8oiq

39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA

Method: ELECTRON MICROSCOPY D_max: 200.4 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mitochondrial ribosomal protein L12

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain B1； UniProt 1–198 Chain B2； UniProt 1–198 Chain B3； UniProt 1–198 Chain B4； UniProt 1–198 Chain B5； UniProt 1–198 Chain B6； UniProt 1–198	Not recorded	E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain B1 1–198（198 aa） Chain B2 1–198（198 aa） Chain B3 1–198（198 aa） Chain B4 1–198（198 aa） Chain B5 1–198（198 aa） Chain B6 1–198（198 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A8D0VGD9_PIG
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B1； PDBConstruct 1–198； UniProt 1–198 Author chain B2； PDBConstruct 1–198； UniProt 1–198 Author chain B3； PDBConstruct 1–198； UniProt 1–198 Author chain B4； PDBConstruct 1–198； UniProt 1–198 Author chain B5； PDBConstruct 1–198； UniProt 1–198 Author chain B6； PDBConstruct 1–198； UniProt 1–198

Large ribosomal subunit protein uL22m

OrganismNot specified

UniProt A0A4X1TXR4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BA； UniProt 1–210	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BA 1–210（210 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A4X1TXR4_PIG
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain BA； PDBConstruct 1–210； UniProt 1–210

39S ribosomal protein L23, mitochondrial

OrganismNot specified

UniProt A0A480JJI1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BB； UniProt 1–150	Non-standard monomer：Yes (specific site not provided by mmCIF)	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BX 1–150（150 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BB 1–150（150 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A480JJI1_PIG
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain BB； PDBConstruct 1–150； UniProt 1–150

uL24m

OrganismNot specified

UniProt F1RHJ1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BC； UniProt 1–216	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4CE4 39S large subunit of the porcine mitochondrial ribosome Deposited 2013-11-08	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 38-meric	Chain Y 1–216（216 aa）	Not recorded	ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2；pH 7.9；20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2 cryo-EM vitrification conditions Cryogen ETHANE；MANUAL BLOTTING FOLLOWED BY MANUAL PLUNGING INTO LIQUID ETHANE	Resolution 4.90 Å
4V19 Structure of the large subunit of the mammalian mitoribosome, part 1 of 2 Deposited 2014-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 28 PDB declaration: 32-meric	Chain Y 1–216（216 aa）	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 169	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain BY 1–216（216 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain BY 1–216（216 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GB2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 62-meric	Chain BY 1–216（216 aa）	Not recorded	MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain BY 1–216（216 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain BY 1–216（216 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BY 1–216（216 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BY 1–216（216 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain BY 1–216（216 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BY 1–216（216 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain BY 1–216（216 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BC 1–216（216 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

13 other PDB entries and 13 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1RHJ1_PIG
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain BC； PDBConstruct 1–216； UniProt 1–216

39S ribosomal protein L27, mitochondrial

OrganismNot specified

UniProt A0A4X1U0F6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BD； UniProt 1–148	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BD 1–148（148 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A4X1U0F6_PIG
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain BD； PDBConstruct 1–148； UniProt 1–148

Mitochondrial ribosomal protein L28

OrganismNot specified

UniProt A0A286ZTW8

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BE； UniProt 1–256	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain B1 1–256（256 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GB2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 62-meric	Chain B1 1–256（256 aa）	Not recorded	MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain B1 1–256（256 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain B1 1–256（256 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B1 1–256（256 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B1 1–256（256 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain B1 1–256（256 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B1 1–256（256 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain B1 1–256（256 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BE 1–256（256 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A286ZTW8_PIG
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain BE； PDBConstruct 1–256； UniProt 1–256

Mitochondrial ribosomal protein L47

OrganismNot specified

UniProt F1SGC7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BF； UniProt 1–250	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain B2 1–252（252 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GB2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit. Deposited 2018-04-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 62-meric	Chain B2 1–252（252 aa）	Not recorded	MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain B2 1–252（252 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain B2 1–252（252 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B2 1–252（252 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B2 1–252（252 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain B2 1–252（252 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B2 1–252（252 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain B2 1–252（252 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BF 1–250（250 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1SGC7_PIG
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain BF； PDBConstruct 1–250； UniProt 1–250

Large ribosomal subunit protein uL30m

OrganismNot specified

UniProt A0A8D0VJF4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BG； UniProt 1–161	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BG 1–161（161 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A8D0VJF4_PIG
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain BG； PDBConstruct 1–161； UniProt 1–161

Mitochondrial ribosomal protein L32

OrganismNot specified

UniProt I3LTC4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BH； UniProt 1–207	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4CE4 39S large subunit of the porcine mitochondrial ribosome Deposited 2013-11-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 38-meric	Chain 5 1–126（126 aa）	Not recorded	ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2；pH 7.9；20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2 cryo-EM vitrification conditions Cryogen ETHANE；MANUAL BLOTTING FOLLOWED BY MANUAL PLUNGING INTO LIQUID ETHANE	Resolution 4.90 Å
4V19 Structure of the large subunit of the mammalian mitoribosome, part 1 of 2 Deposited 2014-09-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 28 PDB declaration: 32-meric	Chain 5 1–188（188 aa）	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 169	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain B5 1–188（188 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain B5 20–207（188 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain B5 20–207（188 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain B5 20–207（188 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B5 20–207（188 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B5 20–207（188 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain B5 20–207（188 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B5 20–207（188 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain B5 20–207（188 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BH 1–207（207 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

12 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	I3LTC4_PIG
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain BH； PDBConstruct 1–207； UniProt 1–207

Large ribosomal subunit protein bL33m

OrganismNot specified

UniProt A0A4X1TLP9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BI； UniProt 1–65	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BI 1–65（65 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A4X1TLP9_PIG
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain BI； PDBConstruct 1–65； UniProt 1–65

Large ribosomal subunit protein bL34m

OrganismNot specified

UniProt A0A8D1JE64

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BJ； UniProt 1–95	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BJ 1–95（95 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A8D1JE64_PIG
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain BJ； PDBConstruct 1–95； UniProt 1–95

39S ribosomal protein L35, mitochondrial

OrganismNot specified

UniProt A0A5G2QZK0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BK； UniProt 1–188	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BK 1–188（188 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A5G2QZK0_PIG
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain BK； PDBConstruct 1–188； UniProt 1–188

Mitochondrial ribosomal protein L2

OrganismNot specified

UniProt A0A287A143

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BL； UniProt 1–306	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BD 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BL 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A287A143_PIG
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain BL； PDBConstruct 1–306； UniProt 1–306

ICT1

OrganismNot specified

UniProt A0A140UHW4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BM； UniProt 1–399	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain BE 52–399（348 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain BE 52–399（348 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain BE 52–399（348 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BE 1–399（399 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BE 1–399（399 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain BE 1–399（399 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BE 1–399（399 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain BE 1–399（399 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BM 1–399（399 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

9 other PDB entries and 9 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A140UHW4_PIG
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain BM； PDBConstruct 1–399； UniProt 1–399

Mitochondrial ribosomal protein L4

OrganismNot specified

UniProt A0A287B9C4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BN； UniProt 1–294	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain BF 1–294（294 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GB2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 62-meric	Chain BF 1–294（294 aa）	Not recorded	MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain BF 1–294（294 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain BF 1–294（294 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BF 1–294（294 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BF 1–294（294 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain BF 1–294（294 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain BF 1–294（294 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BN 1–294（294 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

9 other PDB entries and 9 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A287B9C4_PIG
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain BN； PDBConstruct 1–294； UniProt 1–294

Mitochondrial ribosomal protein L9

OrganismNot specified

UniProt I3LR45

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BO； UniProt 1–268	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4CE4 39S large subunit of the porcine mitochondrial ribosome Deposited 2013-11-08	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 38-meric	Chain I 1–268（268 aa）	Not recorded	ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2；pH 7.9；20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2 cryo-EM vitrification conditions Cryogen ETHANE；MANUAL BLOTTING FOLLOWED BY MANUAL PLUNGING INTO LIQUID ETHANE	Resolution 4.90 Å
4V19 Structure of the large subunit of the mammalian mitoribosome, part 1 of 2 Deposited 2014-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 28 PDB declaration: 32-meric	Chain I 1–268（268 aa）	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 169	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain BI 1–268（268 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain BI 1–268（268 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GB2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 62-meric	Chain BI 1–268（268 aa）	Not recorded	MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain BI 1–268（268 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain BI 1–268（268 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BI 1–268（268 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BI 1–268（268 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain BI 1–268（268 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BI 1–268（268 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain BI 1–268（268 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BO 1–268（268 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

13 other PDB entries and 13 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	I3LR45_PIG
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain BO； PDBConstruct 1–268； UniProt 1–268

Mitochondrial ribosomal protein L10

OrganismNot specified

UniProt F1RWJ0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BP； UniProt 1–257	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4V19 Structure of the large subunit of the mammalian mitoribosome, part 1 of 2 Deposited 2014-09-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 28 PDB declaration: 32-meric	Chain J 1–262（262 aa）	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 169	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain BJ 1–262（262 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain BJ 1–262（262 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GB2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit. Deposited 2018-04-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 62-meric	Chain BJ 1–262（262 aa）	Not recorded	MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain BJ 1–262（262 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain BJ 1–262（262 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BJ 1–262（262 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BJ 1–262（262 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain BJ 1–262（262 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain BJ 1–262（262 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BP 1–257（257 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

11 other PDB entries and 11 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1RWJ0_PIG
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain BP； PDBConstruct 1–257； UniProt 1–257

Mitochondrial ribosomal protein L11

OrganismNot specified

UniProt F1RU54

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BQ； UniProt 1–192	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4V19 Structure of the large subunit of the mammalian mitoribosome, part 1 of 2 Deposited 2014-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 28 PDB declaration: 32-meric	Chain K 1–192（192 aa）	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 169	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain BK 1–192（192 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain BK 1–192（192 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GB2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 62-meric	Chain BK 1–192（192 aa）	Not recorded	MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain BK 1–192（192 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain BK 1–192（192 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BK 1–192（192 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BK 1–192（192 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain BK 1–192（192 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain BK 1–192（192 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BQ 1–192（192 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

11 other PDB entries and 11 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1RU54_PIG
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain BQ； PDBConstruct 1–192； UniProt 1–192

39S ribosomal protein L13, mitochondrial

OrganismNot specified

UniProt K7GP19

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BR； UniProt 1–197	Non-standard monomer：Yes (specific site not provided by mmCIF)	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain BN 20–197（178 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain BN 20–197（178 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain BN 20–197（178 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BN 20–197（178 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BN 20–197（178 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain BN 20–197（178 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BN 20–197（178 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain BN 20–197（178 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BR 1–197（197 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

9 other PDB entries and 9 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	K7GP19_PIG
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain BR； PDBConstruct 1–197； UniProt 1–197

Mitochondrial ribosomal protein L14

OrganismNot specified

UniProt A0A287BMZ6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BS； UniProt 1–325	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain BO 181–325（145 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain BO 181–325（145 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain BO 181–325（145 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BO 181–325（145 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BO 181–325（145 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain BO 181–325（145 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain BO 181–325（145 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BS 1–325（325 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

8 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A287BMZ6_PIG
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain BS； PDBConstruct 1–325； UniProt 1–325

39S ribosomal protein L15, mitochondrial

OrganismNot specified

UniProt A0A5G2RG26

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BT； UniProt 1–296	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BP 1–296（296 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BT 1–296（296 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A5G2RG26_PIG
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain BT； PDBConstruct 1–296； UniProt 1–296

uL16m

OrganismNot specified

UniProt F1RI89

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BU； UniProt 1–251	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4CE4 39S large subunit of the porcine mitochondrial ribosome Deposited 2013-11-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 38-meric	Chain Q 1–191（191 aa）	Not recorded	ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2；pH 7.9；20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2 cryo-EM vitrification conditions Cryogen ETHANE；MANUAL BLOTTING FOLLOWED BY MANUAL PLUNGING INTO LIQUID ETHANE	Resolution 4.90 Å
4V19 Structure of the large subunit of the mammalian mitoribosome, part 1 of 2 Deposited 2014-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 28 PDB declaration: 32-meric	Chain Q 1–251（251 aa）	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 169	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain BQ 1–251（251 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain BQ 1–251（251 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GB2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 62-meric	Chain BQ 1–251（251 aa）	Not recorded	MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain BQ 1–251（251 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain BQ 1–251（251 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BQ 1–251（251 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BQ 1–251（251 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain BQ 1–251（251 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain BQ 1–251（251 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BU 1–251（251 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

12 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1RI89_PIG
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain BU； PDBConstruct 1–251； UniProt 1–251

bL17m

OrganismNot specified

UniProt F1RMQ4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BV； UniProt 1–169	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4CE4 39S large subunit of the porcine mitochondrial ribosome Deposited 2013-11-08	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 38-meric	Chain R 1–169（169 aa）	Not recorded	ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2；pH 7.9；20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2 cryo-EM vitrification conditions Cryogen ETHANE；MANUAL BLOTTING FOLLOWED BY MANUAL PLUNGING INTO LIQUID ETHANE	Resolution 4.90 Å
4V19 Structure of the large subunit of the mammalian mitoribosome, part 1 of 2 Deposited 2014-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 28 PDB declaration: 32-meric	Chain R 1–169（169 aa）	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 169	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain BR 1–169（169 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain BR 1–169（169 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GB2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 62-meric	Chain BR 1–169（169 aa）	Not recorded	MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain BR 1–169（169 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain BR 1–169（169 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BR 1–169（169 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BR 1–169（169 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain BR 1–169（169 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BR 1–169（169 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain BR 1–169（169 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BV 1–169（169 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

13 other PDB entries and 13 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1RMQ4_PIG
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain BV； PDBConstruct 1–169； UniProt 1–169

Mitochondrial ribosomal protein L18

OrganismNot specified

UniProt A0A4X1VX01

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BW； UniProt 1–188	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BW 1–188（188 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A4X1VX01_PIG
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain BW； PDBConstruct 1–188； UniProt 1–188

39S ribosomal protein L19, mitochondrial

OrganismNot specified

UniProt I3LNJ0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BX； UniProt 1–303	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4CE4 39S large subunit of the porcine mitochondrial ribosome Deposited 2013-11-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 38-meric	Chain T 1–292（292 aa）	Not recorded	ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2；pH 7.9；20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2 cryo-EM vitrification conditions Cryogen ETHANE；MANUAL BLOTTING FOLLOWED BY MANUAL PLUNGING INTO LIQUID ETHANE	Resolution 4.90 Å
4V19 Structure of the large subunit of the mammalian mitoribosome, part 1 of 2 Deposited 2014-09-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 28 PDB declaration: 32-meric	Chain T 1–292（292 aa）	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 169	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain BT 1–292（292 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain BT 12–303（292 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GAZ Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 28S ribosomal subunit. Deposited 2018-04-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 33 PDB declaration: 36-meric	Chain BT 12–303（292 aa）	Not recorded	GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MG MAGNESIUM ION × 111 NA SODIUM ION × 1 SPM SPERMINE × 1 ZN ZINC ION × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain BT 12–303（292 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain BT 12–303（292 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BT 12–303（292 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BT 12–303（292 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain BT 12–303（292 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BT 12–303（292 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain BT 12–303（292 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BX 1–303（303 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIP 28S mammalian mitochondrial small ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 33 PDB declaration: 36-meric	Chain BX 1–303（303 aa）	Not recorded	MG MAGNESIUM ION × 127 SPM SPERMINE × 1 SPD SPERMIDINE × 1 K POTASSIUM ION × 11 ZN ZINC ION × 1 FS2 FE-S-O HYBRID CLUSTER × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

14 other PDB entries and 14 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	I3LNJ0_PIG
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain BX； PDBConstruct 1–303； UniProt 1–303

Mitochondrial ribosomal protein L20

OrganismNot specified

UniProt A0A286ZU56

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BY； UniProt 1–149	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain BU 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GB2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 62-meric	Chain BU 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain BU 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain BU 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BU 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BU 1–149（149 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain BU 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BU 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain BU 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BY 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A286ZU56_PIG
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain BY； PDBConstruct 1–149； UniProt 1–149

Mitochondrial ribosomal protein L21

OrganismNot specified

UniProt F1RY70

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BZ； UniProt 1–209	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4CE4 39S large subunit of the porcine mitochondrial ribosome Deposited 2013-11-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 38-meric	Chain V 1–203（203 aa）	Not recorded	ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2；pH 7.9；20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2 cryo-EM vitrification conditions Cryogen ETHANE；MANUAL BLOTTING FOLLOWED BY MANUAL PLUNGING INTO LIQUID ETHANE	Resolution 4.90 Å
4V19 Structure of the large subunit of the mammalian mitoribosome, part 1 of 2 Deposited 2014-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 28 PDB declaration: 32-meric	Chain V 1–209（209 aa）	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 169	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain BV 1–209（209 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain BV 1–209（209 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GB2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 62-meric	Chain BV 1–209（209 aa）	Not recorded	MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain BV 1–209（209 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain BV 1–209（209 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BV 1–209（209 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BV 1–209（209 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain BV 1–209（209 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BV 1–209（209 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain BV 1–209（209 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BZ 1–209（209 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

13 other PDB entries and 13 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1RY70_PIG
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain BZ； PDBConstruct 1–209； UniProt 1–209

39S ribosomal protein L52, mitochondrial

OrganismNot specified

UniProt F1S9B7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Ba； UniProt 1–160	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4V1A Structure of the large subunit of the mammalian mitoribosome, part 2 of 2 Deposited 2014-09-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain o 1–124（124 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain Bo 1–124（124 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bo 1–124（124 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GB2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit. Deposited 2018-04-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 62-meric	Chain Bo 1–124（124 aa）	Not recorded	MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bo 1–124（124 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bo 1–124（124 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bo 1–124（124 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bo 1–124（124 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bo 1–124（124 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bo 1–124（124 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bo 1–124（124 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Ba 1–160（160 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

12 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1S9B7_PIG
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain Ba； PDBConstruct 1–160； UniProt 1–160

Mitochondrial ribosomal protein L53

OrganismNot specified

UniProt A0A8D0LKT0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bb； UniProt 1–112	Non-standard monomer：Yes (specific site not provided by mmCIF)	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bb 1–112（112 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A8D0LKT0_PIG
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain Bb； PDBConstruct 1–112； UniProt 1–112

mL54

OrganismNot specified

UniProt I3LN63

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bc； UniProt 1–138	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bq 1–138（138 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GB2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 62-meric	Chain Bq 1–138（138 aa）	Not recorded	MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bq 1–138（138 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bq 1–138（138 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bq 1–138（138 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bq 1–138（138 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bq 1–138（138 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bq 1–138（138 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bc 1–138（138 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

9 other PDB entries and 9 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	I3LN63_PIG
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain Bc； PDBConstruct 1–138； UniProt 1–138

Mitochondrial ribosomal protein L55

OrganismNot specified

UniProt A0A4X1ULI6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bd； UniProt 1–126	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bd 1–126（126 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A4X1ULI6_PIG
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain Bd； PDBConstruct 1–126； UniProt 1–126

Mitochondrial ribosomal protein L57

OrganismNot specified

UniProt A0A287BP93

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Be； UniProt 1–102	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bt 1–102（102 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GB2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 62-meric	Chain Bt 1–102（102 aa）	Not recorded	MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bt 1–102（102 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bt 1–102（102 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bt 1–102（102 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bt 1–102（102 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bt 1–102（102 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bt 1–102（102 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bt 1–102（102 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Be 1–102（102 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A287BP93_PIG
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain Be； PDBConstruct 1–102； UniProt 1–102

mL62 (ICT1)

OrganismNot specified

UniProt A0A286ZJR2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bf； UniProt 1–205	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bu 1–205（205 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GB2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 62-meric	Chain Bu 1–205（205 aa）	Not recorded	MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bu 1–205（205 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bu 1–205（205 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bu 1–205（205 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bu 1–205（205 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bu 1–205（205 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bu 1–205（205 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bu 1–205（205 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bf 1–205（205 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A286ZJR2_PIG
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain Bf； PDBConstruct 1–205； UniProt 1–205

mL64

OrganismNot specified

UniProt A0A286ZXA6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bg； UniProt 1–222	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bv 1–222（222 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GB2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 62-meric	Chain Bv 1–222（222 aa）	Not recorded	MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bv 1–222（222 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bv 1–222（222 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bv 1–222（222 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bv 1–222（222 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bv 1–222（222 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bv 1–222（222 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bv 1–222（222 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bg 1–222（222 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A286ZXA6_PIG
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain Bg； PDBConstruct 1–222； UniProt 1–222

Mitochondrial ribosomal protein S18A

OrganismNot specified

UniProt F1RRH6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bh； UniProt 1–196	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4V1A Structure of the large subunit of the mammalian mitoribosome, part 2 of 2 Deposited 2014-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain x 1–196（196 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain Bx 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bx 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GB2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 62-meric	Chain Bx 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bx 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bx 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bx 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bx 1–196（196 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bx 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bx 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bh 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

11 other PDB entries and 11 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1RRH6_PIG
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain Bh； PDBConstruct 1–196； UniProt 1–196

39S ribosomal protein S30, mitochondrial

OrganismNot specified

UniProt A0A480QIM3

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bi； UniProt 1–433	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bw 1–433（433 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bw 1–433（433 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bw 1–433（433 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bw 1–433（433 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bw 1–433（433 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bw 1–433（433 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bw 1–433（433 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bi 1–433（433 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

8 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A480QIM3_PIG
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain Bi； PDBConstruct 1–433； UniProt 1–433

39S ribosomal protein L1, mitochondrial

OrganismNot specified

UniProt A0A287AF82

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bj； UniProt 1–304	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bj 1–304（304 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A287AF82_PIG
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain Bj； PDBConstruct 1–304； UniProt 1–304

Ribosomal protein

OrganismNot specified

UniProt A0A287A731

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bl； UniProt 1–100	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain B9 1–100（100 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GB2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 62-meric	Chain B9 1–100（100 aa）	Not recorded	MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain B9 1–100（100 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain B9 1–100（100 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B9 1–100（100 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B9 1–100（100 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain B9 1–100（100 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain B9 1–100（100 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bl 1–100（100 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

9 other PDB entries and 9 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A287A731_PIG
Isoform	—
PDB entities	41
Chains and sequence ranges	Author chain Bl； PDBConstruct 1–100； UniProt 1–100

Mitochondrial ribosomal protein L37

OrganismNot specified

UniProt A0A287BIV6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bm； UniProt 1–423	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Ba 1–423（423 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GB2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 62-meric	Chain Ba 1–423（423 aa）	Not recorded	MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Ba 1–423（423 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Ba 1–423（423 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Ba 1–423（423 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Ba 1–423（423 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Ba 1–423（423 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Ba 1–423（423 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Ba 1–423（423 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bm 1–423（423 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A287BIV6_PIG
Isoform	—
PDB entities	42
Chains and sequence ranges	Author chain Bm； PDBConstruct 1–423； UniProt 1–423

Mitochondrial ribosomal protein L38

OrganismNot specified

UniProt F1RW03

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bn； UniProt 1–380	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4CE4 39S large subunit of the porcine mitochondrial ribosome Deposited 2013-11-08	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 38-meric	Chain b 1–380（380 aa）	Not recorded	ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2；pH 7.9；20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2 cryo-EM vitrification conditions Cryogen ETHANE；MANUAL BLOTTING FOLLOWED BY MANUAL PLUNGING INTO LIQUID ETHANE	Resolution 4.90 Å
4V1A Structure of the large subunit of the mammalian mitoribosome, part 2 of 2 Deposited 2014-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain b 1–380（380 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain Bb 1–380（380 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bb 1–380（380 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GB2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 62-meric	Chain Bb 1–380（380 aa）	Not recorded	MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bb 1–380（380 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bb 1–380（380 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bb 1–380（380 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bb 1–380（380 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bb 1–380（380 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bb 1–380（380 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bb 1–380（380 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bn 1–380（380 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

13 other PDB entries and 13 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1RW03_PIG
Isoform	—
PDB entities	43
Chains and sequence ranges	Author chain Bn； PDBConstruct 1–380； UniProt 1–380

Mitochondrial ribosomal protein L39

OrganismNot specified

UniProt F1SHP6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bo； UniProt 1–334	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4CE4 39S large subunit of the porcine mitochondrial ribosome Deposited 2013-11-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 38-meric	Chain c 69–337（269 aa）	Not recorded	ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2；pH 7.9；20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2 cryo-EM vitrification conditions Cryogen ETHANE；MANUAL BLOTTING FOLLOWED BY MANUAL PLUNGING INTO LIQUID ETHANE	Resolution 4.90 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bc 1–334（334 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GB2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 62-meric	Chain Bc 1–334（334 aa）	Not recorded	MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bc 1–334（334 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bc 1–334（334 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bc 1–334（334 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bc 1–334（334 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bc 1–334（334 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bc 1–334（334 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bo 1–334（334 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1SHP6_PIG
Isoform	—
PDB entities	44
Chains and sequence ranges	Author chain Bo； PDBConstruct 1–334； UniProt 1–334

Mitochondrial ribosomal protein L40

OrganismNot specified

UniProt A0A286ZP98

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bp； UniProt 1–162	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bd 1–206（206 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GB2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit. Deposited 2018-04-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 62-meric	Chain Bd 1–206（206 aa）	Not recorded	MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bd 1–206（206 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bd 1–206（206 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bd 1–206（206 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bd 1–206（206 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bp 1–162（162 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A286ZP98_PIG
Isoform	—
PDB entities	45
Chains and sequence ranges	Author chain Bp； PDBConstruct 1–162； UniProt 1–162

39S ribosomal protein L41, mitochondrial

OrganismNot specified

UniProt A0A8D1BPA5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bq； UniProt 1–135	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bq 1–135（135 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A8D1BPA5_PIG
Isoform	—
PDB entities	46
Chains and sequence ranges	Author chain Bq； PDBConstruct 1–135； UniProt 1–135

mL42

OrganismNot specified

UniProt A0A287BQA1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Br； UniProt 1–142	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bf 1–142（142 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GB2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 62-meric	Chain Bf 1–142（142 aa）	Not recorded	MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bf 1–142（142 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bf 1–142（142 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bf 1–142（142 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bf 1–142（142 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bf 1–142（142 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bf 1–142（142 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bf 1–142（142 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Br 1–142（142 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A287BQA1_PIG
Isoform	—
PDB entities	47
Chains and sequence ranges	Author chain Br； PDBConstruct 1–142； UniProt 1–142

Large ribosomal subunit protein mL43

OrganismNot specified

UniProt F1S8U4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bs； UniProt 2–159	Non-standard monomer：Yes (specific site not provided by mmCIF)	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4V1A Structure of the large subunit of the mammalian mitoribosome, part 2 of 2 Deposited 2014-09-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain g 1–159（159 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain Bg 1–159（159 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bg 1–159（159 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GB2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit. Deposited 2018-04-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 62-meric	Chain Bg 1–159（159 aa）	Not recorded	MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bg 1–159（159 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bg 1–159（159 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bg 1–159（159 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bg 1–159（159 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bg 1–159（159 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bg 1–159（159 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bg 1–159（159 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bs 2–159（158 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

12 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1S8U4_PIG
Isoform	—
PDB entities	48
Chains and sequence ranges	Author chain Bs； PDBConstruct 2–159； UniProt 2–159

mL44

OrganismNot specified

UniProt F1SR64

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bt； UniProt 1–332	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4CE4 39S large subunit of the porcine mitochondrial ribosome Deposited 2013-11-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 38-meric	Chain h 67–332（266 aa）	Not recorded	ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2；pH 7.9；20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2 cryo-EM vitrification conditions Cryogen ETHANE；MANUAL BLOTTING FOLLOWED BY MANUAL PLUNGING INTO LIQUID ETHANE	Resolution 4.90 Å
4V1A Structure of the large subunit of the mammalian mitoribosome, part 2 of 2 Deposited 2014-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain h 1–332（332 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain Bh 1–332（332 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bh 1–332（332 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GB2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 62-meric	Chain Bh 1–332（332 aa）	Not recorded	MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bh 1–332（332 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bh 1–332（332 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bh 1–332（332 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bh 1–332（332 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bh 1–332（332 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bh 1–332（332 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bh 1–332（332 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bt 1–332（332 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

13 other PDB entries and 13 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1SR64_PIG
Isoform	—
PDB entities	49
Chains and sequence ranges	Author chain Bt； PDBConstruct 1–332； UniProt 1–332

Mitochondrial ribosomal protein L45

OrganismNot specified

UniProt I3LGM5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bu； UniProt 1–306	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bi 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GB2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 62-meric	Chain Bi 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bi 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bi 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bi 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bi 1–306（306 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bi 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bi 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bi 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bu 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	I3LGM5_PIG
Isoform	—
PDB entities	50
Chains and sequence ranges	Author chain Bu； PDBConstruct 1–306； UniProt 1–306

Mitochondrial ribosomal protein L46

OrganismNot specified

UniProt F1SRT0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bv； UniProt 1–279	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4V1A Structure of the large subunit of the mammalian mitoribosome, part 2 of 2 Deposited 2014-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain j 1–279（279 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain Bj 1–279（279 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bj 1–279（279 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GB2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 62-meric	Chain Bj 1–279（279 aa）	Not recorded	MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bj 1–279（279 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bj 1–279（279 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bj 1–279（279 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bj 1–279（279 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bj 1–279（279 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bj 1–279（279 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bj 1–279（279 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bv 1–279（279 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

12 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1SRT0_PIG
Isoform	—
PDB entities	51
Chains and sequence ranges	Author chain Bv； PDBConstruct 1–279； UniProt 1–279

39S ribosomal protein L48, mitochondrial

OrganismNot specified

UniProt A0A480J9Z6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bw； UniProt 1–269	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bk 1–269（269 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bk 1–269（269 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bk 1–269（269 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bk 1–269（269 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bk 1–269（269 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bk 1–269（269 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bk 1–269（269 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bw 1–269（269 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

8 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A480J9Z6_PIG
Isoform	—
PDB entities	52
Chains and sequence ranges	Author chain Bw； PDBConstruct 1–269； UniProt 1–269

39S ribosomal protein L49, mitochondrial

OrganismNot specified

UniProt A0A287A0K2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bx； UniProt 1–166	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	A0A287A0K2_PIG
Isoform	—
PDB entities	53
Chains and sequence ranges	Author chain Bx； PDBConstruct 1–166； UniProt 1–166

Mitochondrial ribosomal protein L50

OrganismNot specified

UniProt I3L9H6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain By； UniProt 1–198	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4V1A Structure of the large subunit of the mammalian mitoribosome, part 2 of 2 Deposited 2014-09-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain m 1–159（159 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain Bm 1–159（159 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bm 1–159（159 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GB2 Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit. Deposited 2018-04-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 62-meric	Chain Bm 1–159（159 aa）	Not recorded	MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bm 1–198（198 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bm 1–198（198 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bm 1–198（198 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bm 1–198（198 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bm 1–198（198 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bm 1–198（198 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bm 1–198（198 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain By 1–198（198 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

12 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	I3L9H6_PIG
Isoform	—
PDB entities	54
Chains and sequence ranges	Author chain By； PDBConstruct 1–198； UniProt 1–198

Large ribosomal subunit protein mL51

OrganismNot specified

UniProt A0A8D1VKN8

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bz； UniProt 1–128	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） P-site Met-tRNA(fMet) × 1 Peptide chain release factor 1, mitochondrial × 1 （O75570） MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bz 1–128（128 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A8D1VKN8_PIG
Isoform	—
PDB entities	55
Chains and sequence ranges	Author chain Bz； PDBConstruct 1–128； UniProt 1–128

Peptide chain release factor 1, mitochondrial

Homo sapiens

UniProt O75570

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 58 RNA 4 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Aa； UniProt 1–445	Not recorded	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） 39S ribosomal protein L49, mitochondrial × 1 （A0A287A0K2） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） P-site Met-tRNA(fMet) × 1 MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8OIQ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Aa 1–445（445 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIP 28S mammalian mitochondrial small ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 33 PDB declaration: 36-meric	Chain Aa 1–445（445 aa）	Not recorded	MG MAGNESIUM ION × 127 SPM SPERMINE × 1 SPD SPERMIDINE × 1 K POTASSIUM ION × 11 ZN ZINC ION × 1 FS2 FE-S-O HYBRID CLUSTER × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIR 55S human mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Aa 1–445（445 aa）	Mutation：311GGQ313 > AAQ	K POTASSIUM ION × 51 MG MAGNESIUM ION × 354 VAL VALINE × 1 ZN ZINC ION × 3 FS2 FE-S-O HYBRID CLUSTER × 3 MET METHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.10 Å
8OIS 28S human mitochondrial small ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 33 PDB declaration: 36-meric	Chain Aa 1–445（445 aa）	Mutation：311GGQ313 > AAQ	K POTASSIUM ION × 17 MG MAGNESIUM ION × 126 MET METHIONINE × 1 ZN ZINC ION × 1 FS2 FE-S-O HYBRID CLUSTER × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
8OIT 39S human mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain Aa 1–445（445 aa）	Mutation：311GGQ313 > AAQ	K POTASSIUM ION × 34 MG MAGNESIUM ION × 228 VAL VALINE × 1 ZN ZINC ION × 2 FS2 FE-S-O HYBRID CLUSTER × 1 MET METHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 2.90 Å

5 other PDB entries and 5 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RF1M_HUMAN
Isoform	—
PDB entities	57
Chains and sequence ranges	Author chain Aa； PDBConstruct 1–445； UniProt 1–445

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8oiq
Deposition date deposition_date	2023-03-23
Structure title title	39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA
Keywords keywords	mammalian mitochondrial ribosome, release factor mtRF1, non-canonical stop codon, RIBOSOME; RIBOSOME
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	76.89 Å
Radius of gyration Rg (electron density) rg_electron	80.83 Å
Forward intensity I(0) i0	57798000000.00
Molecular weight molecular_weight	1640600.0 kDa
Excluded volume excluded_volume	1883500 Å³
Envelope volume envelope_volume	3166400 Å³
Hydration-shell volume shell_volume	303400 Å³
Envelope diameter envelope_diameter	309.5 Å
Shell Rg shell_rg	90.93 Å
Envelope Rg envelope_rg	81.36 Å
Shape Rg shape_rg	81.05 Å
Total Rg total_rg	80.31 Å
Total atoms total_atoms	112965
Residues n_residues	11086
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	200.4 Å
Rg (real space) rg_real	74.09 Å
Rg uncertainty (real space) rg_real_error	0.40 Å
I(0) (real space) i0_real	5.5790e+10
I(0) uncertainty (real space) i0_real_error	9.2980e+08
Rg (reciprocal space) rg_reciprocal	77.20 Å
I(0) (reciprocal space) i0_reciprocal	57840000000.0000
Solution quality estimate total_estimate	0.8985
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	90.2 Å
Skewness Skewness skewness	0.213
Kurtosis Kurtosis kurtosis	-0.468
Angular range angular_range	— – 0.1000 Å⁻¹
Current regularization parameter α current_alpha	0.2132
Highest regularization parameter α highest_alpha	4678000000.0000
Real-space data points n_real_points	21
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.001; Oscil: 0.971; Stabil: 0.987; Sysdev: 1.000; Positv: 1.000; Valcen: 0.978; Smooth: 0.007

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (63)

Entity 1 Entity 1 polymer

Description description	Mitochondrial ribosomal protein L12
Molecular weight formula_weight	21269.0 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B1,B2,B3,B4,B5,B6
Atom count atom_count	112981

MLPAAASSLWGPCFGLRAAALRVARHQGPRLCGVRLMRCSSHRKGEALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGFMPMGAVAPGAPPAAAAPEAAEEDLPKRKEQTHFTVRLTEAKPVDKVKLIKEIKSHIQGINLVQAKKLVESLPQEIKANVPKAEAEKIKAALEAVGGTVVLE

Entity 2 Entity 2 polymer

Description description	E-site tRNA
Molecular weight formula_weight	894.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	B7

CCA

Entity 3 Entity 3 polymer

Description description	16S rRNA
Molecular weight formula_weight	504908.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	B8

ACCAAAGCUAGCUCAACAUACUAAACAAAUACAAAAAUACACCAAAAUAAAAUAAAACAUUCACCUAACAUUAAAGUAUAGGAGAUAGAAAUUUUUAUCCUGACGCUAUAGAGAUAGUACCGUAAGGGAAAGAUGAAAGAAUAAAAUAAAAGUAAAAAAAAGCAAAGAUUACCCCUUCUACCUUUUGCAUAAUGGUUUAACCAGAAAAAAUCUAACAAAGAGAACUUUAGCUAGAUACCCCGAAACCAGACGAGCUACCCAUGAGCAGUUUAAAAGAACCAACUCAUCUAUGUGGCAAAAUAGUGAGAAGACUUGUAGGUAGAGGUGAAAAGCCUAACGAGCCUGGUGAUAGCUGGUUGUCCGAGAAAGAAUUUUAGUUCAACCUUAAAAAUACCCCAAAAACCCUAAAUUCCAAUGUAUUUUUAAGAGAUAGUCUAAAAAGGUACAGCUUUUUAGAAACGGAUACAACCUUGACUAGAGAGUAAAAUCUUAAUACUACCAUAGUAGGCCUAAAAGCAGCCAUCAAUUGAGAAAGCGUUAAAGCUCAACAAAUUCACCAACAUAAUCCCAAAAACUAAUAACAAACUCCUAGCCCAAUACCGGACUAAUCUAUUGAAACAUAGAAGCAAUAAUGUUAAUAUGAGUAACAAGAAGCCUUUCUCCUCGCACACGCUUACAUCAGUAACUAAUAAUAUACUGAUAAUUAACAACCAAUAAACCAAAACAACACUAAAACGUUUAUUAAUUACAUUGUUAACCCAACACAGGAGUGCACCAAGGAAAGAUUAAAAGAAGUAAAAGGAACUCGGCAAACACAAACCCCGCCUGUUUACCAAAAACAUCACCUCUAGCAUUACUAGUAUUAGAGGCAAUGCCUGCCCAGUGACACCAGUUUAACGGCCGCGGUAUUCUGACCGUGCAAAGGUAGCAUAAUCACUUGUUCUCCAAAUAAGGACUUGUAUGAAUGGCCACACGAGGGUUUUACUGUCUCUUACUUCCAAUCAGUGAAAUUAACCUUCCCGUGAAGAGGCGGGAAUAAAAAAAUAAGACGAGAAGACCCUAUGGAGCUUUAAUUAACUAUUCCAAAAGUUAAACAACUCAACCACAAAGGGAUAAAACAUAACUUAACAUGGACUAGCAAUUUCGGUUGGGGUGACCUCGGAGUACAAAAAACCCUCCGAGUGAUUUUAAUCUAGACAAACCAGUCAAAAUAACCAUAACAUCACUUAUUGAUCCAAAAUUUUGAUCAACGGAACAAGUUACCCUAGGGAUAACAGCGCAAUCCUGUUCUAGAGUUCCUAUCGACAAUAGGGUUUACGACCUCGAUGUUGGAUCAGGACACCCAAAUGGUGCAACCGCUAUUAAAGGUUCGUUUGUUCAACGAUUAAAGUCCUACGUGAUCUGAGUUCAGACCGGAGCAAUCCAGGUCGGUUUCUAUCUAUUAUAAAUUUCUCCCAGUACGAAAGGACAAGAGAAAUGGGACCAACCUCACAAACGCGUCUCAGAGAUAAUUAAUGAUUUAAUCUUAACCUAAUUAACUCAUAAUAAAUCCAGCCCUAGAACAGGGCACA

Entity 4 Entity 4 polymer

Description description	CP Phe-tRNA
Molecular weight formula_weight	23516.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	B9

GUUAAUGUAGCUUAAAUUAUCAAAGCAAGGCACUGAAAAUGCCUAGAUGAGCCUCACAGCUCCAUAAACACCA

Entity 5 Entity 5 polymer

Description description	Large ribosomal subunit protein uL22m
Molecular weight formula_weight	24313.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BA

MAAAVLERLGGLWMQNLRGKLALRLLSSHSILPQSHIHTSASVEISRKWEKKNKIVYPPQLPGEPRRPAEIYHCRRQIKYSKDKMWYLAKLIRGMSIDQALAQLEFSDKKGAQIIKEVLLEAQDMAVRDHNVEFRSNLYVAESTSGRGQYLKRIRYHGRGRFGIMEKVFCHYFVKLVEGPPPPREAPKTAVAHAREYIQELRNRTITHAL

Entity 6 Entity 6 polymer

Description description	39S ribosomal protein L23, mitochondrial
Molecular weight formula_weight	17685.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BB

MARNVLYPLYQLGNPQLRVFRTNFFIQLVRPGTAQPEDTVQFRIPMEMTRVDLRNYLERIYNVPVAAVRTRVQYGSNRRRDHRNIRIKKPDYKVAYVQLALGQTFTFPDLFPERKGASVDVDVRDQVLEDQRQKHSPDPRRGGVPGWFGL

Entity 7 Entity 7 polymer

Description description	uL24m
Molecular weight formula_weight	24893.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BC

MRLSALLALASKVTLPPNYRYGMSRPGSLSDKRKNPPGTRRRRVPVEPISDEDWHLFCGDKVEILEGKDAGKQGKVVQVIRQRNWVVVEGLNTHYRYVGKTVDYRGTMIPSEAPLLHNQVKLVDPTDRKPTDVEWRFTEAGERVRVSTRSGRIIPKPEFPRADGIVPETWIDGPKDTSVEDALEKTYVPRLKTLEEEVMEAMGIQETRRHKKVYWY

Entity 8 Entity 8 polymer

Description description	39S ribosomal protein L27, mitochondrial
Molecular weight formula_weight	15943.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BD

MALAVLALRTRAAVTALLSPPQAAALAVRYASKKTGGSSKNLGGKSPGKRFGIKKMEGHYVHAGNILATQRHFRWHPGAHVGLGKNKCLYALEEGVVRYTKEVYVPNPSNSEAVDLVTRLPQGAVLYKTFVHVVPAKPEGTFKLVAML

Entity 9 Entity 9 polymer

Description description	Mitochondrial ribosomal protein L28
Molecular weight formula_weight	30149.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BE

MPLHKVPVGLWKQLRLWEGIYSRLPRHYLRSLEEARTPTPVHYRPHGAKFKINPKNWQRERVEDVPIPVHYPPESQLGLWGGEGWVLGHRYVNNDKLSKRVRKVWKPQLFQRELYSEILDKRFTVTVTMRTLDLIDQACGFDFYILKTPKEDLCSKFGMDLKRGMLLRLARQDPQLHPDDPARRAAIYDRYKAFVIPEAEAEWVGLTLDEAVEKQRLLEEKDPIPLFKIFVEELLGQLQQQALSEPAVVQTRASRK

Entity 10 Entity 10 polymer

Description description	Mitochondrial ribosomal protein L47
Molecular weight formula_weight	29894.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BF

MAAAGLAVFCRRVSAALKACRLLIRPQAPPSTRFSPSLLPKNTPNVTSFHQFRIFHTTFSRRGLEEFFDDPKNWGEEKVKSGASWTCQQLRNKSNEDLHKLWYVLLKERNMLLTLEQEAKRQRLPMPSPERLEKVVDSMDALDKVVQEREDALRLLQTGQEKARPGAWRRDIFGRIIWHKFKQWPIPWYLNKKYNRKRFFAMPYVERFVRMRIEKQARIKARKRSLERKKEKFLQEKFPHLSETQKSSHV

Entity 11 Entity 11 polymer

Description description	Large ribosomal subunit protein uL30m
Molecular weight formula_weight	18921.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BG

HPPRQDFLVRRQPHRNRTVTKGMESLICTDWIRHKFTRSRIPDKVFQPSPEDHEKYGGDPQYPHKLHIVTRIKSTKRRPYWEKDIIKMLGLEKAHTPQVHKNIPSVNAKLKVVKHLIRIKPLKLPQGLPTEEDMANTCLKSNGELVVRWLLNPANQEARKS

Entity 12 Entity 12 polymer

Description description	Mitochondrial ribosomal protein L32
Molecular weight formula_weight	23567.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BH

MLEVGVGPRPDGRGFWASNMASAMLVLVVPPWPAARGLLRNWWEQLQRKLQHNRLGLPLHPWGPALAVQGPAICTEPANDTNGSKAISSLLDSVFWMAAPKNRRSIEVNRCRRRNPQKLIKVKNNIDVCPECGHLKQKHILCGYCYEKVRKETAEIRRQMGKQEGGPFRAPTTETVVLYSGETPSEQDQGKRIIERERKRPSWFTQN

Entity 13 Entity 13 polymer

Description description	Large ribosomal subunit protein bL33m
Molecular weight formula_weight	7508.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BI

MFLSAVTFAKSKSKTILVKMMSQAGTGFSFNTKRSRLREKLTLLHYDPVVKKKVLFVEQKKIRSL

Entity 14 Entity 14 polymer

Description description	Large ribosomal subunit protein bL34m
Molecular weight formula_weight	10871.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BJ

MAFLARSVGRLLDPVSRSAALVGGRWLQPQAWLGFPDTWGLPAMQQTRGKARGNEYQPSNIKRKHKHGWVRRLRTPTGVQVILRRMHKGRKSLSH

Entity 15 Entity 15 polymer

Description description	39S ribosomal protein L35, mitochondrial
Molecular weight formula_weight	21548.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BK

MAASAFAGAVRAATGILRPLHILASSAYQNCAKNACLSSVLSSRHFSHIQTSALLSAPRLITSVRNLMCGPTAPVLNRVAPLLPHVLKPPVRTVTYFSSRKGKRKTVKAVIYRFLRLHSGLWLRRKAGYKKKLWKKTAARKRRLREFVFCNKTQSKLLDKMTTSFWKRRNWYADDPYQKYQDRTNLKV

Entity 16 Entity 16 polymer

Description description	Mitochondrial ribosomal protein L2
Molecular weight formula_weight	33270.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BL

MALRVLTRALSSLSLTPRIAVAPGLNLLPAVQVTNNVLLTLPSGLMSLPCRPILTSVALSATSVSWKSRTKYTVMPVKMRKSGGRNHTGQIQVHGIGGGHKQRYRMIDFLRFRPEHESKPGPFEEKVIAVRYDPCRSADIALVAGGNRKRWIIATENMKAGDTVLNSDHIGRMAVAAREGDAHPLGALPVGTLINNVESEPGRGAQYIRAAGTCGVLLRKVNGTAIIQLPSKRQMQVLETCIATVGRVSNVDHNKRVIGKAGRNRWLGKRPNSGLWQRKGGWAGRKIRPLPPMKSYVKLPSAAAQS

Entity 17 Entity 17 polymer

Description description	ICT1
Molecular weight formula_weight	43708.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BM

MAPAALLPSWGQRGAAAGGGGKAWEGRRRNALKAEWRGAQRCSGRALLGLTMPGWGLLGRAGARVLGCGADGLGASRGLGNRTDICLLVRSLHGKSVTWWDEHLSEENVPFVKQLVSDENKAQLASKLCPLKDEPWPIHPWEPGSSRVGLIALKLGMMPLWTKDGQKHVVTLLQVQDCHVLKYTPKENHNGRMAALTVGGKTVSHFHKSASILEFYQELGLPPKQKVKIFNVTENAVIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMRRWGFKGQPATHGQTKTHRRPGAISTGDVARVWPGTKMPGQLGNIDRTAFGLKVWRINTKHNIIYVNGSVPGHKNCLVKIKDSKLPAYKDFCKNLPFPTYFPDGDEEALPEDLYDENVCQPGAPSITFT

Entity 18 Entity 18 polymer

Description description	Mitochondrial ribosomal protein L4
Molecular weight formula_weight	33251.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BN

MLQLVRAGARTWFRPSGCRGLNTLAEEAVQQAEKPESVASLGLQPPVLRKCELPVPAHRRPVQAWIESLRGYEQERVGLTELHPDVFSTAPRLDILHQVAIWQKNFKRISYAKTKTRAEVRGGGRKPWVQKGSGRARHGSIRSPIWRGGGVAHGPRGPTSYYYMLPMKVRVQGLKVALTVKLAQDDLHIVDSLELPTADPQYLIELARYRRWGDSVLLVDLEHEDMPQNVVAATSGLKTFNLVPAVGLNVHSMLKHQTLVLTLPTVAFLEEKLLWHNSRYTPLYPFRLPYCDFP

Entity 19 Entity 19 polymer

Description description	Mitochondrial ribosomal protein L9
Molecular weight formula_weight	30373.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BO

MAAAACTAAGGGLLRAGLERLLRGGVRALLRPRLEGVTPRSERAFSLSLSRSTVIVERWWKVPLAGEGRKPRLHRRHRVYKLVEDTKHRPKDNLELVLTQSVEELGVRGDLVSVKKSVGRNRLLPQGLAVYASPENKKLFEEEKLLRQEGKLEKLQTKAGEATVKFLRRCHLEVGMKNNVKWELNPEIVARHFLRNLGVVVAPHALKLPEEPITQRGEYWCEVTVNGLDTVRVPMSVVNFERPKTKRYKYWLAQQAAKGDVPTSSQMI

Entity 20 Entity 20 polymer

Description description	Mitochondrial ribosomal protein L10
Molecular weight formula_weight	29238.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BP

MSSQAFRRHPPQGRLPTFQTVRYGSKAVTRHRRVMHFERQKLMAVTEYIPPKPTINPRCLPPPPTPPQEETGLVRLLRREIAAVFRDNRMIAVCQHVALSAEDKLLLRHQLRKHKILMKIFPNQVLKPFLEESKYQNLLPLFVGHNLLLVSEEPKVKEMVRILKGIPFLPLLGGCIDDTILSRQGFINYSKLPSLALVQGELVGGLTFLTAQTYSMLQHQPRQLTALLDQYVKQQQEGHPAVPASGQPEPPDPVPDP

Entity 21 Entity 21 polymer

Description description	Mitochondrial ribosomal protein L11
Molecular weight formula_weight	20809.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BQ

MSKLSRATRALKKPEASGMIRAIVRAGQARPGPPLGPILGQRGVSINQFCKEFNEKTKDIKEGIPLPTKIFVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARHTGKEVAGLVTLKHVYEIARVKAQDDAFALQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAAFQKERALFLAAQREADLAAQAEAAKK

Entity 22 Entity 22 polymer

Description description	39S ribosomal protein L13, mitochondrial
Molecular weight formula_weight	22988.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BR

MRRDTSWILRKGRSCCWGNMSSFSKAPQQWATFARVWYLLDGKMQPPGKLAAMASVKLQGLHKPVYHQLSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHQKDPVAIVKLAIYGMLPKNLHRRTMMQRLHLFPDEDIPEDILKNLVEELPQPRKVPRRLDEYTQEEIEAFPRVWSPPEDYRL

Entity 23 Entity 23 polymer

Description description	Mitochondrial ribosomal protein L14
Molecular weight formula_weight	34796.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BS

MVRGWGQRPAPLGPAGPGTSGSRRRLKGGDAQPSPGFFFGWWWDPQRKERGPGKGRVLTPRRRLGSSSEPRVGAGRGWGRGRGSRWAARAPGSCGGRGCVWGRGSGRREGEEEGRGHEGPTPHASSRKARAHSQIAARPAGSDAQAQDYRPRGGEGGPGPVGPAAGYSRAAKAGLPSRDCMAFCTGLRGPFAQVSRALSQRCFSTTGSLSAIQKMTRVRVVDNSALGTTPYHRPPRCIHVYNKTGVGKVGDRILLAIRGQKKKALIVGHRMPGPRMTPRFDSNNVVLLEDNGNPVGTRIKTPIPSSLRQREGEFSKVLAIAQNFV

Entity 24 Entity 24 polymer

Description description	39S ribosomal protein L15, mitochondrial
Molecular weight formula_weight	33481.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BT

MGGPVQGGGPRALDLLRALPRVSLANLKPNPGSRKPERRPRGRRRGRKCGRGHKGERQRGTRPRLGFEGGQTPFYLRIPKYGFNEGHSFRHQYQPLSLNRLQYLIDLGRVDPTQPIDLTQLVNGRGVTIQPSKRDYGVQLVEEGADTFKAKVNIEVQMASELAIAAIEKNGGVVTTAFYDPRSLEILCKPVPFFLRGQPIPKRMLPPEALVPYYTDAKNRGYLADPARFPEARLELARKYGYVLPDITKDELFKMLSTRKDPRQIFFGLAPGWVVNMADKKILKPTDENLLKYYSS

Entity 25 Entity 25 polymer

Description description	uL16m
Molecular weight formula_weight	28680.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BU

MWRLLARACAPLLRAPLSDSWAAPSATAGFKTLLPVPTFEDVAIPEKPKLRFVERVPLVPKVRRERKNLSDIRGPSTEATEFTEGRFAILALGGGYLHWGHFEMMRLTINRSMDPKNMFALWRVPAPFKPITRKGMGQRMGGGKGAIDHYVTPVKAGRLIVEMGGRCEFKEVQGFLDLVAHKLPFPAKAVSRETLEKMRKDQEERERNNQNPWTFERIATANMLGIRKVLSPYDLTHKGRYWGKFYTPERV

Entity 26 Entity 26 polymer

Description description	bL17m
Molecular weight formula_weight	19268.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BV

MRLSVAAAISHGRVFRRLGLGPESRIHLLQNLLTGLVRHERIEASWARVDELRGYAEKLIDYGKLGDTNERAMRMADFWLTEKDLIPKLFQVLAPRFQGQNGGYTRMLQIPNRNEQDRAKMAVIEYKGNCLPPLPLPRRDSNLTLLNQLLQGLRQDQEASSHTAQTPAV

Entity 27 Entity 27 polymer

Description description	Mitochondrial ribosomal protein L18
Molecular weight formula_weight	21422.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BW

MVLRSSVPLKQVAHARLHFLVPSRKGCRAAALSTSCKPATNPETDPVENEAVAPEFTNRNPRNLELLAVARKERGWGTVWPSREFWHRLRVIRTQHHIEALVEHRNGQVVVSASTREWAIKKHLYSTRNVVACESVGRVLAERCLEAGINFMVYHPTPWEAASDSIKRLQHAMTEGGVVLREPRRIYE

Entity 28 Entity 28 polymer

Description description	39S ribosomal protein L19, mitochondrial
Molecular weight formula_weight	34528.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BX

MGVVVSTQRAGMAASITRGSWAAVGLGQSFPPTRALLPAPASVICRTLAGSGRQQVTGSSEPGAFQPPPKPVIVDKRRPQRPETRFLSPEFIPPRGRTNPLKFQIERKDMLERRKILHIPEFYVGSILRVTTADPYASAKTSQFLGICIQRSGSGLGATFILRNTIEGQGVEICFELYNPRIQEIQVVKLEKRLDNSLLYLRDALPEYSTFDVNMKPITQEFNQEVPVNQLKVKMKPKPWSKRWERPKFNIKGIRFDLCLTEEQMREAQKWSQPWLEFDMMREYDTSKIEAAIWDEIEASKNS

Entity 29 Entity 29 polymer

Description description	Mitochondrial ribosomal protein L20
Molecular weight formula_weight	17554.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BY

MVFLTVPLWLRSRVTDRYWRVQEVLKHARHFRGRKNRCYRLAVRAVTRAFVKCTRARRLKKRSLRTLWINRITAASQEHGLKYPAFIINLIKCQVELNRKVLADLAIYEPKTFKSLAALAKRRREEGFAAALGDGKEPDGIFSRVVQHR

Entity 30 Entity 30 polymer

Description description	Mitochondrial ribosomal protein L21
Molecular weight formula_weight	23154.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BZ

MAAAVAASVLQGTFGRLVSAYSRSVLRTSRPGTAPPWSAPRRLSSQHTSSLRGCVPKTSLGSPPWPDIVLPDPVEETRHHAEVVGQVNELIAAGRYGRLFAVVHFAGHQWKVTAEDLILIENELDVACGERIRLEKVLLVGADNFTLLGKPLLGKELVRVEATVIEKTESWPKINMKFQKRKNYQRKRITVNPQTVLRINSIEIAPCLC

Entity 31 Entity 31 polymer

Description description	39S ribosomal protein L52, mitochondrial
Molecular weight formula_weight	17989.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ba

MAGPVIENQIQDGYFRLPPQRPAWPSRPRPFPALRLSMAAWGILLSSVRRLHCGTAAQAGSQWRLQQGFAANPSGYGPLTELPDWSYADGRPAPPMKGQLRRKAQREKFARRVVLLSQEMDAGLQAWQLRQQEKLQEEEGKQKNALKSKGALLQNPQPSQ

Entity 32 Entity 32 polymer

Description description	Mitochondrial ribosomal protein L53
Molecular weight formula_weight	12057.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bb

MAAALARLGLRAVKQVRVQFCPFEKNVESTRTFLQAVSSEKVRCTNLNCSVIADVRHDGSEPCVDVLFGDGHRLIMRGAHLTAQEMLTAFASHIQARGAAGSGDKPSASTGR

Entity 33 Entity 33 polymer

Description description	mL54
Molecular weight formula_weight	15957.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bc

MAARRLFGAARSWAAWRAWELSDAAVSGRLHVRNYAKRPVIKGGKGGKGAVVGEALKDPEVCTDPFRLTTHAMGVNIYKEGQDVVLKPDSEYPEWLFEMNVGPPKKLEELDPETREYWRLLRKHNIWRHNRLSKNRKF

Entity 34 Entity 34 polymer

Description description	Mitochondrial ribosomal protein L55
Molecular weight formula_weight	15156.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bd

MAAKGSLLRLLWQRVVTGAAPESCRHLYTSSWRADCNRALLTRLHRQTYARLYPVLLVKQDGSTIHIRYREPRRMLTMPVDLDSLSPEERRARFRKREAKFKEKKEEPELSDDFDVEQYKRFWTKK

Entity 35 Entity 35 polymer

Description description	Mitochondrial ribosomal protein L57
Molecular weight formula_weight	12001.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Be

MFLTALLRRNRIPGRQWIGKHRRPRPVSAQAKQNMIRRLETEAENQYWLSRPFLTAEQERGHAAVRRAAAFQALKAAQAARFPAHRRLEEQLGHLLVTRKWS

Entity 36 Entity 36 polymer

Description description	mL62 (ICT1)
Molecular weight formula_weight	23545.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bf

MAAARCLRWGLNRAGAWLLPSPTRYPRRALHKQVEGTEFQSIYSLDKLYPESRGSDTAWRLPDDAKQANDIPVDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLASADWIAEPVRLKLAVKHKNRINRSGELILTSECSRYQFRNLADCLQKLRDMIAEASQPAKEPSREDAELRRSRIENMNRERLRKKRISSAIKTSRRVDVD

Entity 37 Entity 37 polymer

Description description	mL64
Molecular weight formula_weight	25815.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bg

MAAPVQQARTLLRLVTTLGQGSRGYRARPPPRRSQEPRWPDPDDPLTPRWQLSPRYAAKQFARHGAASGVAAGSLWPSQEQLRELEAEEREWYPSLAAMQESLRVQQLAEEQKRQAREQLIEECMAKMPQMIENWRQQQQERREKEQADKDRRARLQAEAQERLGYHVDPRSARFQELLQDMEKQHRKRLKEEKQRKKKEARAAAMAAAAAQDPADSETPSS

Entity 38 Entity 38 polymer

Description description	Mitochondrial ribosomal protein S18A
Molecular weight formula_weight	22273.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bh

MVGLNVLVSGCGRLLRGLLAGPAATSWARPPSRGFREVVEILDGKTTIIEGRITETPQESPNPPNPTGQCPICRWNLKHKYNYEDVLLLSQFIRPHGGMLPRRITGLCQEEHLKIEECVKMAHRAGLLPNHRPKLPEGFVPKSKPRLNRYLTRWSPRSVKPIYNKGHRWNKVRMPVGSPLLKDNVSYSGRPLLLYH

Entity 39 Entity 39 polymer

Description description	39S ribosomal protein S30, mitochondrial
Molecular weight formula_weight	49100.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bi

MAAARCWRFPLRGAGLSLHTAAKAAVTAPEVTGPDVPATPVARYPPIVASLTAKSKAARQRRVEQWQATVHAAKSVDEKLRILTKMQFMKYVVYPQTFALNADNWYQSFTKTVFLSGLPPTPAKLEPEPTLDITALREAVCDCLLQEHFFLRRKKRAPVIQDREAIASPFLDQLVASLTGLLSVHNPVLAAAALDCKRPVHFFWLRGEEIIPRGHRKGRVDALRYQINDKPHNQIRISRQLPEFVPLDYSIPIEVPVMSCKPDKLPLFKRQYENTIFIGSKTADPLCYGHTQFHLLPDKLKREKLLKQNCADQIEVVFRANAIASLFAWTGAQAMYQGFWSEADVTRPFVSQGVITDGKYFSFFCYQLNTLALTAQADQNNPRKNICWGTQSKPLYETIEDNNVKGFNDDVLLQLVQFLLNRPKEDKSQLLEN

Entity 40 Entity 40 polymer

Description description	39S ribosomal protein L1, mitochondrial
Molecular weight formula_weight	34372.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bj

MVSQMPLYPRSVYIQLPNRHFAAAATKPAKKTQKGAKGKASDEKKDDIEKIKSYPFMEGEPEDDVYLKRLYPRQIYEVEKAIHLLKKFQVLDFTNPNQGVYLDLTLDMTLGKKKKVEPFASVLSLPYPFTSEINKVAVFTGNASEIKIAEEKGAAFAGGTNLIQKILDDEIQPDFYVAVPEIMPELNPLRKKLKKRFPKLTRNSIGRDIPKMLELFKTGHEIKVDEERENFLETKIATLNMSSDQIAANLQAVINEVCRQRPLNLGPFVVRAFLRSSTSEGLLIKIEPLLPKEVEAKESGTLTA

Entity 41 Entity 41 polymer

Description description	Ribosomal protein
Molecular weight formula_weight	10841.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bl

MATAFLRTVLSAVGPLLHLGGRPLSTFAAGPPRAALAVGAQPSPAAALLSARPLLGPQPALGFKTKGVLKKRCRDCYLVKRRGRWFIYCKTNPKHKQRQM

Entity 42 Entity 42 polymer

Description description	Mitochondrial ribosomal protein L37
Molecular weight formula_weight	47918.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bm

MALASGPARRALARLGRLGLGGCGAPRRGAYEWGVRSTRKPEPPPLDRVYEIPGLEPITYAGKMHFMPGLARPVFPPWDPGWTHPKFRRLPPLHEHPLYKDQACYVFHQRCRLLEGVKQALWLTKTQLIEGLPEKVLRLADDPRNHIENQDERVLNAISHARLWHSTEDIPKRETYCPVIVDSLIQLCKSQILKHPSLARRICAQNNTLSATWNRESILLQVHGSSGARLNAKDPLPPVASQEEVEATKNHVLETFYPISPTMGLQECNVYDVNDDTGFQEGYPYPCPHTLYFLESANLRPRRFQPDQLRAKMILFAFGSALAQARLLYGNDSKVLEQPVVVQSVGTDGRLFQFLVLQLNTTDLASDEGVKNLAWVDSDQLLYQHFWCLPVIKKKVVVEPVGPIGFQPETFRKFLALYLHGAV

Entity 43 Entity 43 polymer

Description description	Mitochondrial ribosomal protein L38
Molecular weight formula_weight	44656.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bn

MAAPWWRAALCASRRWRGFSTSAALSRRAAPLGPMPNEDIDVSDLERLKKYRSFDRYRRRAEQEARKPHWWRTYREHFGEESGPKDRVDIGLPPPKVSRTQQLLERKQALRELRANVEEERAARLQTARIPLEAVRAEWERTCGPYHKQRLAEYCGLYRDLFHGATFVPRVPLHVAYAVGEDDLMPVYHGNEVTPTEAAQAPEVTYEADEGSLWTLLLTNLDGHLLEPDAEYVHWLVTNIPGNRVTEGQETCPYLPPFPARGSGFHRFAFLLFKQDKRIDFSGDTRPSPCYQLAQRTFHTFDFYKKHQDAMTPAGLAFFQCRWDDSVTRVFHQLLDMREPVFEFVRPPPYHPKQKRFPHRQPLRYLDRYRDSHEPTYGIY

Entity 44 Entity 44 polymer

Description description	Mitochondrial ribosomal protein L39
Molecular weight formula_weight	38523.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bo

MAMGAWGLRLWRAVPRGEAGWRLIATSPASQLSPTELIEMQNDLFNKEKNRQLSLTPRTEKIEVKHVGKTDPGTVFVMNKNISTPYSCAMHLSEWYCRKSILALVDGQPWDMYKPLTKSCEIKFLTFKDDDPGEVNKAYWRSCAMMMGCVIERAFKDEYVVSLVRAPEVPVIAGAFCYDVVLDKRLDEWMPTKENLHSFTKDARALIYKDLPFETLEVEAKVALEIFQHNKYKLDFIEEKASQNPERIVKLHRFGDFIDVSEGPLIPRTSICFQYEVSAVHNLQTQSSLVRRFQGLSLPVHLRAHFTIWNKLLERSRKMVTEDKTKPTEESAST

Entity 45 Entity 45 polymer

Description description	Mitochondrial ribosomal protein L40
Molecular weight formula_weight	19406.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bp

MRAEPLRKKKKVDPKKDQAAKDRLKKRIRRLEKASQELIPIEDFITPVKFLNKERQRPPVELPFEESERRALLLKRWSLYKQREHEMERSAIRSLLEAQEEALQELRLSSPELHAEATKRDPSLFPFERQGPDYTPPISDYQPPEGRYQDITKVYTQVEFKK

Entity 46 Entity 46 polymer

Description description	39S ribosomal protein L41, mitochondrial
Molecular weight formula_weight	15073.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bq

MGLLSGAARALVRGADRMSKWTSKRGPRTFCKGRGAKGTGFHGRDGKFVQIKEMIPELVVPELAGFKLKPYVNYRAPEGTDTPLTAKQLFLETAAPAIEKDFKAGTFDPEHLEKYGFEPTQEGKLFQLYPKNFPR

Entity 47 Entity 47 polymer

Description description	mL42
Molecular weight formula_weight	16680.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Br

MALAAVKWVISSRTILKHLFPIQNSASYCVCHKSTYSSLPDDYNCKVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNIEETHDLVLKTRLEEKGEHLEQGPMIEQLSKMFFTTKHRWYPRGQYHRRRRKPNPPKDR

Entity 48 Entity 48 polymer

Description description	Large ribosomal subunit protein mL43
Molecular weight formula_weight	17623.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bs

XTARGTASRFLTSVLHNGLGRYVQQLQRLSFSLSRDAPSSRGAREFVEREVTDFARRNPGVVIYVNPRPCCVPRVVAEYLNGAVREESIHCKSVEEIAALVQKLADQSGLDVIRIRKPFHTDSPSIQGQWHPFTNKPTTLGGLRPREVQDPAPAQVQAQ

Entity 49 Entity 49 polymer

Description description	mL44
Molecular weight formula_weight	37527.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bt

MASGLVRLLQWGPRRLLAPAAPTLAPPVRGAKKGFRAAYRFQKELERWRLLRCPPPPVRRSEKPNWDYHAEIQAFGHRLQETFSLDLLKTAFVNSCYIKSEEAKRQKLGIDKEAALLNLKDNQELSEQGISFSQTCLTQFFEDAFPDLPTEGVTSLVDFLTSEEVVCHVARNLAVEQLALSAEFPVPPPVLRQTFFAVIGALLQSSGPERTALFIRDFLITQMTGKELFEMWTITNPMGLLVEELKKRKISAPESRLTRQSGSTTALPVYFVGLYCDRKLIAEGPGETVLVAEEEAARVALRKLFGFTENRRPWDYSKPKEHVRAEKTITAS

Entity 50 Entity 50 polymer

Description description	Mitochondrial ribosomal protein L45
Molecular weight formula_weight	35331.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bu

MAAPVTRGLSCLPRVLGWWSRQPVLVTQSTAVVPVRTKKRFTPPTYQPKYKSEKEFVEHARKAGLVIPHERLERPIHLACTAGIFDAYVPPEGDARISSLSKEGLAQRAERLKKNVASQLSIRKIRESDPNFKIKDFPEKAKDIFIEAHLCLNNSDHDRLHTLVTENCFPDMVWDIRYKTVRWSFVESLEPPQVVQVRCSSLMNQGNIYGQVTVRMHTRQTLAIYDRFGRLMYGQEDVPRDVLEYVVFEKHLVDPYGSWRMHGKIIPPWAPPKQPILKTVMIPGPQLKPWEEFEEPQGEVHKPQPA

Entity 51 Entity 51 polymer

Description description	Mitochondrial ribosomal protein L46
Molecular weight formula_weight	32216.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bv

MAAPVRRTMLRVVRGWRRFEGPWAHSLGSRNLALAVAPSSSSSPWRLLGALCLQRPPLVTKPLTPLQEEMADLLQQIEIERSLYSDHELRALDEAQQLAKKKSDLYEEEDEQNILLAQDLEDMWEQKFLHFKLGARLTEADKKDDRTSLHRKLDRNLILLVREKLGDQDIWMLPQSDWQPGETLRQTAERTLATLSENNMEAKFLGNAPCGHYKFKFPQAMRTETSLGAKVFFFKALLLTGDFSQAGKKGHHVWVSKEELGDYLKPKYLAQVRRFLLDL

Entity 52 Entity 52 polymer

Description description	39S ribosomal protein L48, mitochondrial
Molecular weight formula_weight	29942.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bw

MSEAAGTKVLRELNASRSDIVTGPDQGRSVSIFRPPGIAAAWADLQLARLHTTRQQRMNGALGKALCLRNDTVLKQALSLIRVRASGESPICSAGGILLSTSRHYRSKPTHGIGRYKHLVKAQEPKKKKGKVEVRPINLGTDYEYGVLNIHLIAYDMALAESYAQYVHNLCNHLAIKVEESYAMPTKTMEVLQLQEQGSKMFLDAVLTTHERVVQISGLSATFAEIFLEIIHSNLPEGVKLSVREHTEEDFKGRFKARPELEELLAKLN

Entity 53 Entity 53 polymer

Description description	39S ribosomal protein L49, mitochondrial
Molecular weight formula_weight	18957.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bx

MAATVLCGVLRAWRTGVPLGCGLRRLSQTQGTPEYPSFVESVDEYHFVERLLPPASIPRPPKHEHYPTPSGWQPPRDPAPSLPYFVRRSRMHNIPVYRDITHGNRQMTVIRKVEGDIWALQKDVEDFLSPLLGKTPVTQVNEVTGTLRVKGYFDQQLKAWLLEKGF

Entity 54 Entity 54 polymer

Description description	Mitochondrial ribosomal protein L50
Molecular weight formula_weight	22785.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	By

MVRLRGKRECLTLSLRLIGWSWRVTAGGGRCFVSKFSSKMAARWVSGLARRSLTCAVSGAPRREFWSPFRKEKQPVVAETVEEVKKEPILVCPPIQSRTYIPPEDLQSRLESHVKEVFGSSVPSNWQDISLEDVHLKFSFLARLANDLRHAVPNSRLHQMCRVRDVLDFYNVPVQDRSKFDELIASNLPHNLKITWGY

Entity 55 Entity 55 polymer

Description description	Large ribosomal subunit protein mL51
Molecular weight formula_weight	15249.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bz

MAGSLSWVTGRGLWGRLPLTCRSFSLGIPRLFHVRVTLPPRKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIKGPIWLRGWKGNELQRCIRKKRMVGNRMFIDDLHNLNKRISYLYKHFNRHGKYR

Entity 56 Entity 56 polymer

Description description	P-site Met-tRNA(fMet)
Molecular weight formula_weight	22664.5 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	AG

AGUAAGGUCAGCUAAAUAAGCUAUCGGGCCCAUACCCCGAAAAUGUUGGUUAUACCCUUCCCGUACUACCA

Entity 57 Entity 57 polymer

Description description	Peptide chain release factor 1, mitochondrial
Molecular weight formula_weight	55569.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Aa

MNRHLCVWLFRHPSLNGYLQCHIQLHSHQFRQIHLDTRLQVFRQNRNCILHLLSKNWSRRYCHQDTKMLWKHKALQKYMENLSKEYQTLEQCLQHIPVNEENRRSLNRRHAELAPLAAIYQEIQETEQAIEELESMCKSLNKQDEKQLQELALEERQTIDQKINMLYNELFQSLVPKEKYDKNDVILEVTAGRTTGGDICQQFTREIFDMYQNYSCYKHWQFELLNYTPADYGGLHHAAARISGDGVYKHLKYEGGIHRVQRIPEVGLSSRMQRIHTGTMSVIVLPQPDEVDVKLDPKDLRIDTFRAKGAGGQHVNKTDSAVRLVHIPTGLVVECQQERSQIKNKEIAFRVLRARLYQQIIEKDKRQQQSARKLQVGTRAQSERIRTYNFTQDRVSDHRIAYEVRDIKEFLCGGKGLDQLIQRLLQSADEEAIAELLDEHLKSAKGGSGGSGDYKDHDGDYKDHDIDYKDDDDK

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 58 Entity 58 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	205

Entity 59 Entity 59 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	30

Entity 60 Entity 60 non-polymer

Description description	PHENYLALANINE
Molecular weight formula_weight	165.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 61 Entity 61 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 62 Entity 62 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 63 Entity 63 non-polymer

Description description	N-FORMYLMETHIONINE
Molecular weight formula_weight	177.2 kDa
Source method src_method	syn
Copy count entity_count	1

▶

8. Citations (1)

▶

Resolution resolution	3.50 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	50622

fit	/app/data/saxs_computation/oi/8oiq/8oiq.fit
pddf	/app/data/pr_computation/oi/8oiq/8oiq.pr.out
profile	/app/data/saxs_computation/oi/8oiq/8oiq.dat