4ce4

39S large subunit of the porcine mitochondrial ribosome

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

MRPL27

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 2	MRPL28 × 1 （F1RGV8） MRPL47 × 1 MRPL30 × 1 （F1STE5） MRPL32 × 1 （I3LTC4） MRPL33 × 1 MRPL34 × 1 MRPL35 × 1 （F1SVC5） MRPL36 × 1 （I3LDE8） 16S Ribosomal RNA × 1 UNASSIGNED RNA × 1 MRPL2 × 1 （F1RRN2） MRPL3 × 1 （F1RX24） MRPL4 × 1 （F1S3J8） MRPL9 × 1 （I3LR45） MRPL13 × 1 （F1S286） MRPL14 × 1 （F1RQV7） MRPL15 × 1 （F1RSH0） MRPL16 × 1 （F1RI89） MRPL17 × 1 （F1RMQ4） MRPL18 × 1 （F1SB64） MRPL19 × 1 （I3LNJ0） MRPL20 × 1 （F1RJD0） MRPL21 × 1 （F1RY70） MRPL22 × 1 MRPL23 × 1 MRPL24 × 1 （F1RHJ1） MRPL38 × 1 （F1RW03） MRPL39 × 1 （F1SHP6） MRPL44 × 1 （F1SR64） MRPL45 × 1 MRPL49 × 1 MRPL52 × 1 ICT1 × 1 UNASSIGNED HELICES × 2 THIOREDOXIN FOLD × 1 UNASSIGNED HELICES × 1 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RT79_PIG
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 0； PDBConstruct 1–148； UniProt 1–148

MRPL28

OrganismNot specified

UniProt F1RGV8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 2	MRPL27 × 1 （F1RT79） MRPL47 × 1 MRPL30 × 1 （F1STE5） MRPL32 × 1 （I3LTC4） MRPL33 × 1 MRPL34 × 1 MRPL35 × 1 （F1SVC5） MRPL36 × 1 （I3LDE8） 16S Ribosomal RNA × 1 UNASSIGNED RNA × 1 MRPL2 × 1 （F1RRN2） MRPL3 × 1 （F1RX24） MRPL4 × 1 （F1S3J8） MRPL9 × 1 （I3LR45） MRPL13 × 1 （F1S286） MRPL14 × 1 （F1RQV7） MRPL15 × 1 （F1RSH0） MRPL16 × 1 （F1RI89） MRPL17 × 1 （F1RMQ4） MRPL18 × 1 （F1SB64） MRPL19 × 1 （I3LNJ0） MRPL20 × 1 （F1RJD0） MRPL21 × 1 （F1RY70） MRPL22 × 1 MRPL23 × 1 MRPL24 × 1 （F1RHJ1） MRPL38 × 1 （F1RW03） MRPL39 × 1 （F1SHP6） MRPL44 × 1 （F1SR64） MRPL45 × 1 MRPL49 × 1 MRPL52 × 1 ICT1 × 1 UNASSIGNED HELICES × 2 THIOREDOXIN FOLD × 1 UNASSIGNED HELICES × 1 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RGV8_PIG
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 1； PDBConstruct 1–256； UniProt 1–256

MRPL30

OrganismNot specified

UniProt F1STE5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 2	MRPL27 × 1 （F1RT79） MRPL28 × 1 （F1RGV8） MRPL47 × 1 MRPL32 × 1 （I3LTC4） MRPL33 × 1 MRPL34 × 1 MRPL35 × 1 （F1SVC5） MRPL36 × 1 （I3LDE8） 16S Ribosomal RNA × 1 UNASSIGNED RNA × 1 MRPL2 × 1 （F1RRN2） MRPL3 × 1 （F1RX24） MRPL4 × 1 （F1S3J8） MRPL9 × 1 （I3LR45） MRPL13 × 1 （F1S286） MRPL14 × 1 （F1RQV7） MRPL15 × 1 （F1RSH0） MRPL16 × 1 （F1RI89） MRPL17 × 1 （F1RMQ4） MRPL18 × 1 （F1SB64） MRPL19 × 1 （I3LNJ0） MRPL20 × 1 （F1RJD0） MRPL21 × 1 （F1RY70） MRPL22 × 1 MRPL23 × 1 MRPL24 × 1 （F1RHJ1） MRPL38 × 1 （F1RW03） MRPL39 × 1 （F1SHP6） MRPL44 × 1 （F1SR64） MRPL45 × 1 MRPL49 × 1 MRPL52 × 1 ICT1 × 1 UNASSIGNED HELICES × 2 THIOREDOXIN FOLD × 1 UNASSIGNED HELICES × 1 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1STE5_PIG
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 3； PDBConstruct 1–161； UniProt 1–161

MRPL32

OrganismNot specified

UniProt I3LTC4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 2	MRPL27 × 1 （F1RT79） MRPL28 × 1 （F1RGV8） MRPL47 × 1 MRPL30 × 1 （F1STE5） MRPL33 × 1 MRPL34 × 1 MRPL35 × 1 （F1SVC5） MRPL36 × 1 （I3LDE8） 16S Ribosomal RNA × 1 UNASSIGNED RNA × 1 MRPL2 × 1 （F1RRN2） MRPL3 × 1 （F1RX24） MRPL4 × 1 （F1S3J8） MRPL9 × 1 （I3LR45） MRPL13 × 1 （F1S286） MRPL14 × 1 （F1RQV7） MRPL15 × 1 （F1RSH0） MRPL16 × 1 （F1RI89） MRPL17 × 1 （F1RMQ4） MRPL18 × 1 （F1SB64） MRPL19 × 1 （I3LNJ0） MRPL20 × 1 （F1RJD0） MRPL21 × 1 （F1RY70） MRPL22 × 1 MRPL23 × 1 MRPL24 × 1 （F1RHJ1） MRPL38 × 1 （F1RW03） MRPL39 × 1 （F1SHP6） MRPL44 × 1 （F1SR64） MRPL45 × 1 MRPL49 × 1 MRPL52 × 1 ICT1 × 1 UNASSIGNED HELICES × 2 THIOREDOXIN FOLD × 1 UNASSIGNED HELICES × 1 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LTC4_PIG
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 5； PDBConstruct 1–126； UniProt 1–126

MRPL35

OrganismNot specified

UniProt F1SVC5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 2	MRPL27 × 1 （F1RT79） MRPL28 × 1 （F1RGV8） MRPL47 × 1 MRPL30 × 1 （F1STE5） MRPL32 × 1 （I3LTC4） MRPL33 × 1 MRPL34 × 1 MRPL36 × 1 （I3LDE8） 16S Ribosomal RNA × 1 UNASSIGNED RNA × 1 MRPL2 × 1 （F1RRN2） MRPL3 × 1 （F1RX24） MRPL4 × 1 （F1S3J8） MRPL9 × 1 （I3LR45） MRPL13 × 1 （F1S286） MRPL14 × 1 （F1RQV7） MRPL15 × 1 （F1RSH0） MRPL16 × 1 （F1RI89） MRPL17 × 1 （F1RMQ4） MRPL18 × 1 （F1SB64） MRPL19 × 1 （I3LNJ0） MRPL20 × 1 （F1RJD0） MRPL21 × 1 （F1RY70） MRPL22 × 1 MRPL23 × 1 MRPL24 × 1 （F1RHJ1） MRPL38 × 1 （F1RW03） MRPL39 × 1 （F1SHP6） MRPL44 × 1 （F1SR64） MRPL45 × 1 MRPL49 × 1 MRPL52 × 1 ICT1 × 1 UNASSIGNED HELICES × 2 THIOREDOXIN FOLD × 1 UNASSIGNED HELICES × 1 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SVC5_PIG
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain 8； PDBConstruct 1–188； UniProt 1–188

MRPL36

OrganismNot specified

UniProt I3LDE8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 2	MRPL27 × 1 （F1RT79） MRPL28 × 1 （F1RGV8） MRPL47 × 1 MRPL30 × 1 （F1STE5） MRPL32 × 1 （I3LTC4） MRPL33 × 1 MRPL34 × 1 MRPL35 × 1 （F1SVC5） 16S Ribosomal RNA × 1 UNASSIGNED RNA × 1 MRPL2 × 1 （F1RRN2） MRPL3 × 1 （F1RX24） MRPL4 × 1 （F1S3J8） MRPL9 × 1 （I3LR45） MRPL13 × 1 （F1S286） MRPL14 × 1 （F1RQV7） MRPL15 × 1 （F1RSH0） MRPL16 × 1 （F1RI89） MRPL17 × 1 （F1RMQ4） MRPL18 × 1 （F1SB64） MRPL19 × 1 （I3LNJ0） MRPL20 × 1 （F1RJD0） MRPL21 × 1 （F1RY70） MRPL22 × 1 MRPL23 × 1 MRPL24 × 1 （F1RHJ1） MRPL38 × 1 （F1RW03） MRPL39 × 1 （F1SHP6） MRPL44 × 1 （F1SR64） MRPL45 × 1 MRPL49 × 1 MRPL52 × 1 ICT1 × 1 UNASSIGNED HELICES × 2 THIOREDOXIN FOLD × 1 UNASSIGNED HELICES × 1 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LDE8_PIG
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain 9； PDBConstruct 1–100； UniProt 1–100

MRPL2

OrganismNot specified

UniProt F1RRN2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 2	MRPL27 × 1 （F1RT79） MRPL28 × 1 （F1RGV8） MRPL47 × 1 MRPL30 × 1 （F1STE5） MRPL32 × 1 （I3LTC4） MRPL33 × 1 MRPL34 × 1 MRPL35 × 1 （F1SVC5） MRPL36 × 1 （I3LDE8） 16S Ribosomal RNA × 1 UNASSIGNED RNA × 1 MRPL3 × 1 （F1RX24） MRPL4 × 1 （F1S3J8） MRPL9 × 1 （I3LR45） MRPL13 × 1 （F1S286） MRPL14 × 1 （F1RQV7） MRPL15 × 1 （F1RSH0） MRPL16 × 1 （F1RI89） MRPL17 × 1 （F1RMQ4） MRPL18 × 1 （F1SB64） MRPL19 × 1 （I3LNJ0） MRPL20 × 1 （F1RJD0） MRPL21 × 1 （F1RY70） MRPL22 × 1 MRPL23 × 1 MRPL24 × 1 （F1RHJ1） MRPL38 × 1 （F1RW03） MRPL39 × 1 （F1SHP6） MRPL44 × 1 （F1SR64） MRPL45 × 1 MRPL49 × 1 MRPL52 × 1 ICT1 × 1 UNASSIGNED HELICES × 2 THIOREDOXIN FOLD × 1 UNASSIGNED HELICES × 1 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RRN2_PIG
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain D； PDBConstruct 1–306； UniProt 1–306

MRPL3

OrganismNot specified

UniProt F1RX24

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 2	MRPL27 × 1 （F1RT79） MRPL28 × 1 （F1RGV8） MRPL47 × 1 MRPL30 × 1 （F1STE5） MRPL32 × 1 （I3LTC4） MRPL33 × 1 MRPL34 × 1 MRPL35 × 1 （F1SVC5） MRPL36 × 1 （I3LDE8） 16S Ribosomal RNA × 1 UNASSIGNED RNA × 1 MRPL2 × 1 （F1RRN2） MRPL4 × 1 （F1S3J8） MRPL9 × 1 （I3LR45） MRPL13 × 1 （F1S286） MRPL14 × 1 （F1RQV7） MRPL15 × 1 （F1RSH0） MRPL16 × 1 （F1RI89） MRPL17 × 1 （F1RMQ4） MRPL18 × 1 （F1SB64） MRPL19 × 1 （I3LNJ0） MRPL20 × 1 （F1RJD0） MRPL21 × 1 （F1RY70） MRPL22 × 1 MRPL23 × 1 MRPL24 × 1 （F1RHJ1） MRPL38 × 1 （F1RW03） MRPL39 × 1 （F1SHP6） MRPL44 × 1 （F1SR64） MRPL45 × 1 MRPL49 × 1 MRPL52 × 1 ICT1 × 1 UNASSIGNED HELICES × 2 THIOREDOXIN FOLD × 1 UNASSIGNED HELICES × 1 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RX24_PIG
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain E； PDBConstruct 1–399； UniProt 1–399

MRPL4

OrganismNot specified

UniProt F1S3J8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 2	MRPL27 × 1 （F1RT79） MRPL28 × 1 （F1RGV8） MRPL47 × 1 MRPL30 × 1 （F1STE5） MRPL32 × 1 （I3LTC4） MRPL33 × 1 MRPL34 × 1 MRPL35 × 1 （F1SVC5） MRPL36 × 1 （I3LDE8） 16S Ribosomal RNA × 1 UNASSIGNED RNA × 1 MRPL2 × 1 （F1RRN2） MRPL3 × 1 （F1RX24） MRPL9 × 1 （I3LR45） MRPL13 × 1 （F1S286） MRPL14 × 1 （F1RQV7） MRPL15 × 1 （F1RSH0） MRPL16 × 1 （F1RI89） MRPL17 × 1 （F1RMQ4） MRPL18 × 1 （F1SB64） MRPL19 × 1 （I3LNJ0） MRPL20 × 1 （F1RJD0） MRPL21 × 1 （F1RY70） MRPL22 × 1 MRPL23 × 1 MRPL24 × 1 （F1RHJ1） MRPL38 × 1 （F1RW03） MRPL39 × 1 （F1SHP6） MRPL44 × 1 （F1SR64） MRPL45 × 1 MRPL49 × 1 MRPL52 × 1 ICT1 × 1 UNASSIGNED HELICES × 2 THIOREDOXIN FOLD × 1 UNASSIGNED HELICES × 1 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1S3J8_PIG
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain F； PDBConstruct 20–215； UniProt 78–273

MRPL9

OrganismNot specified

UniProt I3LR45

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 2	MRPL27 × 1 （F1RT79） MRPL28 × 1 （F1RGV8） MRPL47 × 1 MRPL30 × 1 （F1STE5） MRPL32 × 1 （I3LTC4） MRPL33 × 1 MRPL34 × 1 MRPL35 × 1 （F1SVC5） MRPL36 × 1 （I3LDE8） 16S Ribosomal RNA × 1 UNASSIGNED RNA × 1 MRPL2 × 1 （F1RRN2） MRPL3 × 1 （F1RX24） MRPL4 × 1 （F1S3J8） MRPL13 × 1 （F1S286） MRPL14 × 1 （F1RQV7） MRPL15 × 1 （F1RSH0） MRPL16 × 1 （F1RI89） MRPL17 × 1 （F1RMQ4） MRPL18 × 1 （F1SB64） MRPL19 × 1 （I3LNJ0） MRPL20 × 1 （F1RJD0） MRPL21 × 1 （F1RY70） MRPL22 × 1 MRPL23 × 1 MRPL24 × 1 （F1RHJ1） MRPL38 × 1 （F1RW03） MRPL39 × 1 （F1SHP6） MRPL44 × 1 （F1SR64） MRPL45 × 1 MRPL49 × 1 MRPL52 × 1 ICT1 × 1 UNASSIGNED HELICES × 2 THIOREDOXIN FOLD × 1 UNASSIGNED HELICES × 1 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LR45_PIG
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain I； PDBConstruct 1–268； UniProt 1–268

MRPL13

OrganismNot specified

UniProt F1S286

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 2	MRPL27 × 1 （F1RT79） MRPL28 × 1 （F1RGV8） MRPL47 × 1 MRPL30 × 1 （F1STE5） MRPL32 × 1 （I3LTC4） MRPL33 × 1 MRPL34 × 1 MRPL35 × 1 （F1SVC5） MRPL36 × 1 （I3LDE8） 16S Ribosomal RNA × 1 UNASSIGNED RNA × 1 MRPL2 × 1 （F1RRN2） MRPL3 × 1 （F1RX24） MRPL4 × 1 （F1S3J8） MRPL9 × 1 （I3LR45） MRPL14 × 1 （F1RQV7） MRPL15 × 1 （F1RSH0） MRPL16 × 1 （F1RI89） MRPL17 × 1 （F1RMQ4） MRPL18 × 1 （F1SB64） MRPL19 × 1 （I3LNJ0） MRPL20 × 1 （F1RJD0） MRPL21 × 1 （F1RY70） MRPL22 × 1 MRPL23 × 1 MRPL24 × 1 （F1RHJ1） MRPL38 × 1 （F1RW03） MRPL39 × 1 （F1SHP6） MRPL44 × 1 （F1SR64） MRPL45 × 1 MRPL49 × 1 MRPL52 × 1 ICT1 × 1 UNASSIGNED HELICES × 2 THIOREDOXIN FOLD × 1 UNASSIGNED HELICES × 1 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1S286_PIG
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain N； PDBConstruct 1–178； UniProt 1–178

MRPL14

OrganismNot specified

UniProt F1RQV7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 2	MRPL27 × 1 （F1RT79） MRPL28 × 1 （F1RGV8） MRPL47 × 1 MRPL30 × 1 （F1STE5） MRPL32 × 1 （I3LTC4） MRPL33 × 1 MRPL34 × 1 MRPL35 × 1 （F1SVC5） MRPL36 × 1 （I3LDE8） 16S Ribosomal RNA × 1 UNASSIGNED RNA × 1 MRPL2 × 1 （F1RRN2） MRPL3 × 1 （F1RX24） MRPL4 × 1 （F1S3J8） MRPL9 × 1 （I3LR45） MRPL13 × 1 （F1S286） MRPL15 × 1 （F1RSH0） MRPL16 × 1 （F1RI89） MRPL17 × 1 （F1RMQ4） MRPL18 × 1 （F1SB64） MRPL19 × 1 （I3LNJ0） MRPL20 × 1 （F1RJD0） MRPL21 × 1 （F1RY70） MRPL22 × 1 MRPL23 × 1 MRPL24 × 1 （F1RHJ1） MRPL38 × 1 （F1RW03） MRPL39 × 1 （F1SHP6） MRPL44 × 1 （F1SR64） MRPL45 × 1 MRPL49 × 1 MRPL52 × 1 ICT1 × 1 UNASSIGNED HELICES × 2 THIOREDOXIN FOLD × 1 UNASSIGNED HELICES × 1 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RQV7_PIG
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain O； PDBConstruct 1–145； UniProt 1–145

MRPL15

OrganismNot specified

UniProt F1RSH0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 2	MRPL27 × 1 （F1RT79） MRPL28 × 1 （F1RGV8） MRPL47 × 1 MRPL30 × 1 （F1STE5） MRPL32 × 1 （I3LTC4） MRPL33 × 1 MRPL34 × 1 MRPL35 × 1 （F1SVC5） MRPL36 × 1 （I3LDE8） 16S Ribosomal RNA × 1 UNASSIGNED RNA × 1 MRPL2 × 1 （F1RRN2） MRPL3 × 1 （F1RX24） MRPL4 × 1 （F1S3J8） MRPL9 × 1 （I3LR45） MRPL13 × 1 （F1S286） MRPL14 × 1 （F1RQV7） MRPL16 × 1 （F1RI89） MRPL17 × 1 （F1RMQ4） MRPL18 × 1 （F1SB64） MRPL19 × 1 （I3LNJ0） MRPL20 × 1 （F1RJD0） MRPL21 × 1 （F1RY70） MRPL22 × 1 MRPL23 × 1 MRPL24 × 1 （F1RHJ1） MRPL38 × 1 （F1RW03） MRPL39 × 1 （F1SHP6） MRPL44 × 1 （F1SR64） MRPL45 × 1 MRPL49 × 1 MRPL52 × 1 ICT1 × 1 UNASSIGNED HELICES × 2 THIOREDOXIN FOLD × 1 UNASSIGNED HELICES × 1 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RSH0_PIG
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain P； PDBConstruct 14–288； UniProt 22–296

MRPL16

OrganismNot specified

UniProt F1RI89

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 2	MRPL27 × 1 （F1RT79） MRPL28 × 1 （F1RGV8） MRPL47 × 1 MRPL30 × 1 （F1STE5） MRPL32 × 1 （I3LTC4） MRPL33 × 1 MRPL34 × 1 MRPL35 × 1 （F1SVC5） MRPL36 × 1 （I3LDE8） 16S Ribosomal RNA × 1 UNASSIGNED RNA × 1 MRPL2 × 1 （F1RRN2） MRPL3 × 1 （F1RX24） MRPL4 × 1 （F1S3J8） MRPL9 × 1 （I3LR45） MRPL13 × 1 （F1S286） MRPL14 × 1 （F1RQV7） MRPL15 × 1 （F1RSH0） MRPL17 × 1 （F1RMQ4） MRPL18 × 1 （F1SB64） MRPL19 × 1 （I3LNJ0） MRPL20 × 1 （F1RJD0） MRPL21 × 1 （F1RY70） MRPL22 × 1 MRPL23 × 1 MRPL24 × 1 （F1RHJ1） MRPL38 × 1 （F1RW03） MRPL39 × 1 （F1SHP6） MRPL44 × 1 （F1SR64） MRPL45 × 1 MRPL49 × 1 MRPL52 × 1 ICT1 × 1 UNASSIGNED HELICES × 2 THIOREDOXIN FOLD × 1 UNASSIGNED HELICES × 1 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RI89_PIG
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain Q； PDBConstruct 1–191； UniProt 1–191

MRPL17

OrganismNot specified

UniProt F1RMQ4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 2	MRPL27 × 1 （F1RT79） MRPL28 × 1 （F1RGV8） MRPL47 × 1 MRPL30 × 1 （F1STE5） MRPL32 × 1 （I3LTC4） MRPL33 × 1 MRPL34 × 1 MRPL35 × 1 （F1SVC5） MRPL36 × 1 （I3LDE8） 16S Ribosomal RNA × 1 UNASSIGNED RNA × 1 MRPL2 × 1 （F1RRN2） MRPL3 × 1 （F1RX24） MRPL4 × 1 （F1S3J8） MRPL9 × 1 （I3LR45） MRPL13 × 1 （F1S286） MRPL14 × 1 （F1RQV7） MRPL15 × 1 （F1RSH0） MRPL16 × 1 （F1RI89） MRPL18 × 1 （F1SB64） MRPL19 × 1 （I3LNJ0） MRPL20 × 1 （F1RJD0） MRPL21 × 1 （F1RY70） MRPL22 × 1 MRPL23 × 1 MRPL24 × 1 （F1RHJ1） MRPL38 × 1 （F1RW03） MRPL39 × 1 （F1SHP6） MRPL44 × 1 （F1SR64） MRPL45 × 1 MRPL49 × 1 MRPL52 × 1 ICT1 × 1 UNASSIGNED HELICES × 2 THIOREDOXIN FOLD × 1 UNASSIGNED HELICES × 1 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RMQ4_PIG
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain R； PDBConstruct 1–169； UniProt 1–169

MRPL18

OrganismNot specified

UniProt F1SB64

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 2	MRPL27 × 1 （F1RT79） MRPL28 × 1 （F1RGV8） MRPL47 × 1 MRPL30 × 1 （F1STE5） MRPL32 × 1 （I3LTC4） MRPL33 × 1 MRPL34 × 1 MRPL35 × 1 （F1SVC5） MRPL36 × 1 （I3LDE8） 16S Ribosomal RNA × 1 UNASSIGNED RNA × 1 MRPL2 × 1 （F1RRN2） MRPL3 × 1 （F1RX24） MRPL4 × 1 （F1S3J8） MRPL9 × 1 （I3LR45） MRPL13 × 1 （F1S286） MRPL14 × 1 （F1RQV7） MRPL15 × 1 （F1RSH0） MRPL16 × 1 （F1RI89） MRPL17 × 1 （F1RMQ4） MRPL19 × 1 （I3LNJ0） MRPL20 × 1 （F1RJD0） MRPL21 × 1 （F1RY70） MRPL22 × 1 MRPL23 × 1 MRPL24 × 1 （F1RHJ1） MRPL38 × 1 （F1RW03） MRPL39 × 1 （F1SHP6） MRPL44 × 1 （F1SR64） MRPL45 × 1 MRPL49 × 1 MRPL52 × 1 ICT1 × 1 UNASSIGNED HELICES × 2 THIOREDOXIN FOLD × 1 UNASSIGNED HELICES × 1 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SB64_PIG
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain S； PDBConstruct 1–180； UniProt 1–180

MRPL19

OrganismNot specified

UniProt I3LNJ0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 2	MRPL27 × 1 （F1RT79） MRPL28 × 1 （F1RGV8） MRPL47 × 1 MRPL30 × 1 （F1STE5） MRPL32 × 1 （I3LTC4） MRPL33 × 1 MRPL34 × 1 MRPL35 × 1 （F1SVC5） MRPL36 × 1 （I3LDE8） 16S Ribosomal RNA × 1 UNASSIGNED RNA × 1 MRPL2 × 1 （F1RRN2） MRPL3 × 1 （F1RX24） MRPL4 × 1 （F1S3J8） MRPL9 × 1 （I3LR45） MRPL13 × 1 （F1S286） MRPL14 × 1 （F1RQV7） MRPL15 × 1 （F1RSH0） MRPL16 × 1 （F1RI89） MRPL17 × 1 （F1RMQ4） MRPL18 × 1 （F1SB64） MRPL20 × 1 （F1RJD0） MRPL21 × 1 （F1RY70） MRPL22 × 1 MRPL23 × 1 MRPL24 × 1 （F1RHJ1） MRPL38 × 1 （F1RW03） MRPL39 × 1 （F1SHP6） MRPL44 × 1 （F1SR64） MRPL45 × 1 MRPL49 × 1 MRPL52 × 1 ICT1 × 1 UNASSIGNED HELICES × 2 THIOREDOXIN FOLD × 1 UNASSIGNED HELICES × 1 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LNJ0_PIG
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain T； PDBConstruct 1–292； UniProt 1–292

MRPL20

OrganismNot specified

UniProt F1RJD0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 2	MRPL27 × 1 （F1RT79） MRPL28 × 1 （F1RGV8） MRPL47 × 1 MRPL30 × 1 （F1STE5） MRPL32 × 1 （I3LTC4） MRPL33 × 1 MRPL34 × 1 MRPL35 × 1 （F1SVC5） MRPL36 × 1 （I3LDE8） 16S Ribosomal RNA × 1 UNASSIGNED RNA × 1 MRPL2 × 1 （F1RRN2） MRPL3 × 1 （F1RX24） MRPL4 × 1 （F1S3J8） MRPL9 × 1 （I3LR45） MRPL13 × 1 （F1S286） MRPL14 × 1 （F1RQV7） MRPL15 × 1 （F1RSH0） MRPL16 × 1 （F1RI89） MRPL17 × 1 （F1RMQ4） MRPL18 × 1 （F1SB64） MRPL19 × 1 （I3LNJ0） MRPL21 × 1 （F1RY70） MRPL22 × 1 MRPL23 × 1 MRPL24 × 1 （F1RHJ1） MRPL38 × 1 （F1RW03） MRPL39 × 1 （F1SHP6） MRPL44 × 1 （F1SR64） MRPL45 × 1 MRPL49 × 1 MRPL52 × 1 ICT1 × 1 UNASSIGNED HELICES × 2 THIOREDOXIN FOLD × 1 UNASSIGNED HELICES × 1 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RJD0_PIG
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain U； PDBConstruct 1–124； UniProt 1–124

MRPL21

OrganismNot specified

UniProt F1RY70

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 2	MRPL27 × 1 （F1RT79） MRPL28 × 1 （F1RGV8） MRPL47 × 1 MRPL30 × 1 （F1STE5） MRPL32 × 1 （I3LTC4） MRPL33 × 1 MRPL34 × 1 MRPL35 × 1 （F1SVC5） MRPL36 × 1 （I3LDE8） 16S Ribosomal RNA × 1 UNASSIGNED RNA × 1 MRPL2 × 1 （F1RRN2） MRPL3 × 1 （F1RX24） MRPL4 × 1 （F1S3J8） MRPL9 × 1 （I3LR45） MRPL13 × 1 （F1S286） MRPL14 × 1 （F1RQV7） MRPL15 × 1 （F1RSH0） MRPL16 × 1 （F1RI89） MRPL17 × 1 （F1RMQ4） MRPL18 × 1 （F1SB64） MRPL19 × 1 （I3LNJ0） MRPL20 × 1 （F1RJD0） MRPL22 × 1 MRPL23 × 1 MRPL24 × 1 （F1RHJ1） MRPL38 × 1 （F1RW03） MRPL39 × 1 （F1SHP6） MRPL44 × 1 （F1SR64） MRPL45 × 1 MRPL49 × 1 MRPL52 × 1 ICT1 × 1 UNASSIGNED HELICES × 2 THIOREDOXIN FOLD × 1 UNASSIGNED HELICES × 1 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RY70_PIG
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain V； PDBConstruct 1–203； UniProt 1–203

MRPL24

OrganismNot specified

UniProt F1RHJ1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 2	MRPL27 × 1 （F1RT79） MRPL28 × 1 （F1RGV8） MRPL47 × 1 MRPL30 × 1 （F1STE5） MRPL32 × 1 （I3LTC4） MRPL33 × 1 MRPL34 × 1 MRPL35 × 1 （F1SVC5） MRPL36 × 1 （I3LDE8） 16S Ribosomal RNA × 1 UNASSIGNED RNA × 1 MRPL2 × 1 （F1RRN2） MRPL3 × 1 （F1RX24） MRPL4 × 1 （F1S3J8） MRPL9 × 1 （I3LR45） MRPL13 × 1 （F1S286） MRPL14 × 1 （F1RQV7） MRPL15 × 1 （F1RSH0） MRPL16 × 1 （F1RI89） MRPL17 × 1 （F1RMQ4） MRPL18 × 1 （F1SB64） MRPL19 × 1 （I3LNJ0） MRPL20 × 1 （F1RJD0） MRPL21 × 1 （F1RY70） MRPL22 × 1 MRPL23 × 1 MRPL38 × 1 （F1RW03） MRPL39 × 1 （F1SHP6） MRPL44 × 1 （F1SR64） MRPL45 × 1 MRPL49 × 1 MRPL52 × 1 ICT1 × 1 UNASSIGNED HELICES × 2 THIOREDOXIN FOLD × 1 UNASSIGNED HELICES × 1 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RHJ1_PIG
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain Y； PDBConstruct 1–216； UniProt 1–216

MRPL38

OrganismNot specified

UniProt F1RW03

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 2	MRPL27 × 1 （F1RT79） MRPL28 × 1 （F1RGV8） MRPL47 × 1 MRPL30 × 1 （F1STE5） MRPL32 × 1 （I3LTC4） MRPL33 × 1 MRPL34 × 1 MRPL35 × 1 （F1SVC5） MRPL36 × 1 （I3LDE8） 16S Ribosomal RNA × 1 UNASSIGNED RNA × 1 MRPL2 × 1 （F1RRN2） MRPL3 × 1 （F1RX24） MRPL4 × 1 （F1S3J8） MRPL9 × 1 （I3LR45） MRPL13 × 1 （F1S286） MRPL14 × 1 （F1RQV7） MRPL15 × 1 （F1RSH0） MRPL16 × 1 （F1RI89） MRPL17 × 1 （F1RMQ4） MRPL18 × 1 （F1SB64） MRPL19 × 1 （I3LNJ0） MRPL20 × 1 （F1RJD0） MRPL21 × 1 （F1RY70） MRPL22 × 1 MRPL23 × 1 MRPL24 × 1 （F1RHJ1） MRPL39 × 1 （F1SHP6） MRPL44 × 1 （F1SR64） MRPL45 × 1 MRPL49 × 1 MRPL52 × 1 ICT1 × 1 UNASSIGNED HELICES × 2 THIOREDOXIN FOLD × 1 UNASSIGNED HELICES × 1 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RW03_PIG
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain b； PDBConstruct 1–380； UniProt 1–380

MRPL39

OrganismNot specified

UniProt F1SHP6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 2	MRPL27 × 1 （F1RT79） MRPL28 × 1 （F1RGV8） MRPL47 × 1 MRPL30 × 1 （F1STE5） MRPL32 × 1 （I3LTC4） MRPL33 × 1 MRPL34 × 1 MRPL35 × 1 （F1SVC5） MRPL36 × 1 （I3LDE8） 16S Ribosomal RNA × 1 UNASSIGNED RNA × 1 MRPL2 × 1 （F1RRN2） MRPL3 × 1 （F1RX24） MRPL4 × 1 （F1S3J8） MRPL9 × 1 （I3LR45） MRPL13 × 1 （F1S286） MRPL14 × 1 （F1RQV7） MRPL15 × 1 （F1RSH0） MRPL16 × 1 （F1RI89） MRPL17 × 1 （F1RMQ4） MRPL18 × 1 （F1SB64） MRPL19 × 1 （I3LNJ0） MRPL20 × 1 （F1RJD0） MRPL21 × 1 （F1RY70） MRPL22 × 1 MRPL23 × 1 MRPL24 × 1 （F1RHJ1） MRPL38 × 1 （F1RW03） MRPL44 × 1 （F1SR64） MRPL45 × 1 MRPL49 × 1 MRPL52 × 1 ICT1 × 1 UNASSIGNED HELICES × 2 THIOREDOXIN FOLD × 1 UNASSIGNED HELICES × 1 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SHP6_PIG
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain c； PDBConstruct 33–301； UniProt 69–337

MRPL44

OrganismNot specified

UniProt F1SR64

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 36 RNA 2	MRPL27 × 1 （F1RT79） MRPL28 × 1 （F1RGV8） MRPL47 × 1 MRPL30 × 1 （F1STE5） MRPL32 × 1 （I3LTC4） MRPL33 × 1 MRPL34 × 1 MRPL35 × 1 （F1SVC5） MRPL36 × 1 （I3LDE8） 16S Ribosomal RNA × 1 UNASSIGNED RNA × 1 MRPL2 × 1 （F1RRN2） MRPL3 × 1 （F1RX24） MRPL4 × 1 （F1S3J8） MRPL9 × 1 （I3LR45） MRPL13 × 1 （F1S286） MRPL14 × 1 （F1RQV7） MRPL15 × 1 （F1RSH0） MRPL16 × 1 （F1RI89） MRPL17 × 1 （F1RMQ4） MRPL18 × 1 （F1SB64） MRPL19 × 1 （I3LNJ0） MRPL20 × 1 （F1RJD0） MRPL21 × 1 （F1RY70） MRPL22 × 1 MRPL23 × 1 MRPL24 × 1 （F1RHJ1） MRPL38 × 1 （F1RW03） MRPL39 × 1 （F1SHP6） MRPL45 × 1 MRPL49 × 1 MRPL52 × 1 ICT1 × 1 UNASSIGNED HELICES × 2 THIOREDOXIN FOLD × 1 UNASSIGNED HELICES × 1 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SR64_PIG
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain h； PDBConstruct 33–298； UniProt 67–332

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4ce4
Deposition date deposition_date	2013-11-08
Structure title title	39S large subunit of the porcine mitochondrial ribosome
Keywords keywords	;RIBOSOME, MAMMALIAN MITOCHONDRIAL RIBOSOME, 39S LARGE RIBOSOMAL SUBUNIT, TRANSLATION, RIBOSOMAL PROTEINS, RRNA, POLYPEPTIDE EXIT SITE, MEMBRANE ASSOCIATION ;; RIBOSOME
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4ce4__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4ce4__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4ce4__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	64.81 Å
Rg (electron density)	68.43 Å
Total Rg	68.20 Å
Atom count	65473
Residues	5991
Excluded volume	1062000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4ce4__assembly_1__model_1`	38-meric （38）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (38)

Entity 1 Entity 1 polymer

Description description	MRPL27
Molecular weight formula_weight	15943.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0
Atom count atom_count	65473

MALAVLALRTRAAVTALLSPPQAAALAVRYASKKTGGSSKNLGGKSPGKRFGIKKMEGHYVHAGNILATQRHFRWHPGAHVGLGKNKCLYALEEGVVRYTKEVYVPNPSNSEAVDLVTRLPQGAVLYKTFVHVVPAKPEGTFKLVAML

Entity 2 Entity 2 polymer

Description description	MRPL28
Molecular weight formula_weight	30149.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

MPLHKVPVGLWKQLRLWEGIYSRLPRHYLRSLEEARTPTPVHYRPHGAKFKINPKNWQRERVEDVPIPVHYPPESQLGLWGGEGWVLGHRYVNNDKLSKRVRKVWKPQLFQRELYSEILDKRFTVTVTMRTLDLIDQACGFDFYILKTPKEDLCSKFGMDLKRGMLLRLARQDPQLHPDDPARRAAIYDRYKAFVIPEAEAEWVGLTLDEAVEKQRLLEEKDPIPLFKIFVEELLGQLQQQALSEPAVVQTRASRK

Entity 3 Entity 3 polymer

Description description	MRPL47
Molecular weight formula_weight	30085.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MAAAGLAVFCRRVSAALKACRLLIRPQAPPSTSCRFSPSLLPKNTPNVTSFHQFRIFHTTFSRRGLEEFFDDPKNWGEEKVKSGASWTCQQLRNKSNEDLHKLWYVLLKERNMLLTLEQEAKRQRLPMPSPERLEKVVDSMDALDKVVQEREDALRLLQTGQEKARPGAWRRDIFGRIIWHKFKQWPIPWYLNKKYNRKRFFAMPYVERFVRMRIEKQARIKARKRSLERKKEKFLQEKFPHLSETQKSSHV

Entity 4 Entity 4 polymer

Description description	MRPL30
Molecular weight formula_weight	18585.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MAGILRSVVQRPPGRLQTVTKGMESLICTDWIRHKFTRSRIPDKVFQPSPEDHEKYGGDPQYPHKLHIVTRIKSTKRRPYWEKDIIKMLGLEKAHTPQVHKNIPSVNAKLKVVKHLIRIKPLKLPQGLPTEEDMANTCLKSNGELVVRWLLNPANQEARKS

Entity 5 Entity 5 polymer

Description description	MRPL32
Molecular weight formula_weight	15932.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

MASAMLVLVVPPWPAARGLLRNWWEQLQRKLQHNRLGLPLHPWGPALAVQGPAICTEPANDTNGSKAISSLLDSVFWMAAPKNRRSIEVNRCRRRNPQKLIKVKNNIDVCPECGHLKQKHILCGYCXXXXXXXXXXXXXXXXXXXX

Entity 6 Entity 6 polymer

Description description	MRPL33
Molecular weight formula_weight	7508.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MFLSAVTFAKSKSKTILVKMMSQAGTGFSFNTKRSRLREKLTLLHYDPVVKKKVLFVEQKKIRSL

Entity 7 Entity 7 polymer

Description description	MRPL34
Molecular weight formula_weight	10871.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

MAFLARSVGRLLDPVSRSAALVGGRWLQPQAWLGFPDTWGLPAMQQTRGKARGNEYQPSNIKRKHKHGWVRRLRTPTGVQVILRRMHKGRKSLSH

Entity 8 Entity 8 polymer

Description description	MRPL35
Molecular weight formula_weight	21548.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

MAASAFAGAVRAATGILRPLHILASSAYQNCAKNACLSSVLSSRHFSHIQTSALLSAPRLITSVRNLMCGPTAPVLNRVAPLLPHVLKPPVRTVTYFSSRKGKRKTVKAVIYRFLRLHSGLWLRRKAGYKKKLWKKTAARKRRLREFVFCNKTQSKLLDKMTTSFWKRRNWYADDPYQKYQDRTNLKV

Entity 9 Entity 9 polymer

Description description	MRPL36
Molecular weight formula_weight	10841.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	9

MATAFLRTVLSAVGPLLHLGGRPLSTFAAGPPRAALAVGAQPSPAAALLSARPLLGPQPALGFKTKGVLKKRCRDCYLVKRRGRWFIYCKTNPKHKQRQM

Entity 10 Entity 10 polymer

Description description	16S Ribosomal RNA
Molecular weight formula_weight	501424.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	A

ACCAAAGCUAGCUCAACAUNNNNNNNNNNNNNNNNNNNNNNNNNAAAUAAAAUAAAACAUUCACCUAACAUUAAAGUAUAGGAGAUAGAAAUUUUUAUCCUGACGCUAUAGAGAUAGUACCGUAAGGGAAAGAUGAAAGAAUAAAAUAAAAGUAAAAAAAAGCAAAGAUUACCCCUUCUACCUUUUGCAUAAUGGUUUAACCAGAAAAAAUCUAACAAAGAGAACUUUAGCUAGAUACCCCGAAACCAGACGAGCUACCCAUGAGCAGUUUAAAAGAACCAACUCAUCUAUGUGGCAAAAUAGUGAGAAGACUUGUAGGUAGAGGUGAAAAGCCUAACGAGCCUGGUGAUAGCUGGUUGUCCGAGAAAGAAUUUUAGUUCAACCUUAAAAAUACCCCAAAAACCCUAAAUUCCAAUGUAUUUUUAAGAGAUAGUCUAAAAAGGUACAGCUUUUUAGAAACGGAUACAACCUUGACUAGAGAGUAAAUCUUAAUACUACCAUAGUAGGCCUAAAAGCAGCCAUCAAUUGAGAAAGCGUUAAAGCUCAACAAAUUCACCAACAUAAUCCCAAAAACUAAUAACAAACUCCUAGCCCAAUACCGGACUAAUCUAUUGAAACAUAGAAGCAAUAAUGUUAAUAUGAGUAACAAGAAGCCUUUCUCCUCGCACACGCUUACAUCAGUAACUAAUAAUAUACUGAUAAUUAACAACCAAUAAACCAAAACAACACUAAAACGUUUAUUAAUUACAUUGUUAACCCAACACAGGAGUGCACCAAGGAAAGAUUAAAAGAAGUAAAAGGAACUCGGCAAACACAAACCCCGCCUGUUUACCAAAAACAUCACCUCUAGCAUUACUAGUAUUAGAGGCAAUGCCUGCCCAGUGACACCAGUUUAACGGCCGCGGUAUUCUGACCGUGCAAAGGUAGCAUAAUCACUUGUUCUCCAAAUAAGGACUUGUAUGAAUGGCCACACGAGGGUUUUACUGUCUCUUACUUCCAAUCAGUGAAAUUAACCUUCCCGUGAAGAGGCGGGAAUAAAAAAAUAAGACGAGAAGACCCUAUGGAGCUUUAAUUAACUAUUCCAAAAGUUAAACAACUCAACCACAAAGGGAUAAAACAUAACUUAACAUGGACUAGCAAUUUCGGUUGGGGUGACCUCGGAGUACAAAAAACCCUCCGAGUGAUUUUAAUCUAGACAAACCAGUCAAAAUAACCAUAACAUCACUUAUUGAUCCAAAAUUUUGAUCAACGGAACAAGUUACCCUAGGGAUAACAGCGCAAUCCUGUUCUAGAGUUCCUAUCGACAAUAGGGUUUACGACCUCGAUGUUGGAUCAGGACACCCAAAUGGUGCAGCCGCUAUUAAAGGUUCGUUUGUUCAACGAUUAAAGUCCUACGUGAUCUGAGUUCAGACCGGAGCAAUCCAGGUCGGUUUCUAUCUAUUAUAAAUUUCUCCCAGUACGAAAGGACAAGAGAAAUGGGACCAACCUCACAAACGCGUCUCAGAGAUAAUUAAUGAUUUAAUCUUAACCUAAUUAACUCAUAAUAAAUCCAGCCCUAGAACAGGGCACA

Entity 11 Entity 11 polymer

Description description	UNASSIGNED RNA
Molecular weight formula_weight	5641.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	B

NNNNNNNNNNNNNNNNNNNNNNNNNNNNN

Entity 12 Entity 12 polymer

Description description	MRPL2
Molecular weight formula_weight	33270.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MALRVLTRALSSLSLTPRIAVAPGLNLLPAVQVTNNVLLTLPSGLMSLPCRPILTSVALSATSVSWKSRTKYTVMPVKMRKSGGRNHTGQIQVHGIGGGHKQRYRMIDFLRFRPEHESKPGPFEEKVIAVRYDPCRSADIALVAGGNRKRWIIATENMKAGDTVLNSDHIGRMAVAAREGDAHPLGALPVGTLINNVESEPGRGAQYIRAAGTCGVLLRKVNGTAIIQLPSKRQMQVLETCIATVGRVSNVDHNKRVIGKAGRNRWLGKRPNSGLWQRKGGWAGRKIRPLPPMKSYVKLPSAAAQS

Entity 13 Entity 13 polymer

Description description	MRPL3
Molecular weight formula_weight	43708.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MAPAALLPSWGQRGAAAGGGGKAWEGRRRNALKAEWRGAQRCSGRALLGLTMPGWGLLGRAGARVLGCGADGLGASRGLGNRTDICLLVRSLHGKSVTWWDEHLSEENVPFVKQLVSDENKAQLASKLCPLKDEPWPIHPWEPGSSRVGLIALKLGMMPLWTKDGQKHVVTLLQVQDCHVLKYTPKENHNGRMAALTVGGKTVSHFHKSASILEFYQELGLPPKQKVKIFNVTENAVIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMRRWGFKGQPATHGQTKTHRRPGAISTGDVARVWPGTKMPGQLGNIDRTAFGLKVWRINTKHNIIYVNGSVPGHKNCLVKIKDSKLPAYKDFCKNLPFPTYFPDGDEEALPEDLYDENVCQPGAPSITFT

Entity 14 Entity 14 polymer

Description description	MRPL4
Molecular weight formula_weight	24306.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

XXXXXXXXXXXXXXXXXXXGLTELHPDVFSTAPRLDILHQVAIWQKNFKRISYAKTKTRAEVRGGGRKPWVQKGSGRARHGSIRSPIWRGGGVAHGPRGPTSYYYMLPMKVRVQGLKVALTVKLAQDDLHIVDSLELPTADPQYLIELARYRRWGDSVLLVDLEHEDMPQNVVAATSGLKTFNLVPAVGLNVHSMLKHQTLVLTLPTVAFLEEKLXXXXXXXXX

Entity 15 Entity 15 polymer

Description description	MRPL9
Molecular weight formula_weight	30373.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MAAAACTAAGGGLLRAGLERLLRGGVRALLRPRLEGVTPRSERAFSLSLSRSTVIVERWWKVPLAGEGRKPRLHRRHRVYKLVEDTKHRPKDNLELVLTQSVEELGVRGDLVSVKKSVGRNRLLPQGLAVYASPENKKLFEEEKLLRQEGKLEKLQTKAGEATVKFLRRCHLEVGMKNNVKWELNPEIVARHFLRNLGVVVAPHALKLPEEPITQRGEYWCEVTVNGLDTVRVPMSVVNFERPKTKRYKYWLAQQAAKGDVPTSSQMI

Entity 16 Entity 16 polymer

Description description	MRPL13
Molecular weight formula_weight	20633.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MSSFSKAPQQWATFARVWYLLDGKMQPPGKLAAMASVKLQGLHKPVYHQLSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHQKDPVAIVKLAIYGMLPKNLHRRTMMQRLHLFPDEDIPEDILKNLVEELPQPRKVPRRLDEYTQEEIEAFPRVWSPPEDYRL

Entity 17 Entity 17 polymer

Description description	MRPL14
Molecular weight formula_weight	15955.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MAFCTGLRGPFAQVSRALSQRCFSTTGSLSAIQKMTRVRVVDNSALGTTPYHRPPRCIHVYNKTGVGKVGDRILLAIRGQKKKALIVGHRMPGPRMTPRFDSNNVVLLEDNGNPVGTRIKTPIPSSLRQREGEFSKVLAIAQNFV

Entity 18 Entity 18 polymer

Description description	MRPL15
Molecular weight formula_weight	32471.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

XXXXXXXXXXXXXVSLANLKPNPGSRKPERRPRGRRRGRKCGRGHKGERQRGTRPRLGFEGGQTPFYLRIPKYGFNEGHSFRHQYQPLSLNRLQYLIDLGRVDPTQPIDLTQLVNGRGVTIQPSKRDYGVQLVEEGADTFKAKVNIEVQMASELAIAAIEKNGGVVTTAFYDPRSLEILCKPVPFFLRGQPIPKRMLPPEALVPYYTDAKNRGYLADPARFPEARLELARKYGYVLPDITKDELFKMLSTRKDPRQIFFGLAPGWVVNMADKKILKPTDENLLKYYSS

Entity 19 Entity 19 polymer

Description description	MRPL16
Molecular weight formula_weight	22745.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MWRLLARACAPLLRAPLSDSWAAPSATAGFKTLLPVPTFEDVAIPEKPKLRFVERVPLVPKVRRERKNLSDIRGPSTEATEFTEGRFAILALGGGYLHWGHFEMMRLTINRSMDPKNMFALWRVPAPFKPITRKGMGQRMGGGKGAIDHYVTPVKAGRLIVEMGGRCEFKEVQGFLDLVAHKLPFPAKAVSXXXXXXXXXXXXXXXXX

Entity 20 Entity 20 polymer

Description description	MRPL17
Molecular weight formula_weight	19268.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MRLSVAAAISHGRVFRRLGLGPESRIHLLQNLLTGLVRHERIEASWARVDELRGYAEKLIDYGKLGDTNERAMRMADFWLTEKDLIPKLFQVLAPRFQGQNGGYTRMLQIPNRNEQDRAKMAVIEYKGNCLPPLPLPRRDSNLTLLNQLLQGLRQDQEASSHTAQTPAV

Entity 21 Entity 21 polymer

Description description	MRPL18
Molecular weight formula_weight	20582.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MALRSRFWALLSICRNPGCRAAALSTSCKPATNPETDPVENEAVAPEFTNRNPRNLELLAVARKERGWGTVWPSREFWHRLRVIRTQHHIEALVEHRNGQVVVSASTREWAIKKHLYSTRNVVACESVGRVLAERCLEAGINFMVYHPTPWEAASDSIKRLQHAMTEGGVVLREPRRIYE

Entity 22 Entity 22 polymer

Description description	MRPL19
Molecular weight formula_weight	33441.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MAASITRGSWAAVGLGQSFPPTRALLPAPASVICRTLAGSGRQQVTGSSEPGAFQPPPKPVIVDKRRPQRPETRFLSPEFIPPRGRTNPLKFQIERKDMLERRKILHIPEFYVGSILRVTTADPYASAKTSQFLGICIQRSGSGLGATFILRNTIEGQGVEICFELYNPRIQEIQVVKLEKRLDNSLLYLRDALPEYSTFDVNMKPITQEFNQEVPVNQLKVKMKPKPWSKRWERPKFNIKGIRFDLCLTEEQMREAQKWSQPWLEFDMMREYDTSKIEAAIWDEIEASKNS

Entity 23 Entity 23 polymer

Description description	MRPL20
Molecular weight formula_weight	15563.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MVFLTVPLWLRSRVTDRYWRVQEVLKHARHFRGRKNRCYRLAVRAVTRAFVKCTRARRLKKRSLRTLWINRITAASQEHGLKYPAFIINLIKCQVELNRKVLADLAIYEPKTFKSLAALAKRRRXXXXXXXX

Entity 24 Entity 24 polymer

Description description	MRPL21
Molecular weight formula_weight	22894.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MAAAVAASVLQGTFGRLVSAYSRSVLRTSRPGTAPPWSAPRRLSSQHTSSLRGCVPKTSLGSPPWPDIVLPDPVEETRHHAEVVGQVNELIAAGRYGRLFAVVHFAGHQWKVTAEDLILIENELDVACGERIRLEKVLLVGADNFTLLGKPLLGKELVRVEATVIEKTESWPKINMKFQKRKNYQRKRITVNPQTVLRINSIEXXXX

Entity 25 Entity 25 polymer

Description description	MRPL22
Molecular weight formula_weight	15072.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

EIYHCRRQIKYSKDKMWYLAKLIRGMSIDQALAQLEFSDKKGAQIIKEVLLEAQDMAVRDHNVEFRSNLYVAESTSGRGQYLKRIRYHGRGRFGIMEKVFCHYFVKLVEGXXXXXXXXXXXXXXXXXXXXXXXX

Entity 26 Entity 26 polymer

Description description	MRPL23
Molecular weight formula_weight	9807.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

XXXXXXXXXXXXXXPEDTVQFRIPMEMTRVDLRNYLERIYNVPVAAVRTRVQYGSNRRRDHRNIRIKKPDYKVAYVQLALGQXXXXX

Entity 27 Entity 27 polymer

Description description	MRPL24
Molecular weight formula_weight	24893.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MRLSALLALASKVTLPPNYRYGMSRPGSLSDKRKNPPGTRRRRVPVEPISDEDWHLFCGDKVEILEGKDAGKQGKVVQVIRQRNWVVVEGLNTHYRYVGKTVDYRGTMIPSEAPLLHNQVKLVDPTDRKPTDVEWRFTEAGERVRVSTRSGRIIPKPEFPRADGIVPETWIDGPKDTSVEDALEKTYVPRLKTLEEEVMEAMGIQETRRHKKVYWY

Entity 28 Entity 28 polymer

Description description	MRPL38
Molecular weight formula_weight	44656.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MAAPWWRAALCASRRWRGFSTSAALSRRAAPLGPMPNEDIDVSDLERLKKYRSFDRYRRRAEQEARKPHWWRTYREHFGEESGPKDRVDIGLPPPKVSRTQQLLERKQALRELRANVEEERAARLQTARIPLEAVRAEWERTCGPYHKQRLAEYCGLYRDLFHGATFVPRVPLHVAYAVGEDDLMPVYHGNEVTPTEAAQAPEVTYEADEGSLWTLLLTNLDGHLLEPDAEYVHWLVTNIPGNRVTEGQETCPYLPPFPARGSGFHRFAFLLFKQDKRIDFSGDTRPSPCYQLAQRTFHTFDFYKKHQDAMTPAGLAFFQCRWDDSVTRVFHQLLDMREPVFEFVRPPPYHPKQKRFPHRQPLRYLDRYRDSHEPTYGIY

Entity 29 Entity 29 polymer

Description description	MRPL39
Molecular weight formula_weight	33832.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHVGKTDPGTVFVMNKNISTPYSCAMHLSEWYCRKSILALVDGQPWDMYKPLTKSCEIKFLTFKDDDPGEVNKAYWRSCAMMMGCVIERAFKDEYVVSLVRAPEVPVIAGAFCYDVVLDKRLDEWMPTKENLHSFTKDARALIYKDLPFETLEVEAKVALEIFQHNKYKLDFIEEKASQNPERIVKLHRFGDFIDVSEGPLIPRTSICFQYEVSAVHNLQTQSSLVRRFQGLSLPVHLRAHFTIWNKLLERSRKMVTEDKTKPTEESAST

Entity 30 Entity 30 polymer

Description description	MRPL44
Molecular weight formula_weight	32637.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDYHAEIQAFGHRLQETFSLDLLKTAFVNSCYIKSEEAKRQKLGIDKEAALLNLKDNQELSEQGISFSQTCLTQFFEDAFPDLPTEGVTSLVDFLTSEEVVCHVARNLAVEQLALSAEFPVPPPVLRQTFFAVIGALLQSSGPERTALFIRDFLITQMTGKELFEMWTITNPMGLLVEELKKRKISAPESRLTRQSGSTTALPVYFVGLYCDRKLIAEGPGETVLVAEEEAARVALRKLFGFTENRRPWDYSKPKEHVRAEKTITAS

Entity 31 Entity 31 polymer

Description description	MRPL45
Molecular weight formula_weight	36119.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

MAAPVTRGLSCLPRVLGWWSRQPVLVTQSTAVVPVRTKKRFTPPTYQPKYKSEKEFVEHARKAGLVIPHERLERPIHLACTAGIFDAYVPPEGDARISSLSKEGLAQRAERLKKNVASQLSIRKIRESDPNFKIKDFPEKAKDIFIEAHLCLNNSDHDRLHTLVTENCFPDMVWDIRYKTVRWSFVESLEPPQVVQVRCSSLMNQGNIYGQVTVRMHTRQTLAIYDRFGRLMYGQEDVPRDVLEYVVFEKHLVDPYGSWRMHGKIIPPWAPPKQPILKTVMIPGPQLKPWEEFEEPQGEVHKPQPARRRNDS

Entity 32 Entity 32 polymer

Description description	MRPL49
Molecular weight formula_weight	18957.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l

MAATVLCGVLRAWRTGVPLGCGLRRLSQTQGTPEYPSFVESVDEYHFVERLLPPASIPRPPKHEHYPTPSGWQPPRDPAPSLPYFVRRSRMHNIPVYRDITHGNRQMTVIRKVEGDIWALQKDVEDFLSPLLGKTPVTQVNEVTGTLRVKGYFDQQLKAWLLEKGF

Entity 33 Entity 33 polymer

Description description	MRPL52
Molecular weight formula_weight	4783.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 34 Entity 34 polymer

Description description	ICT1
Molecular weight formula_weight	23545.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	u

MAAARCLRWGLNRAGAWLLPSPTRYPRRALHKQVEGTEFQSIYSLDKLYPESRGSDTAWRLPDDAKQANDIPVDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLASADWIAEPVRLKLAVKHKNRINRSGELILTSECSRYQFRNLADCLQKLRDMIAEASQPAKEPSREDAELRRSRIENMNRERLRKKRISSAIKTSRRVDVD

Entity 35 Entity 35 polymer

Description description	UNASSIGNED HELICES
Molecular weight formula_weight	7762.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	v,w

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 36 Entity 36 polymer

Description description	THIOREDOXIN FOLD
Molecular weight formula_weight	7251.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 37 Entity 37 polymer

Description description	UNASSIGNED HELICES
Molecular weight formula_weight	36272.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	z

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 38 Entity 38 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.900 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	4.90 Å
Resolution测定Method resolution_method	ANGULAR RECONSTITUTION FOR INITIAL MODEL GENERATION FOLLOWED BY REFINEMENT BY PROJECTION MATCHING
颗粒数 num_particles	232181

39S large subunit of the porcine mitochondrial ribosome

1. Protein Identity and Related Structures Protein Identity & Related Structures

MRPL27

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

MRPL28

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

MRPL30

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

MRPL32

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

MRPL35

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

MRPL36

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

MRPL2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

MRPL3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

MRPL4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

MRPL9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer