8oip

28S mammalian mitochondrial small ribosomal subunit with mtRF1 and P-site tRNA

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

39S ribosomal protein L19, mitochondrial

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LNJ0_PIG
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain BX； PDBConstruct 1–303； UniProt 1–303

bL31m

OrganismNot specified

UniProt I3L9J0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3L9J0_PIG
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain Bd； PDBConstruct 1–126； UniProt 1–126

28S ribosomal protein S35, mitochondrial isoform 1

OrganismNot specified

UniProt F1SG95

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SG95_PIG
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain AB； PDBConstruct 1–366； UniProt 1–366

Mitochondrial ribosomal protein S24

OrganismNot specified

UniProt A0A287ANU4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287ANU4_PIG
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain AC； PDBConstruct 1–167； UniProt 1–167

Aurora kinase A interacting protein 1

OrganismNot specified

UniProt A0A287B3R8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287B3R8_PIG
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain AD； PDBConstruct 1–199； UniProt 1–199

bS6m,Mitochondrial ribosomal protein S6

OrganismNot specified

UniProt A0A4X1TSM9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1TSM9_PIG
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain AE； PDBConstruct 129–376； UniProt 28–275

Mitochondrial ribosomal protein S7

OrganismNot specified

UniProt A0A286ZJ25

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZJ25_PIG
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain AF； PDBConstruct 1–242； UniProt 1–242

Mitochondrial ribosomal protein S10

OrganismNot specified

UniProt F1RUU2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RUU2_PIG
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain AH； PDBConstruct 1–200； UniProt 1–200

Mitochondrial ribosomal protein S12

OrganismNot specified

UniProt A0A0M3KL52

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M3KL52_PIG
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain AJ； PDBConstruct 1–139； UniProt 1–139

Mitochondrial ribosomal protein S14

OrganismNot specified

UniProt A0A0M3KL53

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M3KL53_PIG
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain AK； PDBConstruct 1–128； UniProt 1–128

28S ribosomal protein S15, mitochondrial

OrganismNot specified

UniProt A0A287AKS1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287AKS1_PIG
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain AL； PDBConstruct 1–259； UniProt 1–259

28S ribosomal protein S16, mitochondrial

OrganismNot specified

UniProt A0A480JTD7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A480JTD7_PIG
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain AM； PDBConstruct 1–135； UniProt 1–135

uS17m

OrganismNot specified

UniProt F1RIU0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RIU0_PIG
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain AN； PDBConstruct 1–130； UniProt 1–130

28S ribosomal protein S18b, mitochondrial

OrganismNot specified

UniProt Q767K8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RT18B_PIG
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain AO； PDBConstruct 1–258； UniProt 1–258

Mitochondrial ribosomal protein S18C

OrganismNot specified

UniProt A0A0M3KL54

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M3KL54_PIG
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain AP； PDBConstruct 1–143； UniProt 1–143

28S ribosomal protein S21, mitochondrial

OrganismNot specified

UniProt A0A286ZNB3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZNB3_PIG
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain AQ； PDBConstruct 1–87； UniProt 1–87

Mitochondrial ribosomal protein S22

OrganismNot specified

UniProt A0A287AQT5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287AQT5_PIG
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain AR； PDBConstruct 1–382； UniProt 1–382

mS23

OrganismNot specified

UniProt A0A287AEW3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287AEW3_PIG
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain AS； PDBConstruct 1–190； UniProt 1–190

Mitochondrial ribosomal protein S25

OrganismNot specified

UniProt A0A0M3KL55

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M3KL55_PIG
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain AT； PDBConstruct 1–173； UniProt 1–173

Mitochondrial ribosomal protein S26

OrganismNot specified

UniProt A0A287AY01

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287AY01_PIG
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain AU； PDBConstruct 1–205； UniProt 1–205

Mitochondrial ribosomal protein S27

OrganismNot specified

UniProt A0A5G2R1I0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A5G2R1I0_PIG
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain AV； PDBConstruct 1–395； UniProt 1–395

Mitoribosomal protein ms28, mrps28

OrganismNot specified

UniProt A0A0M3KL56

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M3KL56_PIG
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain AW； PDBConstruct 1–188； UniProt 1–188

Death associated protein 3

OrganismNot specified

UniProt I3LS10

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LS10_PIG
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain AX； PDBConstruct 1–410； UniProt 1–410

28S ribosomal protein S31, mitochondrial

OrganismNot specified

UniProt F1RME2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RME2_PIG
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain AY； PDBConstruct 1–381； UniProt 1–381

Mitochondrial ribosomal protein S33

OrganismNot specified

UniProt F1S8G3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1S8G3_PIG
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain AZ； PDBConstruct 1–148； UniProt 1–148

Peptide chain release factor 1, mitochondrial

Homo sapiens

UniProt O75570

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RF1M_HUMAN
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain Aa； PDBConstruct 1–445； UniProt 1–445

Mitochondrial ribosomal protein S2

OrganismNot specified

UniProt F1S001

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1S001_PIG
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain Ab； PDBConstruct 1–289； UniProt 1–289

Coiled-coil-helix-coiled-coil-helix domain containing 1

OrganismNot specified

UniProt F1SU49

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SU49_PIG
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain Ac； PDBConstruct 1–118； UniProt 1–118

28S ribosomal protein S5, mitochondrial isoform X2

OrganismNot specified

UniProt F1SU66

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SU66_PIG
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain Ad； PDBConstruct 1–430； UniProt 1–430

mS39

OrganismNot specified

UniProt K7GKS8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	K7GKS8_PIG
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain Ae； PDBConstruct 1–692； UniProt 1–692

uS9m

OrganismNot specified

UniProt I3LU08

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LU08_PIG
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain Ag； PDBConstruct 1–397； UniProt 1–397

Mitochondrial ribosomal protein S11

OrganismNot specified

UniProt A0A286ZJJ6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZJJ6_PIG
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain Ai； PDBConstruct 1–196； UniProt 1–196

Mitochondrial ribosomal protein S34

OrganismNot specified

UniProt A0A287AVS9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 33 RNA 3	39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） bL31m × 1 （I3L9J0） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） bS6m,Mitochondrial ribosomal protein S6 × 1 （A0A4X1TSM9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） MAGNESIUM ION × 127 SPERMINE × 1 SPERMIDINE × 1 POTASSIUM ION × 11 ZINC ION × 1 FE-S-O HYBRID CLUSTER × 2 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287AVS9_PIG
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain Aj； PDBConstruct 1–505； UniProt 1–505

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8oip
Deposition date deposition_date	2023-03-23
Structure title title	28S mammalian mitochondrial small ribosomal subunit with mtRF1 and P-site tRNA
Keywords keywords	mammalian mitochondrial ribosome, release factor mtRF1, non-canonical stop codon, RIBOSOME; RIBOSOME
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8oip__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8oip__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8oip__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	73.13 Å
Rg (electron density)	76.80 Å
Total Rg	76.25 Å
Atom count	72358
Residues	7193
Excluded volume	1210300 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8oip__assembly_1__model_1`	36-meric （36）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (45)

Entity 1 Entity 1 polymer

Description description	39S ribosomal protein L19, mitochondrial
Molecular weight formula_weight	34528.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BX
Atom count atom_count	72369

MGVVVSTQRAGMAASITRGSWAAVGLGQSFPPTRALLPAPASVICRTLAGSGRQQVTGSSEPGAFQPPPKPVIVDKRRPQRPETRFLSPEFIPPRGRTNPLKFQIERKDMLERRKILHIPEFYVGSILRVTTADPYASAKTSQFLGICIQRSGSGLGATFILRNTIEGQGVEICFELYNPRIQEIQVVKLEKRLDNSLLYLRDALPEYSTFDVNMKPITQEFNQEVPVNQLKVKMKPKPWSKRWERPKFNIKGIRFDLCLTEEQMREAQKWSQPWLEFDMMREYDTSKIEAAIWDEIEASKNS

Entity 2 Entity 2 polymer

Description description	bL31m
Molecular weight formula_weight	15156.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bd

MAAKGSLLRLLWQRVVTGAAPESCRHLYTSSWRADCNRALLTRLHRQTYARLYPVLLVKQDGSTIHIRYREPRRMLTMPVDLDSLSPEERRARFRKREAKFKEKKEEPELSDDFDVEQYKRFWTKK

Entity 3 Entity 3 polymer

Description description	12S rRNA
Molecular weight formula_weight	309087.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	AA

ACACAGGUUUGGUCCUGGCCUUUCUAUUAAUUCUUAAUAAAAUUACACAUGCAAGUAUCCGCGCCCCGGUGAGAAUGCCCUCCAGAUCUUAAAGAUCAAAAGGAGCAGGUAUCAAGCACACCUAUAACGGUAGCUCAUAACGCCUUGCUCAACCACACCCCCACGGGAAACAGCAGUGAUAAAAAUUAAGCCAUGAACGAAAGUUUGACUAAGUUAUAUUAAUUAGAGUUGGUAAAUCUCGUGCCAGCCACCGCGGUCAUACGAUUAACCCAAAUUAAUAGAUCCACGGCGUAAAGAGUGUUUAAGAAAAAAAAUCACAAUAGAGUUAAAUUAUAACUAAGCUGUAAAAAGCCCUAGUUAAAAUAAAAUAACCCACGAAAGUGACUCUAAUAAUCCUGACACACGAUAGCUAGGACCCAAACUGGGAUUAGAUACCCCACUAUGCCUAGCCCUAAACCCAAAUAGUUACAUAACAAAACUAUUCGCCAGAGUACUACUCGCAACUGCCUAAAACUCAAAGGACUUGGCGGUGCUUCACAUCCACCUAGAGGAGCCUGUUCUAUAAUCGAUAAACCCCGAUAGACCUUACCAACCCUUGCCAAUUCAGCCUAUAUACCGCCAUCUUCAGCAAACCCUAAAAAGGAACAAUAGUAAGCACAAUCAUAGCACAUAAAAACGUUAGGUCAAGGUGUAGCUUAUGGGUUGGAAAGAAAUGGGCUACAUUUUCUACAUAAGAAUAUCCACCACACGAAAGUUUUUAUGAAACUAAAAACCAAAGGAGGAUUUAGCAGUAAAUCAAGAAUAGAGUGCUUGAUUGAAUAAGGCCAUGAAGCACGCACACACCGCCCGUCACCCUCCUCAAGCAUGUAGUAAUAAAAAUAACCUAUAUUCAAUUACACAACCAUGCAAGAAGAGACAAGUCGUAACAAGGUAAGCAUACUGGAAAGUGUGCUUGGAUUACC

Entity 4 Entity 4 polymer

Description description	28S ribosomal protein S35, mitochondrial isoform 1
Molecular weight formula_weight	41357.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AB

MITVSCSRGGRARHVSLRSRASGPPVDSLRACPLPLAVCADMAATSLPAWLILKSRAGTFRAFSTAMSPATRSPRPALRTTERTSKPERALRRKALPPRTEKMAVDQDWPSVYPVAAPFKPSAVPLPVRMGYPVKRGVPMAKEGNLELLKIPNFLHLTPVAIKRHCEALKDFCTEWPAALDSDEKCEKHFPIEIDTADYVSAGPSIRNPKARVVTLRVKLSSLNLDDHAKKKLIKLVGDRYCKSTDVLTIKTDRCPLKRQNYDYAVYLLTVLYHESWKTEEWEKKKTEADMEEYIWENSTSEKNILETLLQIKAAEKNLELSKEELLGTKEVEDYRKSVVSLKNEGDNENTLSQYKESVKRLLNLA

Entity 5 Entity 5 polymer

Description description	Mitochondrial ribosomal protein S24
Molecular weight formula_weight	18935.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AC

MVASVCGGGLRPLVLSWSRELPCAWRALHISAVCAKNRAARVRVSKGDKPVTYEEAHAPHYIAHRKGWLSLHTGNLDGEDHAAERTVEDVFLRKFMLGTFPGCLADQLVLKRRANQLEICALVLRQLPPHKFYFLVGYSETLLSHFYKCPVHLHLQTVPSKVVYKYI

Entity 6 Entity 6 polymer

Description description	Aurora kinase A interacting protein 1
Molecular weight formula_weight	22843.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AD

MFLVRLTSQLLRAVPGAGRSGSPRVSEVLGRHACRPRYSTQPPGPSGIASLPGKHVHPELEEMLVPRKMSISPLESWLTIRYLLPRLGAGTPGTVSPAQLYQCPPSQVGEGVKQGDKEVRDTPQMQCKNILKIRRRKMNHHKYRKLVKRTRFLRRKVREGRLRQKQVKFERDLKRIWQKAGLKEAPAGWQTPKIYLKNQ

Entity 7 Entity 7 polymer

Description description	bS6m,Mitochondrial ribosomal protein S6
Molecular weight formula_weight	41085.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AE

MGYDPSPVAHSLRLTPTTLGKGPQEAALAAALEHRAVGRGGRGSTPRVYPAGAARGRRPKRERSGTRMRGQSRGKGARTDQTAPQRTRTRGRTLARSSPRMRRKAWKVPAGSRTIRSKRGGSGSCRVGGVCSSRWQLAEGTRGAALLQWLPGQGAGPRAGCRPQRAGLSRGRGAAALRRGRGVARGGAWLGEGAWRPVCAAARAFKPGLARPERAFAAWEPSGPAVRQVSAVPALFHPGRRFREEPRAVHSGMPRYELALILKAMQRPETAAALKRTLEALMDRGAVVRNLENLGERMLPYKISAHNQRHSRGGYFLVDFYAPATTVESMMEHLSRDIDVIRPNIVKHPLTQEVKECEGIVPVPLEEKLYSTKKRK

Entity 8 Entity 8 polymer

Description description	Mitochondrial ribosomal protein S7
Molecular weight formula_weight	28150.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AF

MAAPAVKAARGWSCSALGVRIAVLRFPGLTQVRWSRYGPEYKDPQIDKEYYRKPLAEQTEEEKYERDFKKTQLIKAAPATKTSSVFEDPVISKFTNMMMKGGNKVLARSLMTQTLEAVKRKQFAKYHAASAEEQATIERNPYTIFHQALKNCEPVIGLVPILKGGHFYQVPVPLADRRRRFLAMKWMIAECREKKHRRVLMPEKLSQELLEAFHNQGPVIKRKHDMHKMAEANRALAHYRWW

Entity 9 Entity 9 polymer

Description description	P-site Met-tRNA(fMet)
Molecular weight formula_weight	22823.7 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	AG

AGUAAGGUCAGCUAAAUAAGCUAUCGGGCCCAUACCCCGAAAAUGUUGGUUAUACCCUUCCCGUACUACCAM

Entity 10 Entity 10 polymer

Description description	Mitochondrial ribosomal protein S10
Molecular weight formula_weight	23105.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AH

MAARTAFGALARRLWQGSRNFSVSSSRSSTAKNGGFLLTTMKWVQFSNLHVDVPKDMTKPEITISDEPDTLYKRLSVLVKGHDKAVLDSYEYFAVLAAKELGISIKVHEPPRKIERFTLLKSVHIFKKHRVQYEMRTLYRCLELEHLTGSTADVYLEYIQRNLPEGVAMEVTKTKLEQLPEHIRKPIWETMPEEKEESKS

Entity 11 Entity 11 polymer

Description description	mRNA
Molecular weight formula_weight	2902.8 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	AI

AAUGAGACA

Entity 12 Entity 12 polymer

Description description	Mitochondrial ribosomal protein S12
Molecular weight formula_weight	15257.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AJ

MSWSGLLRGLGTSLNCGLALVPRPWATRPMATLNQMHRLGPPKHPPGKMGPTAGRPQLKGVVLRTFIRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHSLQEHHVVLVQGGRTQDLPGVKLTVVRGKYDCGHVQKKK

Entity 13 Entity 13 polymer

Description description	Mitochondrial ribosomal protein S14
Molecular weight formula_weight	15120.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AK

MAASMLGFLLRTVRQMVPSSASGQVRSYYVDWKMLRDVKRRKMAYEYADERLRINSLRKNTILPKDLQEVADEEIASLPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGVQRAMW

Entity 14 Entity 14 polymer

Description description	28S ribosomal protein S15, mitochondrial
Molecular weight formula_weight	29596.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AL

MLRAAWRALSSIRTQAVTQAPVLGLPGGGCARFPSVQRALPSRPAGLILRAARGYAAQKPGEEQGLTGEDRLISHCLCLNIQPNQDDPPPSMLLLDYQNVPGIHKVDDVVKRLLSLEMANQKEKLKIKKMQLMNKVLENPEDTSSLEARIVALTVKIRNYEEHMQKHRKDKAHKRFLLMSIDQRKKMLKNLRETNYAVFEKICKELGIEYTFPPPYHRKAHRRWVTKKALCTQVFREVQKLKKQKRALRAAAVAAHKQG

Entity 15 Entity 15 polymer

Description description	28S ribosomal protein S16, mitochondrial
Molecular weight formula_weight	15182.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AM

MVQLTTVLCRAYRGGHLTIRLALGGCTNRPFYRIVAAHSKCPRDGRFVEQLGSYDPLPNSHGEKLVALNFDRIRHWIGCGAHLSKPVEKLLGLSGFYPLHPMMITNAERLRRKRAREVLLASQKTDTEATETKAS

Entity 16 Entity 16 polymer

Description description	uS17m
Molecular weight formula_weight	14452.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AN

MSIARSSVHAKWVVGKVIGTAMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTVGDIVLLKALPVPRTKHVKHELAEIIFKVGQVIDPVTGKPCAGTTYLESPISPESTRLTKNLEALQLSSTQ

Entity 17 Entity 17 polymer

Description description	28S ribosomal protein S18b, mitochondrial
Molecular weight formula_weight	29220.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AO

MAASILNVLLRRLPGVSPFRGAYGVQVLLQTLCTKAPPEDDSLPQVPISPYKDEPWKYLDSEEYQNRYGSRPVWADYRRNHKGGIPPQRTRKMCIRGNKVAGNPCPICRDQKLHVDFRNVKLLEQFVCAHTGIIFHAPYTGVCMKQHKKLTQAIQKARDHGLLRYHIPQVEPRDLDFSTTHGAVSSTPPAPTLVSGDPWYPWYSWKQPPERELSRLRRLYQGRLREESGPPPELMPEVPLTAPAEASSTEPGAPQSAL

Entity 18 Entity 18 polymer

Description description	Mitochondrial ribosomal protein S18C
Molecular weight formula_weight	16211.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AP

MAAVVSLCSRLGRRKSTDFVNAAVCLTDPGTHAVLWRSCSQYKQVASNEDLPVPMENPYKEPLKKCILCEKHVDYKNVQLLSQFISPFTGCIYGRHITGLCGKKQKEITKAIKRAQILGFMPVTYKDPAYLKDPKVCNIKYRE

Entity 19 Entity 19 polymer

Description description	28S ribosomal protein S21, mitochondrial
Molecular weight formula_weight	10724.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AQ

MANHLKFIARTVMVQEGNVEGAYRTLNRILTMDGLIEDIKRRRYYEKPCRRRQRESYETCRRIYNMEMARKINFLMRKNRADPWQGC

Entity 20 Entity 20 polymer

Description description	Mitochondrial ribosomal protein S22
Molecular weight formula_weight	43234.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AR

MPHEPRETRNLSLPLPALVARIIMATLKASALLRSLQTNSCGTGRVCFPVRARPRPRALLQPLPGASGTGTLCRGLGSESESGNSEIRKPTFMDEEVQNILIKMTGLDLQKIFKPALQELKPPTYKLMTQAQLEEATKQAVEAAKVRLKMPPVLEERAPINDVLAEDKILEGTETAKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVYFPREGRRILTPVIFKEENLQTMYSQDQHVDVLNLCVAQFEPDSAEYIKIHHHTYEDIDKCGKYDLLRSTRHFGGMAWYFVNKKKIDGLLIDQIQRDLVSDATSLVHLYHILHPDGQSAQEAKKQGAEGLHLIKVFAKTEAQKGAYIELTLQAYQEAFITHSAAS

Entity 21 Entity 21 polymer

Description description	mS23
Molecular weight formula_weight	21666.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AS

MAGSRLETVGSIFSRTRDLIRAGVLKEKPLWLDIYNAFPPLREPVFRRPRLRYGKAKAAVQDIFYHEDRIRAKFYSAYGSGPKAFDLFNPNFKSTCQRFVEKYIELQRLGETDEEKLFVEAGKALLAEGVTLRRVGEARTQQEGSPISRKSEPTGIKPQTAVEENQPWKEVPQDQPLEAPEKESKGLPPP

Entity 22 Entity 22 polymer

Description description	Mitochondrial ribosomal protein S25
Molecular weight formula_weight	19954.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AT

MPMKGRFPIRRTLQYLGQGDVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQITMFKNMTPSPFLRFYLDSGEQVLVDVESKSNKEIVEHIRKILGKNEETLEKEEQEKKQLSHPAHFGPRKYCLRECMCEVEGQVPCPGLVPLPKEMTGKYKAALKATAQD

Entity 23 Entity 23 polymer

Description description	Mitochondrial ribosomal protein S26
Molecular weight formula_weight	23637.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AU

MLRVLGGLGARPAGRLPAPLLLPTRGRKTRHDPPAKSKAGRVATPPAVDPTEFFVLTERYRQYRQTVRALRLEFMSEVRKKLHEARAGVQAERKAQEDAAEHRELMAWNQAENQRLHELRLARLRQEALEQERRQAEEAVLQAREAQAWAQLKEQEVLQLQEEAKTFITRENLEARVEEALDSPKSYNWAITREGLVVRPQQKGS

Entity 24 Entity 24 polymer

Description description	Mitochondrial ribosomal protein S27
Molecular weight formula_weight	45761.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AV

VVKSCRRCLLSAAYVDSHKWEARDKEDCHLADLASLMDKTYERKLPVSSLTISRFVDNIASREDIDHAEYYLYKFRHSPNCWYLRDWTIHTWIRQCLKYGAQDKALYTLKNKVQYGIFPDNYTFNLLMDYFIKKENYKDALSVVFEIMMQEAFEVPSTQLLSLYVLYHCLAEKTDLSWEEERNFGASLLLPGLKQKNSVGLSSQLYGYALLGKVELQQGLRAVYCNMPLLWQPGYLHRALQVMEKVASSPEDGQLCGEALDVLDRVLKAVTAPAQGTSEEQPQEGEESQRSEELVEQLDVEETEQSKLPQYLERFEALRSKLQALGKVESESLLTLSTQLAKAQLPTCEAEDIAVYEQRLQQWHGERVRLIQREQEQRERARQDYEARRAAKASA

Entity 25 Entity 25 polymer

Description description	Mitoribosomal protein ms28, mrps28
Molecular weight formula_weight	21014.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AW

MAALCRTRAVTAKSHFLRVFFFSRPCRGTGTESGSGSESSESTEPKQRPGGFASALERHSELQQKAEFGRMRGSPKNVESFASMLRHSPLTQMGPAKNKLVIGQIFHIVEDDLYIDFGGKFHCVCKRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTILEADAVLLGLQESKDSKSKEERHEK

Entity 26 Entity 26 polymer

Description description	Death associated protein 3
Molecular weight formula_weight	46966.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AX

MAQLLANLTSIQVMLKGVTRLISRVHKLDPGHVLYMGTQAPQSLAAHLDNQVPVKSPRAISRTSEDDPAKHREQHEGQHYNISLQELKTVFPHGLPPRFAMQVKTFNEACLMVRKPALELLHYLKNTNFAHPAVRYVLYGEKGTGKTLSLCHILHFCAKQNWLILHIPDAHIWVKNCRDLLQSNYNKQRFDQPLEASTWLKNFKTANEHFLSQIKVQEKYVWNKRESTEKGRPLGEVVEQGIMRVRNATDAVGIVLKELKRQSSLGIFHLLVAVDGVNALWGRTTLKREDKSPIAPEELALIHNLRKMVKNDWQGGAIVLTVSQTGSLFKPRNAYLPQELLGKEGFDALDPFIPILVSNYNPKEFESCIQYYLENNWLQHEKAHTEEGKKELLFLSNRNPGQLERLCAYL

Entity 27 Entity 27 polymer

Description description	28S ribosomal protein S31, mitochondrial
Molecular weight formula_weight	43516.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AY

MLPRVSAVIPLRPLSRLPLCSGGPEASAAAILLLDSLRGTVRTENNIQRYFGTNNLVYSKKDEQSGPTCEISKETESKGSVKENSKKDLLNIIKGMKVELSTVNVQTTKPSNKRQLKNLETAIGRIKKAPEDTPQKRSESLSSELVAAVSAVADSLPFDRRMTKSELLRQLQKHEEDSRDKKKKLIFSNIISDMKVARSATARVSTRPVHQIQFDEGTDDFADQEKTLNLKKRKNIFKGRRLNIFEPQAVTEEAPETEAVPSLWDIEFAKQLAAVTERPFQNGFEEMIQWTKEGKLWEFPINNEAGFDDDGSEFHEHIFLDKYLQDFPKQGPIRHFMELVTCGLSKNPYLSVKQKVEHIEWFRNYFNEKRVILKESGIQLN

Entity 28 Entity 28 polymer

Description description	Mitochondrial ribosomal protein S33
Molecular weight formula_weight	16971.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AZ

MRDGFRAPAEVSSLVESPRIGRINFINQLGGLTGTLAPAAQEMSSLSEYAVRMSRLSARLFGEVARPTDSKSMKVVKLFSEQPLAKRKETYDWYPNHNTYFALMGTLRFLGLYRDEHQDFRDEQLRLKKLRGKGKPRKGEGKRAMKKK

Entity 29 Entity 29 polymer

Description description	Peptide chain release factor 1, mitochondrial
Molecular weight formula_weight	55569.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Aa

MNRHLCVWLFRHPSLNGYLQCHIQLHSHQFRQIHLDTRLQVFRQNRNCILHLLSKNWSRRYCHQDTKMLWKHKALQKYMENLSKEYQTLEQCLQHIPVNEENRRSLNRRHAELAPLAAIYQEIQETEQAIEELESMCKSLNKQDEKQLQELALEERQTIDQKINMLYNELFQSLVPKEKYDKNDVILEVTAGRTTGGDICQQFTREIFDMYQNYSCYKHWQFELLNYTPADYGGLHHAAARISGDGVYKHLKYEGGIHRVQRIPEVGLSSRMQRIHTGTMSVIVLPQPDEVDVKLDPKDLRIDTFRAKGAGGQHVNKTDSAVRLVHIPTGLVVECQQERSQIKNKEIAFRVLRARLYQQIIEKDKRQQQSARKLQVGTRAQSERIRTYNFTQDRVSDHRIAYEVRDIKEFLCGGKGLDQLIQRLLQSADEEAIAELLDEHLKSAKGGSGGSGDYKDHDGDYKDHDIDYKDDDDK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 30 Entity 30 polymer

Description description	Mitochondrial ribosomal protein S2
Molecular weight formula_weight	31731.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ab

MASGPLLPRLLGAGAPRRPLRLHLVPTATPGPAGPTGRTLGSNAAPAAREPELGNDLRDRILSEPLKHADFFNLKELFSVRSLFDARVHLGHKAGCRHRFMEPYLFGSRLGQDIIDLEQTAAHLQLALNFTAHVAYREGIILFVSRHRQFAHLIETTARDCGEYAHTRYFKGGLLTNAPLLLGPGVRLPDLIIFLHTLNNVFEPHVAVRDAAKMNIPTVGIVDTNCNPALITYPVPGNDDSPPAVRLFCRLFQVAISRAKEKRRQVEALYRLQGPAGAERGPAAPPPPE

Entity 31 Entity 31 polymer

Description description	Coiled-coil-helix-coiled-coil-helix domain containing 1
Molecular weight formula_weight	13603.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ac

MATPSLRGRLARLGNPRRPILKPNKPLILANHVGERRREKGEATCITEMSVMMACWKQNEFRDEACRKEIQDFFDCASRAEAARKMRSIQENLGELGSLPPKKLNKLLHRFPNKPHVS

Entity 32 Entity 32 polymer

Description description	28S ribosomal protein S5, mitochondrial isoform X2
Molecular weight formula_weight	48213.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ad

MAAAVRAAGFFPGLFGASAGNLWSRQLYLNTFPAASILTSKTFPSNGPLSPPGTRDNHHFTSLACALQTQCSISSPSNWMGQQYRSYSFFTKLTADELWKGALAESGAGARKGRGKRTKKKRRKDLNRGQIIGEGRHGFLWPGLNIPLMRNGAVQTIAQRSKEDQEKVEADMVQQREEWDRRRKMKVKRERGWSGNTWGGVSLGPPDPGPNGETYDDFDTRILEVRNVFNMTAKEGRKRSVRVLVAVGNGKGAAGFAIGKATERADAFRKAKNRAVHYLHYIERYEDHTIYHDISLKFKRTHIKMKKQPRGYGLHCHRAIMTICRLIGIKDLYAKVSGSVNMLNLTRGLFLGLSRQETHQQLADKKSLHVVEFREECGPLPIVVASPQGALRKDPEPEDEVPDITLDWEDVKAAQGMKRSVWSGLKRAAT

Entity 33 Entity 33 polymer

Description description	mS39
Molecular weight formula_weight	78518.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ae

MAAVASARWLGVRSGLCLPLTGRRVGPCGRTPRSRFYSGSAAHPEVEGANVTGIEEVVIPKKKTWDKVAILQALASTVHRDSTAAPYVFQDDPYLIPTSSVESHSFLLAKKSGENAAKFIINSYPKYFQKDIAEPHIPCLMPEYFEPQIEDVSEAALQERIKLRKVKASVDMFDQLLQAGTTVSLETTNSLLDLLCYYGNQEPSANYNFQQREQSEELEEATEADNEKSKTKAGHHLGVTWRTKNNAERIFALMPEKNAHSYCTMIRGMVKHQAPTQALNLYTVLLNNRLRADVYTFNSLIEATALVVNEKFEEKWNNILDLLKQMVTQNVKPNLQTFNTILKCLRRFYAFGKLPALQTLREMKAIGIEPSLATYHYVIQLFYQHESPSKGSSLIIYDIMNEVMGKRFSPRDPDDDMFFQSAMRVCSSLRDLELAYQVHGLLNTGDNWKLIGSDHRRNFYYSKFFNLLCFMEQIDVTLKWYKDLIPSVFFPHSQTMIDLLQALDVANRLDMVPQIWKDSKEYGHTFRNELKEEILMLMARDQHPPELQVAFADCAADIKSTYESQDARQTAPEWPASSLNYVAVLFLRAGRTQEAWKMLGLFRKHNKIPRAELLNEFLDSAKASSSPAQAIELVKLASAFSLPVCEGLTRRVMAEFTLTQEQREALGELTALTSDSSSDSDSDSDSDISEGK

Entity 34 Entity 34 polymer

Description description	uS9m
Molecular weight formula_weight	45604.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ag

MAAPCVFCGAAVSYRLFLGCRVSFARGQVLWKAAAPELQAGARCQILRLRHTAVVTTKKNVAASRRETYTVDFIKKQIEEFNIGKRHLANMMGEDPETFTQEDIDRAIAYLFPSGLFEKRARPIMKHPEEIFPKQRAIQWGEDGRPFHFLFYTGKQSYYSLMHDTYGKLLDVEKHHNQLRAKDLLAEKTKILKDPIGSRWLIKEELEEMLVEKLSDQDYAQFIRLLERLSALPCGATEEDFVNRFRRSIPIQSKKQLIEPLQYDEQGMAFSRGEGKRKTAKAEVVVYGQGSGRIDVNGVDYLLYFPVTQDREQLMFPLHFLDRLGKHDMTCAVSGGGRSAQAGAVRLAMARALCSFVTEDEVEWMRQAGLLTADPRVRERKKPGQEGARRKFTWKKR

Entity 35 Entity 35 polymer

Description description	Mitochondrial ribosomal protein S11
Molecular weight formula_weight	20856.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ai

MQVVRNAGSRLLQSWAWPPKTRIVAGLPASTIHRSAPHLQDAAAKLDIEDKEEARTPSHSSFSIYPPIPGQENSLRWAGKKFEEIPIAHIKASYNNTQIQVVSAAHQPLAHASCGTEGFRNAKKGTGIAAQTAGIAAAAKATGKGVTHVRVVVKGLGPGRLSAIKGLTMGGLEVISITDNTPIPHXGCRPRKARRL

Entity 36 Entity 36 polymer

Description description	Mitochondrial ribosomal protein S34
Molecular weight formula_weight	55714.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Aj

MRERRLLGRVTQDTHTGRARIWLHSAPPEAPGRALGLHTVLTAQGVQGLHQDVGSSIFQDGWDGERRVSCHSFFSPRRDTTGVRRADPQPRQHVDKTLIGSGSQSAGPSVSSSSPTGKPAPVPGRLTAFREALPCRSQADYHLSGLRGTSEESIPPPAAHWARPHLGPRAPPGAARPARVAAAAVPWPPPCAPPPGPGRSRRPRAGGTLGVRVRDLPGRGPPRSPAPAPARAPGPPSSSVGHGPPGLFCASGRARTPLRETPAASGIGRARRRAAASSGQSTEAPAAMARKKVRPRLIAELARRVRALREQRERPRDSQRYALDYETMMRPHSGNRLPMRAWADVRHESRLLQLLNRLPLFGLGRLVTRKSWLWQHDEPCYWRLTRVRPDYAAENLDHGKAWGILTFKGKTESEAREIEQVMYHDWRLVPKHEEEAFTAFTLVPEDTPLSVPYPPLLRAMILAQRQKYGDTSTEEPMLNLERARIDPWDYPAKLEAKTKTKGAAV

Entity 37 Entity 37 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	127

Entity 38 Entity 38 non-polymer

Description description	SPERMINE
Molecular weight formula_weight	202.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 39 Entity 39 non-polymer

Description description	SPERMIDINE
Molecular weight formula_weight	145.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 40 Entity 40 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	11

Entity 41 Entity 41 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 42 Entity 42 non-polymer

Description description	FE-S-O HYBRID CLUSTER
Molecular weight formula_weight	335.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 43 Entity 43 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 44 Entity 44 non-polymer

Description description	GUANOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	443.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 45 Entity 45 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	3

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	50622

28S mammalian mitochondrial small ribosomal subunit with mtRF1 and P-site tRNA

1. Protein Identity and Related Structures Protein Identity & Related Structures

39S ribosomal protein L19, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

bL31m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

28S ribosomal protein S35, mitochondrial isoform 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial ribosomal protein S24

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Aurora kinase A interacting protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

bS6m,Mitochondrial ribosomal protein S6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial ribosomal protein S7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial ribosomal protein S10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial ribosomal protein S12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial ribosomal protein S14

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer