2010-05-02
Structure title title	Structure of the Tropomyosin Overlap Complex from Chicken Smooth Muscle
Keywords keywords	tropomysoin, overlap complex, coiled-coils, Contractile Protein; CONTRACTILE PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3mud__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3mud__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3mud__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	38.25 Å
Rg (electron density)	39.22 Å
Total Rg	38.83 Å
Atom count	3430
Residues	434
Excluded volume	60793 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3mud__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	DNA repair protein XRCC4,Tropomyosin alpha-1 chain
Molecular weight formula_weight	19743.2 kDa
Mutation mutation	I134T, L249N,I134T
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	3833

GGSGERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEADDMAMEKGKYVGELRKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPAEVIRELICYCLDTTAKNEKSIDDLEEKVAHAKEENLNMHQMLDQTLLELNNM

Source Source

Source organism organism	Gallus gallus
Common name common_name	Chicken
NCBI taxonomy ID ncbi_taxonomy_id	9031
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Tropomyosin alpha-1 chain,Microtubule-associated protein RP/EB family member 1
Molecular weight formula_weight	8572.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

GASMDAIKKKMQMLKLDKENALDRAEQAEADKDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPD

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	398

▼

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	3mudA01
Class class	2 — Mainly Beta
Architecture architecture	170 — Beta Complex
Topology topology	210 — Dna Repair Protein Xrcc4; Chain: A, domain 1
Homologous superfamily homologous superfamily	10 — DNA double-strand break repair and VJ recombination XRCC4, N-terminal

Domain ID domain_id	3mudA02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	370 —

Domain ID domain_id	3mudB01
Class class	2 — Mainly Beta
Architecture architecture	170 — Beta Complex
Topology topology	210 — Dna Repair Protein Xrcc4; Chain: A, domain 1
Homologous superfamily homologous superfamily	10 — DNA double-strand break repair and VJ recombination XRCC4, N-terminal

Domain ID domain_id	3mudB02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	370 —

Domain ID domain_id	3mudC00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	1160 — Vasodilator-stimulated phosphoprotein

Domain ID domain_id	3mudD00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	1160 — Vasodilator-stimulated phosphoprotein

▶

Unit-cell length a length_a	96.564 Å
Unit-cell length b length_b	96.564 Å
Unit-cell length c length_c	162.993 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 41 21 2
Space-group number int_tables_number	92
Crystal system crystal_system	—

Resolution resolution	2.200 Å
Low-resolution limit resolution_low	30.000 Å
R factor r_factor	0.2091
R_work r_work	0.2070
R_free r_free	0.2505

Structure of the Tropomyosin Overlap Complex from Chicken Smooth Muscle

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA repair protein XRCC4,Tropomyosin alpha-1 chain

State in the Current Structure

Other States of the Same Protein in the Database

DNA repair protein XRCC4,Tropomyosin alpha-1 chain

State in the Current Structure

Other States of the Same Protein in the Database

Tropomyosin alpha-1 chain,Microtubule-associated protein RP/EB family member 1

State in the Current Structure

Other States of the Same Protein in the Database

Tropomyosin alpha-1 chain,Microtubule-associated protein RP/EB family member 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3mud__assembly_1__model_1

3mud__assembly_1__model_1 | I(q)

3mud__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)

Structure of the Tropomyosin Overlap Complex from Chicken Smooth Muscle

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA repair protein XRCC4,Tropomyosin alpha-1 chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA repair protein XRCC4,Tropomyosin alpha-1 chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tropomyosin alpha-1 chain,Microtubule-associated protein RP/EB family member 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tropomyosin alpha-1 chain,Microtubule-associated protein RP/EB family member 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3mud__assembly_1__model_1

3mud__assembly_1__model_1 | I(q)

3mud__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)