6gaz

Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 28S ribosomal subunit.

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Translation initiation factor IF-2, mitochondrial

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitochondrial ribosomal protein S5 × 1 （F1SU66） Mitochondrial ribosomal protein S6 × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S9 × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） Mitochondrial ribosomal protein S15 × 1 （A0A287BMP0） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S17 × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S21 × 1 （A0A286ZNB3） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （I3LK09） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S34 × 1 （F1RG19） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Mitochondrial ribosomal protein S37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） Mitochondrial ribosomal protein S39 × 1 （K7GKS8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IF2M_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain BC； PDBConstruct 8–657； UniProt 78–727

Mitochondrial ribosomal protein L19

OrganismNot specified

UniProt I3LNJ0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Translation initiation factor IF-2, mitochondrial × 1 （P46199） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitochondrial ribosomal protein S5 × 1 （F1SU66） Mitochondrial ribosomal protein S6 × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S9 × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） Mitochondrial ribosomal protein S15 × 1 （A0A287BMP0） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S17 × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S21 × 1 （A0A286ZNB3） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （I3LK09） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S34 × 1 （F1RG19） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Mitochondrial ribosomal protein S37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） Mitochondrial ribosomal protein S39 × 1 （K7GKS8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LNJ0_PIG
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain BT； PDBConstruct 1–292； UniProt 12–303

Mitochondrial ribosomal protein S2

OrganismNot specified

UniProt F1S001

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitochondrial ribosomal protein S5 × 1 （F1SU66） Mitochondrial ribosomal protein S6 × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S9 × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） Mitochondrial ribosomal protein S15 × 1 （A0A287BMP0） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S17 × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S21 × 1 （A0A286ZNB3） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （I3LK09） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S34 × 1 （F1RG19） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Mitochondrial ribosomal protein S37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） Mitochondrial ribosomal protein S39 × 1 （K7GKS8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1S001_PIG
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain AB； PDBConstruct 1–289； UniProt 1–289

Mitochondrial ribosomal protein S24

OrganismNot specified

UniProt A0A287ANU4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S5 × 1 （F1SU66） Mitochondrial ribosomal protein S6 × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S9 × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） Mitochondrial ribosomal protein S15 × 1 （A0A287BMP0） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S17 × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S21 × 1 （A0A286ZNB3） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （I3LK09） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S34 × 1 （F1RG19） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Mitochondrial ribosomal protein S37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） Mitochondrial ribosomal protein S39 × 1 （K7GKS8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287ANU4_PIG
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain AC； PDBConstruct 1–167； UniProt 1–167

Mitochondrial ribosomal protein S5

OrganismNot specified

UniProt F1SU66

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitochondrial ribosomal protein S6 × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S9 × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） Mitochondrial ribosomal protein S15 × 1 （A0A287BMP0） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S17 × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S21 × 1 （A0A286ZNB3） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （I3LK09） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S34 × 1 （F1RG19） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Mitochondrial ribosomal protein S37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） Mitochondrial ribosomal protein S39 × 1 （K7GKS8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SU66_PIG
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain AE； PDBConstruct 1–430； UniProt 1–430

Mitochondrial ribosomal protein S6

OrganismNot specified

UniProt I3LEJ9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitochondrial ribosomal protein S5 × 1 （F1SU66） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S9 × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） Mitochondrial ribosomal protein S15 × 1 （A0A287BMP0） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S17 × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S21 × 1 （A0A286ZNB3） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （I3LK09） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S34 × 1 （F1RG19） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Mitochondrial ribosomal protein S37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） Mitochondrial ribosomal protein S39 × 1 （K7GKS8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LEJ9_PIG
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain AF； PDBConstruct 1–124； UniProt 1–124

Mitochondrial ribosomal protein S7

OrganismNot specified

UniProt A0A286ZJ25

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitochondrial ribosomal protein S5 × 1 （F1SU66） Mitochondrial ribosomal protein S6 × 1 （I3LEJ9） Mitochondrial ribosomal protein S9 × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） Mitochondrial ribosomal protein S15 × 1 （A0A287BMP0） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S17 × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S21 × 1 （A0A286ZNB3） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （I3LK09） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S34 × 1 （F1RG19） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Mitochondrial ribosomal protein S37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） Mitochondrial ribosomal protein S39 × 1 （K7GKS8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZJ25_PIG
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain AG； PDBConstruct 1–242； UniProt 1–242

Mitochondrial ribosomal protein S9

OrganismNot specified

UniProt I3LU08

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitochondrial ribosomal protein S5 × 1 （F1SU66） Mitochondrial ribosomal protein S6 × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） Mitochondrial ribosomal protein S15 × 1 （A0A287BMP0） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S17 × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S21 × 1 （A0A286ZNB3） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （I3LK09） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S34 × 1 （F1RG19） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Mitochondrial ribosomal protein S37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） Mitochondrial ribosomal protein S39 × 1 （K7GKS8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LU08_PIG
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain AI； PDBConstruct 1–397； UniProt 1–397

Mitochondrial ribosomal protein S10

OrganismNot specified

UniProt F1RUU2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitochondrial ribosomal protein S5 × 1 （F1SU66） Mitochondrial ribosomal protein S6 × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S9 × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） Mitochondrial ribosomal protein S15 × 1 （A0A287BMP0） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S17 × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S21 × 1 （A0A286ZNB3） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （I3LK09） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S34 × 1 （F1RG19） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Mitochondrial ribosomal protein S37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） Mitochondrial ribosomal protein S39 × 1 （K7GKS8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RUU2_PIG
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain AJ； PDBConstruct 1–201； UniProt 1–201

Mitochondrial ribosomal protein S11

OrganismNot specified

UniProt A0A286ZJJ6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitochondrial ribosomal protein S5 × 1 （F1SU66） Mitochondrial ribosomal protein S6 × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S9 × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） Mitochondrial ribosomal protein S15 × 1 （A0A287BMP0） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S17 × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S21 × 1 （A0A286ZNB3） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （I3LK09） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S34 × 1 （F1RG19） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Mitochondrial ribosomal protein S37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） Mitochondrial ribosomal protein S39 × 1 （K7GKS8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZJJ6_PIG
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain AK； PDBConstruct 1–196； UniProt 1–196

Mitochondrial ribosomal protein S12

OrganismNot specified

UniProt A0A0M3KL52

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitochondrial ribosomal protein S5 × 1 （F1SU66） Mitochondrial ribosomal protein S6 × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S9 × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） Mitochondrial ribosomal protein S15 × 1 （A0A287BMP0） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S17 × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S21 × 1 （A0A286ZNB3） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （I3LK09） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S34 × 1 （F1RG19） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Mitochondrial ribosomal protein S37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） Mitochondrial ribosomal protein S39 × 1 （K7GKS8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M3KL52_PIG
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain AL； PDBConstruct 1–139； UniProt 1–139

Mitochondrial ribosomal protein S14

OrganismNot specified

UniProt A0A0M3KL53

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitochondrial ribosomal protein S5 × 1 （F1SU66） Mitochondrial ribosomal protein S6 × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S9 × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S15 × 1 （A0A287BMP0） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S17 × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S21 × 1 （A0A286ZNB3） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （I3LK09） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S34 × 1 （F1RG19） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Mitochondrial ribosomal protein S37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） Mitochondrial ribosomal protein S39 × 1 （K7GKS8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M3KL53_PIG
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain AN； PDBConstruct 1–128； UniProt 1–128

Mitochondrial ribosomal protein S15

OrganismNot specified

UniProt A0A287BMP0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitochondrial ribosomal protein S5 × 1 （F1SU66） Mitochondrial ribosomal protein S6 × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S9 × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S17 × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S21 × 1 （A0A286ZNB3） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （I3LK09） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S34 × 1 （F1RG19） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Mitochondrial ribosomal protein S37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） Mitochondrial ribosomal protein S39 × 1 （K7GKS8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287BMP0_PIG
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain AO； PDBConstruct 1–239； UniProt 1–239

Mitochondrial ribosomal protein S17

OrganismNot specified

UniProt F1RIU0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitochondrial ribosomal protein S5 × 1 （F1SU66） Mitochondrial ribosomal protein S6 × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S9 × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） Mitochondrial ribosomal protein S15 × 1 （A0A287BMP0） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S21 × 1 （A0A286ZNB3） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （I3LK09） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S34 × 1 （F1RG19） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Mitochondrial ribosomal protein S37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） Mitochondrial ribosomal protein S39 × 1 （K7GKS8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RIU0_PIG
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain AQ； PDBConstruct 1–130； UniProt 1–130

Mitochondrial ribosomal protein S18C

OrganismNot specified

UniProt A0A0M3KL54

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitochondrial ribosomal protein S5 × 1 （F1SU66） Mitochondrial ribosomal protein S6 × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S9 × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） Mitochondrial ribosomal protein S15 × 1 （A0A287BMP0） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S17 × 1 （F1RIU0） Mitochondrial ribosomal protein S21 × 1 （A0A286ZNB3） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （I3LK09） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S34 × 1 （F1RG19） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Mitochondrial ribosomal protein S37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） Mitochondrial ribosomal protein S39 × 1 （K7GKS8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M3KL54_PIG
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain AR； PDBConstruct 1–143； UniProt 1–143

Mitochondrial ribosomal protein S21

OrganismNot specified

UniProt A0A286ZNB3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitochondrial ribosomal protein S5 × 1 （F1SU66） Mitochondrial ribosomal protein S6 × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S9 × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） Mitochondrial ribosomal protein S15 × 1 （A0A287BMP0） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S17 × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （I3LK09） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S34 × 1 （F1RG19） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Mitochondrial ribosomal protein S37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） Mitochondrial ribosomal protein S39 × 1 （K7GKS8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZNB3_PIG
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain AU； PDBConstruct 1–87； UniProt 1–87

Mitochondrial ribosomal protein S22

OrganismNot specified

UniProt A0A287AQT5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitochondrial ribosomal protein S5 × 1 （F1SU66） Mitochondrial ribosomal protein S6 × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S9 × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） Mitochondrial ribosomal protein S15 × 1 （A0A287BMP0） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S17 × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S21 × 1 （A0A286ZNB3） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （I3LK09） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S34 × 1 （F1RG19） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Mitochondrial ribosomal protein S37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） Mitochondrial ribosomal protein S39 × 1 （K7GKS8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287AQT5_PIG
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain Aa； PDBConstruct 1–382； UniProt 1–382

Mitochondrial ribosomal protein S23

OrganismNot specified

UniProt A0A287AEW3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitochondrial ribosomal protein S5 × 1 （F1SU66） Mitochondrial ribosomal protein S6 × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S9 × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） Mitochondrial ribosomal protein S15 × 1 （A0A287BMP0） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S17 × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S21 × 1 （A0A286ZNB3） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （I3LK09） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S34 × 1 （F1RG19） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Mitochondrial ribosomal protein S37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） Mitochondrial ribosomal protein S39 × 1 （K7GKS8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287AEW3_PIG
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain Ab； PDBConstruct 1–190； UniProt 1–190

Mitochondrial ribosomal protein S25

OrganismNot specified

UniProt A0A0M3KL55

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitochondrial ribosomal protein S5 × 1 （F1SU66） Mitochondrial ribosomal protein S6 × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S9 × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） Mitochondrial ribosomal protein S15 × 1 （A0A287BMP0） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S17 × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S21 × 1 （A0A286ZNB3） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （I3LK09） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S34 × 1 （F1RG19） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Mitochondrial ribosomal protein S37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） Mitochondrial ribosomal protein S39 × 1 （K7GKS8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M3KL55_PIG
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain Ac； PDBConstruct 1–173； UniProt 1–173

Mitochondrial ribosomal protein S26

OrganismNot specified

UniProt A0A287AY01

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitochondrial ribosomal protein S5 × 1 （F1SU66） Mitochondrial ribosomal protein S6 × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S9 × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） Mitochondrial ribosomal protein S15 × 1 （A0A287BMP0） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S17 × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S21 × 1 （A0A286ZNB3） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S27 × 1 （I3LK09） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S34 × 1 （F1RG19） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Mitochondrial ribosomal protein S37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） Mitochondrial ribosomal protein S39 × 1 （K7GKS8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287AY01_PIG
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain Ad； PDBConstruct 1–205； UniProt 1–205

Mitochondrial ribosomal protein S27

OrganismNot specified

UniProt I3LK09

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitochondrial ribosomal protein S5 × 1 （F1SU66） Mitochondrial ribosomal protein S6 × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S9 × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） Mitochondrial ribosomal protein S15 × 1 （A0A287BMP0） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S17 × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S21 × 1 （A0A286ZNB3） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S34 × 1 （F1RG19） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Mitochondrial ribosomal protein S37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） Mitochondrial ribosomal protein S39 × 1 （K7GKS8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LK09_PIG
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain Ae； PDBConstruct 1–390； UniProt 6–395

Mitoribosomal protein ms28, mrps28

OrganismNot specified

UniProt A0A0M3KL56

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitochondrial ribosomal protein S5 × 1 （F1SU66） Mitochondrial ribosomal protein S6 × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S9 × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） Mitochondrial ribosomal protein S15 × 1 （A0A287BMP0） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S17 × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S21 × 1 （A0A286ZNB3） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （I3LK09） Death associated protein 3 × 1 （I3LS10） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S34 × 1 （F1RG19） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Mitochondrial ribosomal protein S37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） Mitochondrial ribosomal protein S39 × 1 （K7GKS8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M3KL56_PIG
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain Af； PDBConstruct 1–188； UniProt 1–188

Death associated protein 3

OrganismNot specified

UniProt I3LS10

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitochondrial ribosomal protein S5 × 1 （F1SU66） Mitochondrial ribosomal protein S6 × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S9 × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） Mitochondrial ribosomal protein S15 × 1 （A0A287BMP0） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S17 × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S21 × 1 （A0A286ZNB3） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （I3LK09） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S34 × 1 （F1RG19） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Mitochondrial ribosomal protein S37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） Mitochondrial ribosomal protein S39 × 1 （K7GKS8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LS10_PIG
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain Ag； PDBConstruct 1–397； UniProt 1–397

Mitochondrial ribosomal protein S33

OrganismNot specified

UniProt F1S8G3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitochondrial ribosomal protein S5 × 1 （F1SU66） Mitochondrial ribosomal protein S6 × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S9 × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） Mitochondrial ribosomal protein S15 × 1 （A0A287BMP0） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S17 × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S21 × 1 （A0A286ZNB3） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （I3LK09） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S34 × 1 （F1RG19） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Mitochondrial ribosomal protein S37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） Mitochondrial ribosomal protein S39 × 1 （K7GKS8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1S8G3_PIG
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain Ai； PDBConstruct 1–106； UniProt 43–148

Mitochondrial ribosomal protein S34

OrganismNot specified

UniProt F1RG19

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitochondrial ribosomal protein S5 × 1 （F1SU66） Mitochondrial ribosomal protein S6 × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S9 × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） Mitochondrial ribosomal protein S15 × 1 （A0A287BMP0） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S17 × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S21 × 1 （A0A286ZNB3） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （I3LK09） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Mitochondrial ribosomal protein S37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） Mitochondrial ribosomal protein S39 × 1 （K7GKS8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RG19_PIG
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain Aj； PDBConstruct 1–218； UniProt 1–218

Mitochondrial ribosomal protein S35

OrganismNot specified

UniProt F1SG95

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitochondrial ribosomal protein S5 × 1 （F1SU66） Mitochondrial ribosomal protein S6 × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S9 × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） Mitochondrial ribosomal protein S15 × 1 （A0A287BMP0） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S17 × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S21 × 1 （A0A286ZNB3） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （I3LK09） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S34 × 1 （F1RG19） Mitochondrial ribosomal protein S37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） Mitochondrial ribosomal protein S39 × 1 （K7GKS8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SG95_PIG
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain Ak； PDBConstruct 1–325； UniProt 42–366

Mitochondrial ribosomal protein S37

OrganismNot specified

UniProt F1SU49

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitochondrial ribosomal protein S5 × 1 （F1SU66） Mitochondrial ribosomal protein S6 × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S9 × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） Mitochondrial ribosomal protein S15 × 1 （A0A287BMP0） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S17 × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S21 × 1 （A0A286ZNB3） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （I3LK09） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S34 × 1 （F1RG19） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） Mitochondrial ribosomal protein S39 × 1 （K7GKS8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SU49_PIG
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain Am； PDBConstruct 1–118； UniProt 1–118

Aurora kinase A interacting protein 1

OrganismNot specified

UniProt A0A287B3R8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitochondrial ribosomal protein S5 × 1 （F1SU66） Mitochondrial ribosomal protein S6 × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S9 × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） Mitochondrial ribosomal protein S15 × 1 （A0A287BMP0） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S17 × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S21 × 1 （A0A286ZNB3） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （I3LK09） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S34 × 1 （F1RG19） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Mitochondrial ribosomal protein S37 × 1 （F1SU49） Mitochondrial ribosomal protein S39 × 1 （K7GKS8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287B3R8_PIG
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain An； PDBConstruct 1–199； UniProt 1–199

Mitochondrial ribosomal protein S39

OrganismNot specified

UniProt K7GKS8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitochondrial ribosomal protein S5 × 1 （F1SU66） Mitochondrial ribosomal protein S6 × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S9 × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） Mitochondrial ribosomal protein S15 × 1 （A0A287BMP0） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S17 × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S21 × 1 （A0A286ZNB3） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （I3LK09） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S34 × 1 （F1RG19） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Mitochondrial ribosomal protein S37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	K7GKS8_PIG
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain Ao； PDBConstruct 1–692； UniProt 1–692

28S ribosomal protein S18b, mitochondrial

OrganismNot specified

UniProt Q767K8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） 12S ribosomal RNA, mitochondrial × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitochondrial ribosomal protein S5 × 1 （F1SU66） Mitochondrial ribosomal protein S6 × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S9 × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） Mitochondrial ribosomal protein S15 × 1 （A0A287BMP0） bS16m, MRPS16 × 1 Mitochondrial ribosomal protein S17 × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S21 × 1 （A0A286ZNB3） P-site fMet-tRNAMet, mitochondrial × 1 MT-CO3 mRNA, mitochondrial × 1 unassigned secondary structure elements × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （I3LK09） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） mS31, MRPS31 × 1 Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S34 × 1 （F1RG19） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Mitochondrial ribosomal protein S37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） Mitochondrial ribosomal protein S39 × 1 （K7GKS8） 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MAGNESIUM ION × 111 SODIUM ION × 1 SPERMINE × 1 ZINC ION × 3 N-FORMYLMETHIONINE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RT18B_PIG
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain Ap； PDBConstruct 1–258； UniProt 1–258

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6gaz
Deposition date deposition_date	2018-04-13
Structure title title	Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 28S ribosomal subunit.
Keywords keywords	translation initiation, initiation factor IF2, mitochondria, membrane targeting, RIBOSOME; RIBOSOME
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6gaz__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6gaz__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6gaz__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	72.71 Å
Rg (electron density)	76.41 Å
Total Rg	75.89 Å
Atom count	73167
Residues	7351
Excluded volume	1223600 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6gaz__assembly_1__model_1`	36-meric （36）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (44)

Entity 1 Entity 1 polymer

Description description	Translation initiation factor IF-2, mitochondrial
Molecular weight formula_weight	72811.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BC
Atom count atom_count	73172

SGGSGSGWKSQLSSTKSKKVVEVWIGMTIEELARAMEKNTDYVYEALLNTDIDIDSLEADSHLDEVWIKEVITKAGMKLKWSKLKQDKVRKNKDAVRRPQADPALLTPRSPVVTIMGHVDHGKTTLLDKFRKTQVAAVETGGITQHIGAFLVSLPSGEKITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDGVMKQTVESIQHAKDAQVPIILAVNKCDKAEADPEKVKKELLAYDVVCEDYGGDVQAVPVSALTGDNLMALAEATVALAEMLELKADPNGPVEGTVIESFTDKGRGLVTTAIIQRGTLRKGSVLVAGKCWAKVRLMFDENGKTIDEAYPSMPVGITGWRDLPSAGEEILEVESEPRAREVVDWRKYEQEQEKGQEDLKIIEEKRKEHKEAHQKAREKYGHLLWKKRSILRFLERKEQIPLKPKEKRERDSNVLSVIIKGDVDGSVEAILNIIDTYDASHECELELVHFGVGDVSANDVNLAETFDGVIYGFNVNAGNVIQQSAAKKGVKIKLHKIIYRLVEDLQEELSSRLPCAVEEHPVGEASILATFSVTEGKKKVPVAGCRVQKGQLEKQKKFKLTRNGHVIWKGSLTSLKHHKDDISIVKTGMDCGLSLDEDNMEFQVGDRIVCYEEKQIQAKTSWDPGF

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Mitochondrial ribosomal protein L19
Molecular weight formula_weight	33441.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BT

MAASITRGSWAAVGLGQSFPPTRALLPAPASVICRTLAGSGRQQVTGSSEPGAFQPPPKPVIVDKRRPQRPETRFLSPEFIPPRGRTNPLKFQIERKDMLERRKILHIPEFYVGSILRVTTADPYASAKTSQFLGICIQRSGSGLGATFILRNTIEGQGVEICFELYNPRIQEIQVVKLEKRLDNSLLYLRDALPEYSTFDVNMKPITQEFNQEVPVNQLKVKMKPKPWSKRWERPKFNIKGIRFDLCLTEEQMREAQKWSQPWLEFDMMREYDTSKIEAAIWDEIEASKNS

Entity 3 Entity 3 polymer

Description description	12S ribosomal RNA, mitochondrial
Molecular weight formula_weight	308989.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	AA

ACACAGGUUUGGUCCUGGCCUUUCUAUUAAUUCUUAAUAAAAUUACACAUGCAAGUAUCCGCGCCCCGGUGAGAAUGCCCUCCAGAUCUUAAAGAUCAAAAGGAGCAGGUAUCAAGCACACCUAUAACGGUAGCUCAUAACGCCUUGCUCAACCACACCCCCACGGGAAACAGCAGUGAUAAAAAUUAAGCCAUGAACGAAAGUUUGACUAAGUUAUAUUAAUUAGAGUUGGUAAAUCUCGUGCCAGCCACCGCGGUCAUACGAUUAACCCAAAUUAAUAGAUCCACGGCGUAAAGAGUGUUUAAGAAAAAAAAUCACAAUAGAGUUAAAUUAUAACUAAGCUGUAAAAAGCCCUAGUUAAAAUAAAAUAACCCACGAAAGUGACUCUAAUAAUCCUGACACACGAUAGCUAGGACCCAAACUGGGAUUAGAUACCCCACUAUGCCUAGCCCUAAACCCAAAUAGUUACAUAACAAAACUAUUCGCCAGAGUACUACUCGCAACUGCCUAAAACUCAAAGGACUUGGCGGUGCUUCACAUCCACCUAGAGGAGCCUGUUCUAUAAUCGAUAAACCCCGAUAGACCUUACCAACCCUUGCCAAUUCAGCCUAUAUACCGCCAUCUUCAGCAAACCCUAAAAAGGAACAAUAGUAAGCACAAUCAUAGCACAUAAAAACGUUAGGUCAAGGUGUAGCUUAUGGGUUGGAAAGAAAUGGGCUACAUUUUCUACAUAAGAAUAUCCACCACACGAAAGUUUUUAUGAAACUAAAAACCAAAGGAGGAUUUAGCAGUAAAUCAAGAAUAGAGUGCUUGAUUGAAUAAGGCCAUGAAGCACGCACACACCGCCCGUCACCCUCCUCAAGCAUGUAGUAAUAAAAAUAACCUAUAUUCAAUUACACAACCAUGCAAGAAGAGACAAGUCGUAACAAGGUAAGCAUACUGGAAAGUGUGCUUGGAUUACC

Entity 4 Entity 4 polymer

Description description	Mitochondrial ribosomal protein S2
Molecular weight formula_weight	31731.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AB

MASGPLLPRLLGAGAPRRPLRLHLVPTATPGPAGPTGRTLGSNAAPAAREPELGNDLRDRILSEPLKHADFFNLKELFSVRSLFDARVHLGHKAGCRHRFMEPYLFGSRLGQDIIDLEQTAAHLQLALNFTAHVAYREGIILFVSRHRQFAHLIETTARDCGEYAHTRYFKGGLLTNAPLLLGPGVRLPDLIIFLHTLNNVFEPHVAVRDAAKMNIPTVGIVDTNCNPALITYPVPGNDDSPPAVRLFCRLFQVAISRAKEKRRQVEALYRLQGPAGAERGPAAPPPPE

Entity 5 Entity 5 polymer

Description description	Mitochondrial ribosomal protein S24
Molecular weight formula_weight	18935.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AC

MVASVCGGGLRPLVLSWSRELPCAWRALHISAVCAKNRAARVRVSKGDKPVTYEEAHAPHYIAHRKGWLSLHTGNLDGEDHAAERTVEDVFLRKFMLGTFPGCLADQLVLKRRANQLEICALVLRQLPPHKFYFLVGYSETLLSHFYKCPVHLHLQTVPSKVVYKYI

Entity 6 Entity 6 polymer

Description description	Mitochondrial ribosomal protein S5
Molecular weight formula_weight	48213.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AE

MAAAVRAAGFFPGLFGASAGNLWSRQLYLNTFPAASILTSKTFPSNGPLSPPGTRDNHHFTSLACALQTQCSISSPSNWMGQQYRSYSFFTKLTADELWKGALAESGAGARKGRGKRTKKKRRKDLNRGQIIGEGRHGFLWPGLNIPLMRNGAVQTIAQRSKEDQEKVEADMVQQREEWDRRRKMKVKRERGWSGNTWGGVSLGPPDPGPNGETYDDFDTRILEVRNVFNMTAKEGRKRSVRVLVAVGNGKGAAGFAIGKATERADAFRKAKNRAVHYLHYIERYEDHTIYHDISLKFKRTHIKMKKQPRGYGLHCHRAIMTICRLIGIKDLYAKVSGSVNMLNLTRGLFLGLSRQETHQQLADKKSLHVVEFREECGPLPIVVASPQGALRKDPEPEDEVPDITLDWEDVKAAQGMKRSVWSGLKRAAT

Entity 7 Entity 7 polymer

Description description	Mitochondrial ribosomal protein S6
Molecular weight formula_weight	14283.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AF

MPRYELALILKAMQRPETAAALKRTLEALMDRGAVVRNLENLGERMLPYKISAHNQRHSRGGYFLVDFYAPATTVESMMEHLSRDIDVIRPNIVKHPLTQEVKECEGIVPVPLEEKLYSTKKRK

Entity 8 Entity 8 polymer

Description description	Mitochondrial ribosomal protein S7
Molecular weight formula_weight	28150.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AG

MAAPAVKAARGWSCSALGVRIAVLRFPGLTQVRWSRYGPEYKDPQIDKEYYRKPLAEQTEEEKYERDFKKTQLIKAAPATKTSSVFEDPVISKFTNMMMKGGNKVLARSLMTQTLEAVKRKQFAKYHAASAEEQATIERNPYTIFHQALKNCEPVIGLVPILKGGHFYQVPVPLADRRRRFLAMKWMIAECREKKHRRVLMPEKLSQELLEAFHNQGPVIKRKHDMHKMAEANRALAHYRWW

Entity 9 Entity 9 polymer

Description description	Mitochondrial ribosomal protein S9
Molecular weight formula_weight	45604.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AI

MAAPCVFCGAAVSYRLFLGCRVSFARGQVLWKAAAPELQAGARCQILRLRHTAVVTTKKNVAASRRETYTVDFIKKQIEEFNIGKRHLANMMGEDPETFTQEDIDRAIAYLFPSGLFEKRARPIMKHPEEIFPKQRAIQWGEDGRPFHFLFYTGKQSYYSLMHDTYGKLLDVEKHHNQLRAKDLLAEKTKILKDPIGSRWLIKEELEEMLVEKLSDQDYAQFIRLLERLSALPCGATEEDFVNRFRRSIPIQSKKQLIEPLQYDEQGMAFSRGEGKRKTAKAEVVVYGQGSGRIDVNGVDYLLYFPVTQDREQLMFPLHFLDRLGKHDMTCAVSGGGRSAQAGAVRLAMARALCSFVTEDEVEWMRQAGLLTADPRVRERKKPGQEGARRKFTWKKR

Entity 10 Entity 10 polymer

Description description	Mitochondrial ribosomal protein S10
Molecular weight formula_weight	23192.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AJ

MAARTAFGALARRLWQGSRNFSVSSSRSSTAKNGGFLLSTTMKWVQFSNLHVDVPKDMTKPEITISDEPDTLYKRLSVLVKGHDKAVLDSYEYFAVLAAKELGISIKVHEPPRKIERFTLLKSVHIFKKHRVQYEMRTLYRCLELEHLTGSTADVYLEYIQRNLPEGVAMEVTKTKLEQLPEHIRKPIWETMPEEKEESKS

Entity 11 Entity 11 polymer

Description description	Mitochondrial ribosomal protein S11
Molecular weight formula_weight	20841.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AK

MQVVRNAGSRLLQSWAWPPKTRIVAGLPASTIHRSAPHLQDAAAKLDIEDKEEARTPSHSSFSIYPPIPGQENSLRWAGKKFEEIPIAHIKASYNNTQIQVVSAAHQPLAHASCGTEGFRNAKKGTGIAAQTAGIAAAAKATGKGVTHVRVVVKGLGPGRLSAIKGLTMGGLEVISITDNTPIPHNGCRPRKARRL

Entity 12 Entity 12 polymer

Description description	Mitochondrial ribosomal protein S12
Molecular weight formula_weight	15257.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AL

MSWSGLLRGLGTSLNCGLALVPRPWATRPMATLNQMHRLGPPKHPPGKMGPTAGRPQLKGVVLRTFIRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHSLQEHHVVLVQGGRTQDLPGVKLTVVRGKYDCGHVQKKK

Entity 13 Entity 13 polymer

Description description	Mitochondrial ribosomal protein S14
Molecular weight formula_weight	15120.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AN

MAASMLGFLLRTVRQMVPSSASGQVRSYYVDWKMLRDVKRRKMAYEYADERLRINSLRKNTILPKDLQEVADEEIASLPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGVQRAMW

Entity 14 Entity 14 polymer

Description description	Mitochondrial ribosomal protein S15
Molecular weight formula_weight	27411.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AO

MLRAAWRALSSIRTQAVTQAPVLGLPGGGCARFPSVQRALPSRPAGLILRAARGYAAQKPVQPNQDDPPPSMLLLDYQNVPGIHKVDDVVKRLLSLEMANQKEKLKIKKMQLMNKVLENPEDTSSLEARIVALTVKIRNYEEHMQKHRKDKAHKRFLLMSIDQRKKMLKNLRETNYAVFEKICKELGIEYTFPPPYHRKAHRRWVTKKALCTQVFREVQKLKKQKRALRAAAVAAHKQG

Entity 15 Entity 15 polymer

Description description	bS16m, MRPS16
Molecular weight formula_weight	15182.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AP

MVQLTTVLCRAYRGGHLTIRLALGGCTNRPFYRIVAAHSKCPRDGRFVEQLGSYDPLPNSHGEKLVALNFDRIRHWIGCGAHLSKPVEKLLGLSGFYPLHPMMITNAERLRRKRAREVLLASQKTDTEATETKAS

Entity 16 Entity 16 polymer

Description description	Mitochondrial ribosomal protein S17
Molecular weight formula_weight	14452.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AQ

MSIARSSVHAKWVVGKVIGTAMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTVGDIVLLKALPVPRTKHVKHELAEIIFKVGQVIDPVTGKPCAGTTYLESPISPESTRLTKNLEALQLSSTQ

Entity 17 Entity 17 polymer

Description description	Mitochondrial ribosomal protein S18C
Molecular weight formula_weight	16211.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AR

MAAVVSLCSRLGRRKSTDFVNAAVCLTDPGTHAVLWRSCSQYKQVASNEDLPVPMENPYKEPLKKCILCEKHVDYKNVQLLSQFISPFTGCIYGRHITGLCGKKQKEITKAIKRAQILGFMPVTYKDPAYLKDPKVCNIKYRE

Entity 18 Entity 18 polymer

Description description	Mitochondrial ribosomal protein S21
Molecular weight formula_weight	10682.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AU

MANHLKFIARTVMVQEGNVEGAYRTLNRILTMDGLIEDIKRRRYYEKPCRRRQRESYETCRRIYNMEMARKINFLMRKNRADPWQGC

Entity 19 Entity 19 polymer

Description description	P-site fMet-tRNAMet, mitochondrial
Molecular weight formula_weight	22664.5 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	AV

AGUAAGGUCAGCUAAAUAAGCUAUCGGGCCCAUACCCCGAAAAUGUUGGUUAUACCCUUCCCGUACUACCA

Entity 20 Entity 20 polymer

Description description	MT-CO3 mRNA, mitochondrial
Molecular weight formula_weight	63946.1 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	AX

AUGACCCACCAAUCACAUGCCUAUCAUAUAGUAAAACCCAGCCCAUGACCCCUAACAGGGGCCCUCUCAGCCCUCCUAAUGACCUCCGGCCUAGCCAUGUGAUUUCACUUCCACUCCAUAACGCUCCUCAUACUAGGCCUACUAACCAACACACUAACCAUAUACCAAUGAUGGCGCGAUGUAACACGAGAAAGCACAUAC

Entity 21 Entity 21 polymer

Description description	unassigned secondary structure elements
Molecular weight formula_weight	1297.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AZ

AAAAAAAAAAAAAAAAAA

Entity 22 Entity 22 polymer

Description description	Mitochondrial ribosomal protein S22
Molecular weight formula_weight	43234.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Aa

MPHEPRETRNLSLPLPALVARIIMATLKASALLRSLQTNSCGTGRVCFPVRARPRPRALLQPLPGASGTGTLCRGLGSESESGNSEIRKPTFMDEEVQNILIKMTGLDLQKIFKPALQELKPPTYKLMTQAQLEEATKQAVEAAKVRLKMPPVLEERAPINDVLAEDKILEGTETAKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVYFPREGRRILTPVIFKEENLQTMYSQDQHVDVLNLCVAQFEPDSAEYIKIHHHTYEDIDKCGKYDLLRSTRHFGGMAWYFVNKKKIDGLLIDQIQRDLVSDATSLVHLYHILHPDGQSAQEAKKQGAEGLHLIKVFAKTEAQKGAYIELTLQAYQEAFITHSAAS

Entity 23 Entity 23 polymer

Description description	Mitochondrial ribosomal protein S23
Molecular weight formula_weight	21666.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ab

MAGSRLETVGSIFSRTRDLIRAGVLKEKPLWLDIYNAFPPLREPVFRRPRLRYGKAKAAVQDIFYHEDRIRAKFYSAYGSGPKAFDLFNPNFKSTCQRFVEKYIELQRLGETDEEKLFVEAGKALLAEGVTLRRVGEARTQQEGSPISRKSEPTGIKPQTAVEENQPWKEVPQDQPLEAPEKESKGLPPP

Entity 24 Entity 24 polymer

Description description	Mitochondrial ribosomal protein S25
Molecular weight formula_weight	19954.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ac

MPMKGRFPIRRTLQYLGQGDVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQITMFKNMTPSPFLRFYLDSGEQVLVDVESKSNKEIVEHIRKILGKNEETLEKEEQEKKQLSHPAHFGPRKYCLRECMCEVEGQVPCPGLVPLPKEMTGKYKAALKATAQD

Entity 25 Entity 25 polymer

Description description	Mitochondrial ribosomal protein S26
Molecular weight formula_weight	23637.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ad

MLRVLGGLGARPAGRLPAPLLLPTRGRKTRHDPPAKSKAGRVATPPAVDPTEFFVLTERYRQYRQTVRALRLEFMSEVRKKLHEARAGVQAERKAQEDAAEHRELMAWNQAENQRLHELRLARLRQEALEQERRQAEEAVLQAREAQAWAQLKEQEVLQLQEEAKTFITRENLEARVEEALDSPKSYNWAITREGLVVRPQQKGS

Entity 26 Entity 26 polymer

Description description	Mitochondrial ribosomal protein S27
Molecular weight formula_weight	45244.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ae

RRCLLSAAYVDSHKWEARDKEDCHLADLASLMDKTYERKLPVSSLTISRFVDNIASREDIDHAEYYLYKFRHSPNCWYLRDWTIHTWIRQCLKYGAQDKALYTLKNKVQYGIFPDNYTFNLLMDYFIKKENYKDALSVVFEIMMQEAFEVPSTQLLSLYVLYHCLAEKTDLSWEEERNFGASLLLPGLKQKNSVGLSSQLYGYALLGKVELQQGLRAVYCNMPLLWQPGYLHRALQVMEKVASSPEDGQLCGEALDVLDRVLKAVTAPAQGTSEEQPQEGEESQRSEELVEQLDVEETEQSKLPQYLERFEALRSKLQALGKVESESLLTLSTQLAKAQLPTCEAEDIAVYEQRLQQWHGERVRLIQREQEQRERARQDYEARRAAKASA

Entity 27 Entity 27 polymer

Description description	Mitoribosomal protein ms28, mrps28
Molecular weight formula_weight	21014.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Af

MAALCRTRAVTAKSHFLRVFFFSRPCRGTGTESGSGSESSESTEPKQRPGGFASALERHSELQQKAEFGRMRGSPKNVESFASMLRHSPLTQMGPAKNKLVIGQIFHIVEDDLYIDFGGKFHCVCKRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTILEADAVLLGLQESKDSKSKEERHEK

Entity 28 Entity 28 polymer

Description description	Death associated protein 3
Molecular weight formula_weight	45582.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ag

MLKGVTRLISRVHKLDPGHVLYMGTQAPQSLAAHLDNQVPVKSPRAISRTSEDDPAKHREQHEGQHYNISLQELKTVFPHGLPPRFAMQVKTFNEACLMVRKPALELLHYLKNTNFAHPAVRYVLYGEKGTGKTLSLCHILHFCAKQNWLILHIPDAHIWVKNCRDLLQSNYNKQRFDQPLEASTWLKNFKTANEHFLSQIKVQEKYVWNKRESTEKGRPLGEVVEQGIMRVRNATDAVGIVLKELKRQSSLGIFHLLVAVDGVNALWGRTTLKREDKSPIAPEELALIHNLRKMVKNDWQGGAIVLTVSQTGSLFKPRNAYLPQELLGKEGFDALDPFIPILVSNYNPKEFESCIQYYLENNWLQHEKAHTEEGKKELLFLSNRNPGQLERLCAYL

Entity 29 Entity 29 polymer

Description description	mS31, MRPS31
Molecular weight formula_weight	44092.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ah

MLPRVSAVIPLRPLSRLPLCSGGPEASAAAILLLDSLRGTVRTENNIQRYFGTNNLVYSKKDEQSGPTCEISKETESKGSVKENSKKDLLNIIKGMKVELSTVNVQTTKPSNKRQLKNLETAIGRIKKAPEDTPQKRSESLSSELVAAVSAVADSLPFDRRMTKSELLRQLQKHEEDSRXQKDGEKPKISFSNIISDMKVARSATARVSTRPVHQIQFDEGTDDFADQEKTLNLKKSFRKNIFKGRRLNIFEPQAVTEEAPETEAVPSLWDIEFAKQLAAVTERPFQNGFEEMIQWTKEGKLWEFPINNEAGFDDDGSEFHEHIFLDKYLQDFPKQGPIRHFMELVTCGLSKNPYLSVKQKVEHIEWFRNYFNEKRVILKESGIQLN

Entity 30 Entity 30 polymer

Description description	Mitochondrial ribosomal protein S33
Molecular weight formula_weight	12544.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ai

MSSLSEYAVRMSRLSARLFGEVARPTDSKSMKVVKLFSEQPLAKRKETYDWYPNHNTYFALMGTLRFLGLYRDEHQDFRDEQLRLKKLRGKGKPRKGEGKRAMKKK

Entity 31 Entity 31 polymer

Description description	Mitochondrial ribosomal protein S34
Molecular weight formula_weight	25843.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Aj

MARKKVRPRLIAELARRVRALREQRERPRDSQRYALDYETMMRPHSGNRLPMRAWADVRHESRLLQLLNRLPLFGLGRLVTRKSWLWQHDEPCYWRLTRVRPDYAAENLDHGKAWGILTFKGKTESEAREIEQVMYHDWRLVPKHEEEAFTAFTLVPEDTPLSVPYPPLLRAMILAQRQKYGDTSTEEPMLNLERARIDPWDYPAKLEAKTKTKGAAV

Entity 32 Entity 32 polymer

Description description	Mitochondrial ribosomal protein S35
Molecular weight formula_weight	37104.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ak

MAATSLPAWLILKSRAGTFRAFSTAMSPATRSPRPALRTTERTSKPERALRRKALPPRTEKMAVDQDWPSVYPVAAPFKPSAVPLPVRMGYPVKRGVPMAKEGNLELLKIPNFLHLTPVAIKRHCEALKDFCTEWPAALDSDEKCEKHFPIEIDTADYVSAGPSIRNPKARVVTLRVKLSSLNLDDHAKKKLIKLVGDRYCKSTDVLTIKTDRCPLKRQNYDYAVYLLTVLYHESWKTEEWEKKKTEADMEEYIWENSTSEKNILETLLQIKAAEKNLELSKEELLGTKEVEDYRKSVVSLKNEGDNENTLSQYKESVKRLLNLA

Entity 33 Entity 33 polymer

Description description	Mitochondrial ribosomal protein S37
Molecular weight formula_weight	13561.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Am

MATPSLRGRLARLGNPRRPILKPNKPLILANHVGERRREKGEATCITEMSVMMACWKQNEFRDEACRKEIQDFFDCASRAEAARKMRSIQENLGELGSLPPKKLNKLLHRFPNKPHVS

Entity 34 Entity 34 polymer

Description description	Aurora kinase A interacting protein 1
Molecular weight formula_weight	22843.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	An

MFLVRLTSQLLRAVPGAGRSGSPRVSEVLGRHACRPRYSTQPPGPSGIASLPGKHVHPELEEMLVPRKMSISPLESWLTIRYLLPRLGAGTPGTVSPAQLYQCPPSQVGEGVKQGDKEVRDTPQMQCKNILKIRRRKMNHHKYRKLVKRTRFLRRKVREGRLRQKQVKFERDLKRIWQKAGLKEAPAGWQTPKIYLKNQ

Entity 35 Entity 35 polymer

Description description	Mitochondrial ribosomal protein S39
Molecular weight formula_weight	76473.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ao

MAAVASARWLGVRSGLCLPLTGRRVGPCGRTPRSRFYSGSAAHPEVEGANVTGIEEVVIPKKKTWDKVAILQALASTVHRDSTAAPYVFQDDPYLIPTSSVESHSFLLAKKSGENAAKFIINSYPKYFQKDIAEPHIPCLMPEYFEPQIEDVSEAALQERIKLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTWRTKNNAERIFALMPEKNAHSYCTMIRGMVKHQAPTQALNLYTVLLNNRLRADVYTFNSLIEATALVVNEKFEEKWNNILDLLKQMVTQNVKPNLQTFNTILKCLRRFYAFGKLPALQTLREMKAIGIEPSLATYHYVIQLFYQHESPSKGSSLIIYDIMNEVMGKRFSPRDPDDDMFFQSAMRVCSSLRDLELAYQVHGLLNTGDNWKLIGSDHRRNFYYSKFFNLLCFMEQIDVTLKWYKDLIPSVFFPHSQTMIDLLQALDVANRLDMVPQIWKDSKEYGHTFRNELKEEILMLMARDQHPPELQVAFADCAADIKSTYESQDARQTAPEWPASSLNYVAVLFLRAGRTQEAWKMLGLFRKHNKIPRAELLNEFLDSAKASSSPAQAIELVKLASAFSLPVCEGLTRRVMAEFTLTQEQREALGELTALTSDSSSDSDSDSDSDISEGK

Entity 36 Entity 36 polymer

Description description	28S ribosomal protein S18b, mitochondrial
Molecular weight formula_weight	29220.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ap

MAASILNVLLRRLPGVSPFRGAYGVQVLLQTLCTKAPPEDDSLPQVPISPYKDEPWKYLDSEEYQNRYGSRPVWADYRRNHKGGIPPQRTRKMCIRGNKVAGNPCPICRDQKLHVDFRNVKLLEQFVCAHTGIIFHAPYTGVCMKQHKKLTQAIQKARDHGLLRYHIPQVEPRDLDFSTTHGAVSSTPPAPTLVSGDPWYPWYSWKQPPERELSRLRRLYQGRLREESGPPPELMPEVPLTAPAEASSTEPGAPQSAL

Entity 37 Entity 37 non-polymer

Description description	5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE
Molecular weight formula_weight	539.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 38 Entity 38 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	111

Entity 39 Entity 39 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 40 Entity 40 non-polymer

Description description	SPERMINE
Molecular weight formula_weight	202.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 41 Entity 41 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 42 Entity 42 non-polymer

Description description	N-FORMYLMETHIONINE
Molecular weight formula_weight	177.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 43 Entity 43 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 44 Entity 44 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	5

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	139206

Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 28S ribosomal subunit.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Translation initiation factor IF-2, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial ribosomal protein L19

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial ribosomal protein S2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial ribosomal protein S24

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial ribosomal protein S5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial ribosomal protein S6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial ribosomal protein S7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial ribosomal protein S9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial ribosomal protein S10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial ribosomal protein S11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer