7nsj

55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mitochondrial ribosomal protein L27

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RT79_PIG
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B0； PDBConstruct 1–148； UniProt 1–148

Mitochondrial ribosomal protein L28

OrganismNot specified

UniProt A0A286ZTW8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZTW8_PIG
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B1； PDBConstruct 1–256； UniProt 1–256

Mitochondrial ribosomal protein L47

OrganismNot specified

UniProt F1SGC7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SGC7_PIG
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain B2； PDBConstruct 1–252； UniProt 1–252

uL30m

OrganismNot specified

UniProt F1STE5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1STE5_PIG
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain B3； PDBConstruct 1–161； UniProt 1–161

bL31m

OrganismNot specified

UniProt I3L9J0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3L9J0_PIG
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain B4； PDBConstruct 1–126； UniProt 1–126

bL32m

OrganismNot specified

UniProt I3LTC4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LTC4_PIG
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain B5； PDBConstruct 1–188； UniProt 20–207

bL33m

OrganismNot specified

UniProt A0A286ZU68

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZU68_PIG
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain B6； PDBConstruct 1–65； UniProt 1–65

Mitochondrial ribosomal protein L34

OrganismNot specified

UniProt A0A287A119

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287A119_PIG
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain B7； PDBConstruct 1–95； UniProt 1–95

uL2m

OrganismNot specified

UniProt F1RRN2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RRN2_PIG
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain BD； PDBConstruct 1–306； UniProt 1–306

ICT1

OrganismNot specified

UniProt A0A140UHW4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A140UHW4_PIG
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain BE； PDBConstruct 1–399； UniProt 1–399

Mitochondrial ribosomal protein L4

OrganismNot specified

UniProt A0A287B9C4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287B9C4_PIG
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain BF； PDBConstruct 1–294； UniProt 1–294

Mitochondrial ribosomal protein L9

OrganismNot specified

UniProt I3LR45

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LR45_PIG
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain BI； PDBConstruct 1–268； UniProt 1–268

Mitochondrial ribosomal protein L10

OrganismNot specified

UniProt F1RWJ0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RWJ0_PIG
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain BJ； PDBConstruct 1–262； UniProt 1–262

Mitochondrial ribosomal protein L11

OrganismNot specified

UniProt F1RU54

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RU54_PIG
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain BK； PDBConstruct 1–192； UniProt 1–192

uL13m

OrganismNot specified

UniProt K7GP19

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	K7GP19_PIG
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain BN； PDBConstruct 1–178； UniProt 20–197

uL14m

OrganismNot specified

UniProt A0A287BMZ6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287BMZ6_PIG
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain BO； PDBConstruct 1–145； UniProt 181–325

uL15m

OrganismNot specified

UniProt F1RSH0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RSH0_PIG
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain BP； PDBConstruct 1–296； UniProt 1–296

uL16m

OrganismNot specified

UniProt F1RI89

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RI89_PIG
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain BQ； PDBConstruct 1–251； UniProt 1–251

bL17m

OrganismNot specified

UniProt F1RMQ4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RMQ4_PIG
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain BR； PDBConstruct 1–169； UniProt 1–169

Mitochondrial ribosomal protein L18

OrganismNot specified

UniProt A0A286ZNK1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZNK1_PIG
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain BS； PDBConstruct 1–180； UniProt 1–180

Mitochondrial ribosomal protein L19

OrganismNot specified

UniProt I3LNJ0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LNJ0_PIG
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain BT； PDBConstruct 1–292； UniProt 12–303

Mitochondrial ribosomal protein L20

OrganismNot specified

UniProt A0A286ZU56

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZU56_PIG
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain BU； PDBConstruct 1–149； UniProt 1–149

Mitochondrial ribosomal protein L21

OrganismNot specified

UniProt F1RY70

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RY70_PIG
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain BV； PDBConstruct 1–209； UniProt 1–209

uL22m

OrganismNot specified

UniProt F1RQC9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RQC9_PIG
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain BW； PDBConstruct 1–210； UniProt 1–210

uL23m

OrganismNot specified

UniProt A0A286ZZC6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZZC6_PIG
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain BX； PDBConstruct 1–150； UniProt 1–150

uL24m

OrganismNot specified

UniProt F1RHJ1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RHJ1_PIG
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain BY； PDBConstruct 1–216； UniProt 1–216

Mitochondrial ribosomal protein L37

OrganismNot specified

UniProt A0A287BIV6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287BIV6_PIG
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain Ba； PDBConstruct 1–423； UniProt 1–423

Mitochondrial ribosomal protein L38

OrganismNot specified

UniProt F1RW03

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RW03_PIG
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain Bb； PDBConstruct 1–380； UniProt 1–380

Mitochondrial ribosomal protein L39

OrganismNot specified

UniProt F1SHP6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SHP6_PIG
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain Bc； PDBConstruct 1–334； UniProt 1–334

Mitochondrial ribosomal protein L40

OrganismNot specified

UniProt A0A5G2R2V2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A5G2R2V2_PIG
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain Bd； PDBConstruct 1–206； UniProt 1–206

Mitochondrial ribosomal protein L41

OrganismNot specified

UniProt A0A287AWS0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287AWS0_PIG
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain Be； PDBConstruct 1–135； UniProt 1–135

mL42

OrganismNot specified

UniProt A0A287BQA1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287BQA1_PIG
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain Bf； PDBConstruct 1–142； UniProt 1–142

Mitochondrial ribosomal protein L43

OrganismNot specified

UniProt F1S8U4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1S8U4_PIG
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain Bg； PDBConstruct 1–159； UniProt 1–159

mL44

OrganismNot specified

UniProt F1SR64

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SR64_PIG
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain Bh； PDBConstruct 1–332； UniProt 1–332

Mitochondrial ribosomal protein L35

OrganismNot specified

UniProt F1SVC5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SVC5_PIG
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain B8； PDBConstruct 1–188； UniProt 1–188

Mitochondrial ribosomal protein L45

OrganismNot specified

UniProt I3LGM5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LGM5_PIG
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain Bi； PDBConstruct 1–306； UniProt 1–306

Mitochondrial ribosomal protein L46

OrganismNot specified

UniProt F1SRT0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SRT0_PIG
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain Bj； PDBConstruct 1–279； UniProt 1–279

39S ribosomal protein L48, mitochondrial

OrganismNot specified

UniProt A0A480J9Z6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A480J9Z6_PIG
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain Bk； PDBConstruct 1–269； UniProt 1–269

Mrpl34

OrganismNot specified

UniProt A0A0R4J8D6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0R4J8D6_PIG
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain Bl； PDBConstruct 1–166； UniProt 1–166

Mitochondrial ribosomal protein L50

OrganismNot specified

UniProt I3L9H6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3L9H6_PIG
Isoform	—
PDB entities	41
Chains and sequence ranges	Author chain Bm； PDBConstruct 1–198； UniProt 1–198

Mitochondrial ribosomal protein L51

OrganismNot specified

UniProt A0A287BE26

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287BE26_PIG
Isoform	—
PDB entities	42
Chains and sequence ranges	Author chain Bn； PDBConstruct 1–128； UniProt 1–128

mL52

OrganismNot specified

UniProt F1S9B7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1S9B7_PIG
Isoform	—
PDB entities	43
Chains and sequence ranges	Author chain Bo； PDBConstruct 1–124； UniProt 1–124

mL53

OrganismNot specified

UniProt A0A341D604

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A341D604_NEOAA
Isoform	—
PDB entities	44
Chains and sequence ranges	Author chain Bp； PDBConstruct 1–112； UniProt 1–112

mL54

OrganismNot specified

UniProt I3LN63

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LN63_PIG
Isoform	—
PDB entities	45
Chains and sequence ranges	Author chain Bq； PDBConstruct 1–138； UniProt 1–138

Mitochondrial ribosomal protein L57

OrganismNot specified

UniProt A0A287BP93

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287BP93_PIG
Isoform	—
PDB entities	46
Chains and sequence ranges	Author chain Bt； PDBConstruct 1–102； UniProt 1–102

mL62 (ICT1)

OrganismNot specified

UniProt A0A286ZJR2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZJR2_PIG
Isoform	—
PDB entities	47
Chains and sequence ranges	Author chain Bu； PDBConstruct 1–205； UniProt 1–205

mL64

OrganismNot specified

UniProt A0A286ZXA6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZXA6_PIG
Isoform	—
PDB entities	48
Chains and sequence ranges	Author chain Bv； PDBConstruct 1–222； UniProt 1–222

39S ribosomal protein S30, mitochondrial

OrganismNot specified

UniProt A0A480QIM3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A480QIM3_PIG
Isoform	—
PDB entities	49
Chains and sequence ranges	Author chain Bw； PDBConstruct 1–433； UniProt 1–433

Mitochondrial ribosomal protein S18A

OrganismNot specified

UniProt F1RRH6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RRH6_PIG
Isoform	—
PDB entities	50
Chains and sequence ranges	Author chain Bx； PDBConstruct 1–196； UniProt 1–196

Ribosomal protein

OrganismNot specified

UniProt A0A287A731

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287A731_PIG
Isoform	—
PDB entities	52
Chains and sequence ranges	Author chain B9； PDBConstruct 1–100； UniProt 1–100

Mitochondrial ribosomal protein S2

OrganismNot specified

UniProt F1S001

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1S001_PIG
Isoform	—
PDB entities	54
Chains and sequence ranges	Author chain AB； PDBConstruct 1–289； UniProt 1–289

Mitochondrial ribosomal protein S24

OrganismNot specified

UniProt A0A287ANU4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287ANU4_PIG
Isoform	—
PDB entities	55
Chains and sequence ranges	Author chain AC； PDBConstruct 1–167； UniProt 1–167

28S ribosomal protein S5, mitochondrial isoform X2

OrganismNot specified

UniProt F1SU66

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SU66_PIG
Isoform	—
PDB entities	56
Chains and sequence ranges	Author chain AE； PDBConstruct 1–430； UniProt 1–430

bS6m

OrganismNot specified

UniProt I3LEJ9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LEJ9_PIG
Isoform	—
PDB entities	57
Chains and sequence ranges	Author chain AF； PDBConstruct 1–276； UniProt 1–276

Mitochondrial ribosomal protein S7

OrganismNot specified

UniProt A0A286ZJ25

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZJ25_PIG
Isoform	—
PDB entities	58
Chains and sequence ranges	Author chain AG； PDBConstruct 1–242； UniProt 1–242

uS9m

OrganismNot specified

UniProt I3LU08

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LU08_PIG
Isoform	—
PDB entities	59
Chains and sequence ranges	Author chain AI； PDBConstruct 1–397； UniProt 1–397

Mitochondrial ribosomal protein S10

OrganismNot specified

UniProt F1RUU2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RUU2_PIG
Isoform	—
PDB entities	60
Chains and sequence ranges	Author chain AJ； PDBConstruct 1–200； UniProt 1–200

uS11m

OrganismNot specified

UniProt A0A286ZJJ6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZJJ6_PIG
Isoform	—
PDB entities	61
Chains and sequence ranges	Author chain AK； PDBConstruct 1–196； UniProt 1–196

Mitochondrial ribosomal protein S12

OrganismNot specified

UniProt A0A0M3KL52

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M3KL52_PIG
Isoform	—
PDB entities	62
Chains and sequence ranges	Author chain AL； PDBConstruct 1–139； UniProt 1–139

Mitochondrial ribosomal protein S14

OrganismNot specified

UniProt A0A0M3KL53

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M3KL53_PIG
Isoform	—
PDB entities	63
Chains and sequence ranges	Author chain AN； PDBConstruct 1–128； UniProt 1–128

uS15m

OrganismNot specified

UniProt A0A287BMP0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287BMP0_PIG
Isoform	—
PDB entities	64
Chains and sequence ranges	Author chain AO； PDBConstruct 1–239； UniProt 1–239

28S ribosomal protein S16, mitochondrial

OrganismNot specified

UniProt A0A480JTD7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A480JTD7_PIG
Isoform	—
PDB entities	65
Chains and sequence ranges	Author chain AP； PDBConstruct 1–135； UniProt 1–135

uS17m

OrganismNot specified

UniProt F1RIU0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RIU0_PIG
Isoform	—
PDB entities	66
Chains and sequence ranges	Author chain AQ； PDBConstruct 1–130； UniProt 1–130

Mitochondrial ribosomal protein S18C

OrganismNot specified

UniProt A0A0M3KL54

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M3KL54_PIG
Isoform	—
PDB entities	67
Chains and sequence ranges	Author chain AR； PDBConstruct 1–143； UniProt 1–143

bS21m

OrganismNot specified

UniProt A0A286ZNB3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZNB3_PIG
Isoform	—
PDB entities	68
Chains and sequence ranges	Author chain AU； PDBConstruct 1–87； UniProt 1–87

Mitochondrial ribosomal protein S22

OrganismNot specified

UniProt A0A287AQT5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287AQT5_PIG
Isoform	—
PDB entities	70
Chains and sequence ranges	Author chain Aa； PDBConstruct 1–382； UniProt 1–382

mS23

OrganismNot specified

UniProt A0A287AEW3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287AEW3_PIG
Isoform	—
PDB entities	71
Chains and sequence ranges	Author chain Ab； PDBConstruct 1–190； UniProt 1–190

Mitochondrial ribosomal protein S25

OrganismNot specified

UniProt A0A0M3KL55

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M3KL55_PIG
Isoform	—
PDB entities	72
Chains and sequence ranges	Author chain Ac； PDBConstruct 1–173； UniProt 1–173

Mitochondrial ribosomal protein S26

OrganismNot specified

UniProt A0A287AY01

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287AY01_PIG
Isoform	—
PDB entities	73
Chains and sequence ranges	Author chain Ad； PDBConstruct 1–205； UniProt 1–205

Mitochondrial ribosomal protein S27

OrganismNot specified

UniProt A0A5G2R5D6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A5G2R5D6_PIG
Isoform	—
PDB entities	74
Chains and sequence ranges	Author chain Ae； PDBConstruct 1–455； UniProt 1–455

Mitoribosomal protein ms28, mrps28

OrganismNot specified

UniProt A0A0M3KL56

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M3KL56_PIG
Isoform	—
PDB entities	75
Chains and sequence ranges	Author chain Af； PDBConstruct 1–188； UniProt 1–188

Death associated protein 3

OrganismNot specified

UniProt I3LS10

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LS10_PIG
Isoform	—
PDB entities	76
Chains and sequence ranges	Author chain Ag； PDBConstruct 1–410； UniProt 1–410

28S ribosomal protein S31, mitochondrial

OrganismNot specified

UniProt A0A4X1SQW0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1SQW0_PIG
Isoform	—
PDB entities	77
Chains and sequence ranges	Author chain Ah； PDBConstruct 1–387； UniProt 1–387

mS33

OrganismNot specified

UniProt F1S8G3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1S8G3_PIG
Isoform	—
PDB entities	78
Chains and sequence ranges	Author chain Ai； PDBConstruct 1–106； UniProt 43–148

mS34

OrganismNot specified

UniProt A0A287AVS9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287AVS9_PIG
Isoform	—
PDB entities	79
Chains and sequence ranges	Author chain Aj； PDBConstruct 1–218； UniProt 288–505

Mitochondrial ribosomal protein S35

OrganismNot specified

UniProt F1SG95

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SG95_PIG
Isoform	—
PDB entities	80
Chains and sequence ranges	Author chain Ak； PDBConstruct 1–325； UniProt 42–366

mS37

OrganismNot specified

UniProt F1SU49

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SU49_PIG
Isoform	—
PDB entities	81
Chains and sequence ranges	Author chain Am； PDBConstruct 1–118； UniProt 1–118

Aurora kinase A interacting protein 1

OrganismNot specified

UniProt A0A287B3R8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287B3R8_PIG
Isoform	—
PDB entities	82
Chains and sequence ranges	Author chain An； PDBConstruct 1–199； UniProt 1–199

;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ;

OrganismNot specified

UniProt F1SVC4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SVC4_PIG
Isoform	—
PDB entities	83
Chains and sequence ranges	Author chain Ao； PDBConstruct 1–161； UniProt 1–161 Author chain Ao； PDBConstruct 238–690； UniProt 238–690

28S ribosomal protein S18b, mitochondrial

OrganismNot specified

UniProt Q767K8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） Mitochondrial ribosomal protein L12 × 6 （A0A287ARV8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RT18B_PIG
Isoform	—
PDB entities	84
Chains and sequence ranges	Author chain Ap； PDBConstruct 1–258； UniProt 1–258

Mitochondrial ribosomal protein L12

OrganismNot specified

UniProt A0A287ARV8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 87 RNA 6	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） uL30m × 1 （F1STE5） bL31m × 1 （I3L9J0） bL32m × 1 （I3LTC4） bL33m × 1 （A0A286ZU68） CP tRNAPhe × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） uL2m × 1 （F1RRN2） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） uL13m × 1 （K7GP19） uL14m × 1 （A0A287BMZ6） uL15m × 1 （F1RSH0） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） uL22m × 1 （F1RQC9） uL23m × 1 （A0A286ZZC6） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A5G2R2V2） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） mL42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL52 × 1 （F1S9B7） mL53 × 1 （A0A341D604） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 12S rRNA × 1 Ribosomal protein × 1 （A0A287A731） 16S rRNA × 1 Mitochondrial ribosomal protein S2 × 1 （F1S001） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） bS6m × 1 （I3LEJ9） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S10 × 1 （F1RUU2） uS11m × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） uS15m × 1 （A0A287BMP0） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） uS17m × 1 （F1RIU0） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） bS21m × 1 （A0A286ZNB3） unknown × 1 Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R5D6） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Death associated protein 3 × 1 （I3LS10） 28S ribosomal protein S31, mitochondrial × 1 （A0A4X1SQW0） mS33 × 1 （F1S8G3） mS34 × 1 （A0A287AVS9） Mitochondrial ribosomal protein S35 × 1 （F1SG95） mS37 × 1 （F1SU49） Aurora kinase A interacting protein 1 × 1 （A0A287B3R8） ;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ; × 1 （F1SVC4） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） tRNA(P/P) and tRNA(E*) × 2 mRNA × 1 MAGNESIUM ION × 324 ZINC ION × 6 SPERMINE × 3 GUANOSINE-5'-MONOPHOSPHATE × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287ARV8_PIG
Isoform	—
PDB entities	85
Chains and sequence ranges	Author chain CL； PDBConstruct 1–198； UniProt 1–198 Author chain DL； PDBConstruct 1–198； UniProt 1–198 Author chain EL； PDBConstruct 1–198； UniProt 1–198 Author chain FL； PDBConstruct 1–198； UniProt 1–198 Author chain GL； PDBConstruct 1–198； UniProt 1–198 Author chain HL； PDBConstruct 1–198； UniProt 1–198

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7nsj
Deposition date deposition_date	2021-03-07
Structure title title	55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*)
Keywords keywords	Ribosome, Mitochondria, tRNA(E*), TRANSLATION; TRANSLATION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7nsj__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7nsj__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7nsj__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	91.42 Å
Rg (electron density)	96.20 Å
Total Rg	95.46 Å
Atom count	174834
Residues	17140
Excluded volume	2909400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7nsj__assembly_1__model_1`	93-meric （93）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (93)

Entity 1 Entity 1 polymer

Description description	Mitochondrial ribosomal protein L27
Molecular weight formula_weight	15943.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B0
Atom count atom_count	174837

MALAVLALRTRAAVTALLSPPQAAALAVRYASKKTGGSSKNLGGKSPGKRFGIKKMEGHYVHAGNILATQRHFRWHPGAHVGLGKNKCLYALEEGVVRYTKEVYVPNPSNSEAVDLVTRLPQGAVLYKTFVHVVPAKPEGTFKLVAML

Entity 2 Entity 2 polymer

Description description	Mitochondrial ribosomal protein L28
Molecular weight formula_weight	30149.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B1

MPLHKVPVGLWKQLRLWEGIYSRLPRHYLRSLEEARTPTPVHYRPHGAKFKINPKNWQRERVEDVPIPVHYPPESQLGLWGGEGWVLGHRYVNNDKLSKRVRKVWKPQLFQRELYSEILDKRFTVTVTMRTLDLIDQACGFDFYILKTPKEDLCSKFGMDLKRGMLLRLARQDPQLHPDDPARRAAIYDRYKAFVIPEAEAEWVGLTLDEAVEKQRLLEEKDPIPLFKIFVEELLGQLQQQALSEPAVVQTRASRK

Entity 3 Entity 3 polymer

Description description	Mitochondrial ribosomal protein L47
Molecular weight formula_weight	30085.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B2

MAAAGLAVFCRRVSAALKACRLLIRPQAPPSTSCRFSPSLLPKNTPNVTSFHQFRIFHTTFSRRGLEEFFDDPKNWGEEKVKSGASWTCQQLRNKSNEDLHKLWYVLLKERNMLLTLEQEAKRQRLPMPSPERLEKVVDSMDALDKVVQEREDALRLLQTGQEKARPGAWRRDIFGRIIWHKFKQWPIPWYLNKKYNRKRFFAMPYVERFVRMRIEKQARIKARKRSLERKKEKFLQEKFPHLSETQKSSHV

Entity 4 Entity 4 polymer

Description description	uL30m
Molecular weight formula_weight	18921.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B3

HPPRQDFLVRRQPHRNRTVTKGMESLICTDWIRHKFTRSRIPDKVFQPSPEDHEKYGGDPQYPHKLHIVTRIKSTKRRPYWEKDIIKMLGLEKAHTPQVHKNIPSVNAKLKVVKHLIRIKPLKLPQGLPTEEDMANTCLKSNGELVVRWLLNPANQEARKS

Entity 5 Entity 5 polymer

Description description	bL31m
Molecular weight formula_weight	15156.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B4

MAAKGSLLRLLWQRVVTGAAPESCRHLYTSSWRADCNRALLTRLHRQTYARLYPVLLVKQDGSTIHIRYREPRRMLTMPVDLDSLSPEERRARFRKREAKFKEKKEEPELSDDFDVEQYKRFWTKK

Entity 6 Entity 6 polymer

Description description	bL32m
Molecular weight formula_weight	21537.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B5

MASAMLVLVVPPWPAARGLLRNWWEQLQRKLQHNRLGLPLHPWGPALAVQGPAICTEPANDTNGSKAISSLLDSVFWMAAPKNRRSIEVNRCRRRNPQKLIKVKNNIDVCPECGHLKQKHILCGYCYEKVRKETAEIRRQMGKQEGGPFRAPTTETVVLYSGETPSEQDQGKRIIERERKRPSWFTQN

Entity 7 Entity 7 polymer

Description description	bL33m
Molecular weight formula_weight	7508.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B6

MFLSAVTFAKSKSKTILVKMMSQAGTGFSFNTKRSRLREKLTLLHYDPVVKKKVLFVEQKKIRSL

Entity 8 Entity 8 polymer

Description description	CP tRNAPhe
Molecular weight formula_weight	23402.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	BB

GUUAAUGUAGCUUAAAUUAUCAAAGCAAGGCACUGAAAAUGCCUAGAUGAGCCUCACAGCUCCAUAAACACCA

Entity 9 Entity 9 polymer

Description description	Mitochondrial ribosomal protein L34
Molecular weight formula_weight	10871.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B7

MAFLARSVGRLLDPVSRSAALVGGRWLQPQAWLGFPDTWGLPAMQQTRGKARGNEYQPSNIKRKHKHGWVRRLRTPTGVQVILRRMHKGRKSLSH

Entity 10 Entity 10 polymer

Description description	uL2m
Molecular weight formula_weight	33270.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BD

MALRVLTRALSSLSLTPRIAVAPGLNLLPAVQVTNNVLLTLPSGLMSLPCRPILTSVALSATSVSWKSRTKYTVMPVKMRKSGGRNHTGQIQVHGIGGGHKQRYRMIDFLRFRPEHESKPGPFEEKVIAVRYDPCRSADIALVAGGNRKRWIIATENMKAGDTVLNSDHIGRMAVAAREGDAHPLGALPVGTLINNVESEPGRGAQYIRAAGTCGVLLRKVNGTAIIQLPSKRQMQVLETCIATVGRVSNVDHNKRVIGKAGRNRWLGKRPNSGLWQRKGGWAGRKIRPLPPMKSYVKLPSAAAQS

Entity 11 Entity 11 polymer

Description description	ICT1
Molecular weight formula_weight	43708.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BE

MAPAALLPSWGQRGAAAGGGGKAWEGRRRNALKAEWRGAQRCSGRALLGLTMPGWGLLGRAGARVLGCGADGLGASRGLGNRTDICLLVRSLHGKSVTWWDEHLSEENVPFVKQLVSDENKAQLASKLCPLKDEPWPIHPWEPGSSRVGLIALKLGMMPLWTKDGQKHVVTLLQVQDCHVLKYTPKENHNGRMAALTVGGKTVSHFHKSASILEFYQELGLPPKQKVKIFNVTENAVIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMRRWGFKGQPATHGQTKTHRRPGAISTGDVARVWPGTKMPGQLGNIDRTAFGLKVWRINTKHNIIYVNGSVPGHKNCLVKIKDSKLPAYKDFCKNLPFPTYFPDGDEEALPEDLYDENVCQPGAPSITFT

Entity 12 Entity 12 polymer

Description description	Mitochondrial ribosomal protein L4
Molecular weight formula_weight	33251.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BF

MLQLVRAGARTWFRPSGCRGLNTLAEEAVQQAEKPESVASLGLQPPVLRKCELPVPAHRRPVQAWIESLRGYEQERVGLTELHPDVFSTAPRLDILHQVAIWQKNFKRISYAKTKTRAEVRGGGRKPWVQKGSGRARHGSIRSPIWRGGGVAHGPRGPTSYYYMLPMKVRVQGLKVALTVKLAQDDLHIVDSLELPTADPQYLIELARYRRWGDSVLLVDLEHEDMPQNVVAATSGLKTFNLVPAVGLNVHSMLKHQTLVLTLPTVAFLEEKLLWHNSRYTPLYPFRLPYCDFP

Entity 13 Entity 13 polymer

Description description	Mitochondrial ribosomal protein L9
Molecular weight formula_weight	30373.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BI

MAAAACTAAGGGLLRAGLERLLRGGVRALLRPRLEGVTPRSERAFSLSLSRSTVIVERWWKVPLAGEGRKPRLHRRHRVYKLVEDTKHRPKDNLELVLTQSVEELGVRGDLVSVKKSVGRNRLLPQGLAVYASPENKKLFEEEKLLRQEGKLEKLQTKAGEATVKFLRRCHLEVGMKNNVKWELNPEIVARHFLRNLGVVVAPHALKLPEEPITQRGEYWCEVTVNGLDTVRVPMSVVNFERPKTKRYKYWLAQQAAKGDVPTSSQMI

Entity 14 Entity 14 polymer

Description description	Mitochondrial ribosomal protein L10
Molecular weight formula_weight	29449.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BJ

MAAVVAGMLRGGLLPQAGRLPTFQTVRYGSKAVTRHRRVMHFERQKLMAVTEYIPPKPTINPRCLPPPPTPPQEETGLVRLLRREIAAVFRDNRMIAVCQHVALSAEDKLLLRHQLRKHKILMKIFPNQVLKPFLEESKYQNLLPLFVGHNLLLVSEEPKVKEMVRILKGIPFLPLLGGCIDDTILSRQGFINYSKLPSLALVQGELVGGLTFLTAQTYSMLQHQPRQLTALLDQYVKQQQEGHPAVPASGQPEPPDPVPDP

Entity 15 Entity 15 polymer

Description description	Mitochondrial ribosomal protein L11
Molecular weight formula_weight	20809.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BK

MSKLSRATRALKKPEASGMIRAIVRAGQARPGPPLGPILGQRGVSINQFCKEFNEKTKDIKEGIPLPTKIFVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARHTGKEVAGLVTLKHVYEIARVKAQDDAFALQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAAFQKERALFLAAQREADLAAQAEAAKK

Entity 16 Entity 16 polymer

Description description	uL13m
Molecular weight formula_weight	20633.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BN

MSSFSKAPQQWATFARVWYLLDGKMQPPGKLAAMASVKLQGLHKPVYHQLSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHQKDPVAIVKLAIYGMLPKNLHRRTMMQRLHLFPDEDIPEDILKNLVEELPQPRKVPRRLDEYTQEEIEAFPRVWSPPEDYRL

Entity 17 Entity 17 polymer

Description description	uL14m
Molecular weight formula_weight	15955.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BO

MAFCTGLRGPFAQVSRALSQRCFSTTGSLSAIQKMTRVRVVDNSALGTTPYHRPPRCIHVYNKTGVGKVGDRILLAIRGQKKKALIVGHRMPGPRMTPRFDSNNVVLLEDNGNPVGTRIKTPIPSSLRQREGEFSKVLAIAQNFV

Entity 18 Entity 18 polymer

Description description	uL15m
Molecular weight formula_weight	33481.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BP

MGGPVQGGGPRALDLLRALPRVSLANLKPNPGSRKPERRPRGRRRGRKCGRGHKGERQRGTRPRLGFEGGQTPFYLRIPKYGFNEGHSFRHQYQPLSLNRLQYLIDLGRVDPTQPIDLTQLVNGRGVTIQPSKRDYGVQLVEEGADTFKAKVNIEVQMASELAIAAIEKNGGVVTTAFYDPRSLEILCKPVPFFLRGQPIPKRMLPPEALVPYYTDAKNRGYLADPARFPEARLELARKYGYVLPDITKDELFKMLSTRKDPRQIFFGLAPGWVVNMADKKILKPTDENLLKYYSS

Entity 19 Entity 19 polymer

Description description	uL16m
Molecular weight formula_weight	28680.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BQ

MWRLLARACAPLLRAPLSDSWAAPSATAGFKTLLPVPTFEDVAIPEKPKLRFVERVPLVPKVRRERKNLSDIRGPSTEATEFTEGRFAILALGGGYLHWGHFEMMRLTINRSMDPKNMFALWRVPAPFKPITRKGMGQRMGGGKGAIDHYVTPVKAGRLIVEMGGRCEFKEVQGFLDLVAHKLPFPAKAVSRETLEKMRKDQEERERNNQNPWTFERIATANMLGIRKVLSPYDLTHKGRYWGKFYTPERV

Entity 20 Entity 20 polymer

Description description	bL17m
Molecular weight formula_weight	19268.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BR

MRLSVAAAISHGRVFRRLGLGPESRIHLLQNLLTGLVRHERIEASWARVDELRGYAEKLIDYGKLGDTNERAMRMADFWLTEKDLIPKLFQVLAPRFQGQNGGYTRMLQIPNRNEQDRAKMAVIEYKGNCLPPLPLPRRDSNLTLLNQLLQGLRQDQEASSHTAQTPAV

Entity 21 Entity 21 polymer

Description description	Mitochondrial ribosomal protein L18
Molecular weight formula_weight	20582.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BS

MALRSRFWALLSICRNPGCRAAALSTSCKPATNPETDPVENEAVAPEFTNRNPRNLELLAVARKERGWGTVWPSREFWHRLRVIRTQHHIEALVEHRNGQVVVSASTREWAIKKHLYSTRNVVACESVGRVLAERCLEAGINFMVYHPTPWEAASDSIKRLQHAMTEGGVVLREPRRIYE

Entity 22 Entity 22 polymer

Description description	Mitochondrial ribosomal protein L19
Molecular weight formula_weight	33441.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BT

MAASITRGSWAAVGLGQSFPPTRALLPAPASVICRTLAGSGRQQVTGSSEPGAFQPPPKPVIVDKRRPQRPETRFLSPEFIPPRGRTNPLKFQIERKDMLERRKILHIPEFYVGSILRVTTADPYASAKTSQFLGICIQRSGSGLGATFILRNTIEGQGVEICFELYNPRIQEIQVVKLEKRLDNSLLYLRDALPEYSTFDVNMKPITQEFNQEVPVNQLKVKMKPKPWSKRWERPKFNIKGIRFDLCLTEEQMREAQKWSQPWLEFDMMREYDTSKIEAAIWDEIEASKNS

Entity 23 Entity 23 polymer

Description description	Mitochondrial ribosomal protein L20
Molecular weight formula_weight	17554.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BU

MVFLTVPLWLRSRVTDRYWRVQEVLKHARHFRGRKNRCYRLAVRAVTRAFVKCTRARRLKKRSLRTLWINRITAASQEHGLKYPAFIINLIKCQVELNRKVLADLAIYEPKTFKSLAALAKRRREEGFAAALGDGKEPDGIFSRVVQHR

Entity 24 Entity 24 polymer

Description description	Mitochondrial ribosomal protein L21
Molecular weight formula_weight	23154.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BV

MAAAVAASVLQGTFGRLVSAYSRSVLRTSRPGTAPPWSAPRRLSSQHTSSLRGCVPKTSLGSPPWPDIVLPDPVEETRHHAEVVGQVNELIAAGRYGRLFAVVHFAGHQWKVTAEDLILIENELDVACGERIRLEKVLLVGADNFTLLGKPLLGKELVRVEATVIEKTESWPKINMKFQKRKNYQRKRITVNPQTVLRINSIEIAPCLC

Entity 25 Entity 25 polymer

Description description	uL22m
Molecular weight formula_weight	24313.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BW

MAAAVLERLGGLWMQNLRGKLALRLLSSHSILPQSHIHTSASVEISRKWEKKNKIVYPPQLPGEPRRPAEIYHCRRQIKYSKDKMWYLAKLIRGMSIDQALAQLEFSDKKGAQIIKEVLLEAQDMAVRDHNVEFRSNLYVAESTSGRGQYLKRIRYHGRGRFGIMEKVFCHYFVKLVEGPPPPREAPKTAVAHAREYIQELRNRTITHAL

Entity 26 Entity 26 polymer

Description description	uL23m
Molecular weight formula_weight	17643.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BX

MARNVLYPLYQLGNPQLRVFRTNFFIQLVRPGTAQPEDTVQFRIPMEMTRVDLRNYLERIYNVPVAAVRTRVQYGSNRRRDHRNIRIKKPDYKVAYVQLALGQTFTFPDLFPERKGASVDVDVRDQVLEDQRQKHSPDPRRGGVPGWFGL

Entity 27 Entity 27 polymer

Description description	uL24m
Molecular weight formula_weight	24893.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BY

MRLSALLALASKVTLPPNYRYGMSRPGSLSDKRKNPPGTRRRRVPVEPISDEDWHLFCGDKVEILEGKDAGKQGKVVQVIRQRNWVVVEGLNTHYRYVGKTVDYRGTMIPSEAPLLHNQVKLVDPTDRKPTDVEWRFTEAGERVRVSTRSGRIIPKPEFPRADGIVPETWIDGPKDTSVEDALEKTYVPRLKTLEEEVMEAMGIQETRRHKKVYWY

Entity 28 Entity 28 polymer

Description description	Mitochondrial ribosomal protein L37
Molecular weight formula_weight	47918.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ba

MALASGPARRALARLGRLGLGGCGAPRRGAYEWGVRSTRKPEPPPLDRVYEIPGLEPITYAGKMHFMPGLARPVFPPWDPGWTHPKFRRLPPLHEHPLYKDQACYVFHQRCRLLEGVKQALWLTKTQLIEGLPEKVLRLADDPRNHIENQDERVLNAISHARLWHSTEDIPKRETYCPVIVDSLIQLCKSQILKHPSLARRICAQNNTLSATWNRESILLQVHGSSGARLNAKDPLPPVASQEEVEATKNHVLETFYPISPTMGLQECNVYDVNDDTGFQEGYPYPCPHTLYFLESANLRPRRFQPDQLRAKMILFAFGSALAQARLLYGNDSKVLEQPVVVQSVGTDGRLFQFLVLQLNTTDLASDEGVKNLAWVDSDQLLYQHFWCLPVIKKKVVVEPVGPIGFQPETFRKFLALYLHGAV

Entity 29 Entity 29 polymer

Description description	Mitochondrial ribosomal protein L38
Molecular weight formula_weight	44656.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bb

MAAPWWRAALCASRRWRGFSTSAALSRRAAPLGPMPNEDIDVSDLERLKKYRSFDRYRRRAEQEARKPHWWRTYREHFGEESGPKDRVDIGLPPPKVSRTQQLLERKQALRELRANVEEERAARLQTARIPLEAVRAEWERTCGPYHKQRLAEYCGLYRDLFHGATFVPRVPLHVAYAVGEDDLMPVYHGNEVTPTEAAQAPEVTYEADEGSLWTLLLTNLDGHLLEPDAEYVHWLVTNIPGNRVTEGQETCPYLPPFPARGSGFHRFAFLLFKQDKRIDFSGDTRPSPCYQLAQRTFHTFDFYKKHQDAMTPAGLAFFQCRWDDSVTRVFHQLLDMREPVFEFVRPPPYHPKQKRFPHRQPLRYLDRYRDSHEPTYGIY

Entity 30 Entity 30 polymer

Description description	Mitochondrial ribosomal protein L39
Molecular weight formula_weight	38523.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bc

MAMGAWGLRLWRAVPRGEAGWRLIATSPASQLSPTELIEMQNDLFNKEKNRQLSLTPRTEKIEVKHVGKTDPGTVFVMNKNISTPYSCAMHLSEWYCRKSILALVDGQPWDMYKPLTKSCEIKFLTFKDDDPGEVNKAYWRSCAMMMGCVIERAFKDEYVVSLVRAPEVPVIAGAFCYDVVLDKRLDEWMPTKENLHSFTKDARALIYKDLPFETLEVEAKVALEIFQHNKYKLDFIEEKASQNPERIVKLHRFGDFIDVSEGPLIPRTSICFQYEVSAVHNLQTQSSLVRRFQGLSLPVHLRAHFTIWNKLLERSRKMVTEDKTKPTEESAST

Entity 31 Entity 31 polymer

Description description	Mitochondrial ribosomal protein L40
Molecular weight formula_weight	24075.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bd

MAAAALGAASRTLRPASRLVGAWPTQTRDAHERGSLFSFWGLVPMRAEPLRKKKKVDPKKDQAAKDRLKKRIRRLEKASQELIPIEDFITPVKFLNKERQRPPVELPFEESERRALLLKRWSLYKQREHEMERSAIRSLLEAQEEALQELRLSSPELHAEATKRDPSLFPFERQGPDYTPPISDYQPPEGRYQDITKVYTQVEFKK

Entity 32 Entity 32 polymer

Description description	Mitochondrial ribosomal protein L41
Molecular weight formula_weight	15073.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Be

MGLLSGAARALVRGADRMSKWTSKRGPRTFCKGRGAKGTGFHGRDGKFVQIKEMIPELVVPELAGFKLKPYVNYRAPEGTDTPLTAKQLFLETAAPAIEKDFKAGTFDPEHLEKYGFEPTQEGKLFQLYPKNFPR

Entity 33 Entity 33 polymer

Description description	mL42
Molecular weight formula_weight	16680.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bf

MALAAVKWVISSRTILKHLFPIQNSASYCVCHKSTYSSLPDDYNCKVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNIEETHDLVLKTRLEEKGEHLEQGPMIEQLSKMFFTTKHRWYPRGQYHRRRRKPNPPKDR

Entity 34 Entity 34 polymer

Description description	Mitochondrial ribosomal protein L43
Molecular weight formula_weight	17728.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bg

MTARGTASRFLTSVLHNGLGRYVQQLQRLSFSLSRDAPSSRGAREFVEREVTDFARRNPGVVIYVNPRPCCVPRVVAEYLNGAVREESIHCKSVEEIAALVQKLADQSGLDVIRIRKPFHTDSPSIQGQWHPFTNKPTTLGGLRPREVQDPAPAQVQAQ

Entity 35 Entity 35 polymer

Description description	mL44
Molecular weight formula_weight	37527.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bh

MASGLVRLLQWGPRRLLAPAAPTLAPPVRGAKKGFRAAYRFQKELERWRLLRCPPPPVRRSEKPNWDYHAEIQAFGHRLQETFSLDLLKTAFVNSCYIKSEEAKRQKLGIDKEAALLNLKDNQELSEQGISFSQTCLTQFFEDAFPDLPTEGVTSLVDFLTSEEVVCHVARNLAVEQLALSAEFPVPPPVLRQTFFAVIGALLQSSGPERTALFIRDFLITQMTGKELFEMWTITNPMGLLVEELKKRKISAPESRLTRQSGSTTALPVYFVGLYCDRKLIAEGPGETVLVAEEEAARVALRKLFGFTENRRPWDYSKPKEHVRAEKTITAS

Entity 36 Entity 36 polymer

Description description	Mitochondrial ribosomal protein L35
Molecular weight formula_weight	21548.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B8

MAASAFAGAVRAATGILRPLHILASSAYQNCAKNACLSSVLSSRHFSHIQTSALLSAPRLITSVRNLMCGPTAPVLNRVAPLLPHVLKPPVRTVTYFSSRKGKRKTVKAVIYRFLRLHSGLWLRRKAGYKKKLWKKTAARKRRLREFVFCNKTQSKLLDKMTTSFWKRRNWYADDPYQKYQDRTNLKV

Entity 37 Entity 37 polymer

Description description	Mitochondrial ribosomal protein L45
Molecular weight formula_weight	35331.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bi

MAAPVTRGLSCLPRVLGWWSRQPVLVTQSTAVVPVRTKKRFTPPTYQPKYKSEKEFVEHARKAGLVIPHERLERPIHLACTAGIFDAYVPPEGDARISSLSKEGLAQRAERLKKNVASQLSIRKIRESDPNFKIKDFPEKAKDIFIEAHLCLNNSDHDRLHTLVTENCFPDMVWDIRYKTVRWSFVESLEPPQVVQVRCSSLMNQGNIYGQVTVRMHTRQTLAIYDRFGRLMYGQEDVPRDVLEYVVFEKHLVDPYGSWRMHGKIIPPWAPPKQPILKTVMIPGPQLKPWEEFEEPQGEVHKPQPA

Entity 38 Entity 38 polymer

Description description	Mitochondrial ribosomal protein L46
Molecular weight formula_weight	32216.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bj

MAAPVRRTMLRVVRGWRRFEGPWAHSLGSRNLALAVAPSSSSSPWRLLGALCLQRPPLVTKPLTPLQEEMADLLQQIEIERSLYSDHELRALDEAQQLAKKKSDLYEEEDEQNILLAQDLEDMWEQKFLHFKLGARLTEADKKDDRTSLHRKLDRNLILLVREKLGDQDIWMLPQSDWQPGETLRQTAERTLATLSENNMEAKFLGNAPCGHYKFKFPQAMRTETSLGAKVFFFKALLLTGDFSQAGKKGHHVWVSKEELGDYLKPKYLAQVRRFLLDL

Entity 39 Entity 39 polymer

Description description	39S ribosomal protein L48, mitochondrial
Molecular weight formula_weight	29942.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bk

MSEAAGTKVLRELNASRSDIVTGPDQGRSVSIFRPPGIAAAWADLQLARLHTTRQQRMNGALGKALCLRNDTVLKQALSLIRVRASGESPICSAGGILLSTSRHYRSKPTHGIGRYKHLVKAQEPKKKKGKVEVRPINLGTDYEYGVLNIHLIAYDMALAESYAQYVHNLCNHLAIKVEESYAMPTKTMEVLQLQEQGSKMFLDAVLTTHERVVQISGLSATFAEIFLEIIHSNLPEGVKLSVREHTEEDFKGRFKARPELEELLAKLN

Entity 40 Entity 40 polymer

Description description	Mrpl34
Molecular weight formula_weight	18957.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bl

MAATVLCGVLRAWRTGVPLGCGLRRLSQTQGTPEYPSFVESVDEYHFVERLLPPASIPRPPKHEHYPTPSGWQPPRDPAPSLPYFVRRSRMHNIPVYRDITHGNRQMTVIRKVEGDIWALQKDVEDFLSPLLGKTPVTQVNEVTGTLRVKGYFDQQLKAWLLEKGF

Entity 41 Entity 41 polymer

Description description	Mitochondrial ribosomal protein L50
Molecular weight formula_weight	22785.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bm

MVRLRGKRECLTLSLRLIGWSWRVTAGGGRCFVSKFSSKMAARWVSGLARRSLTCAVSGAPRREFWSPFRKEKQPVVAETVEEVKKEPILVCPPIQSRTYIPPEDLQSRLESHVKEVFGSSVPSNWQDISLEDVHLKFSFLARLANDLRHAVPNSRLHQMCRVRDVLDFYNVPVQDRSKFDELIASNLPHNLKITWGY

Entity 42 Entity 42 polymer

Description description	Mitochondrial ribosomal protein L51
Molecular weight formula_weight	15249.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bn

MAGSLSWVTGRGLWGRLPLTCRSFSLGIPRLFHVRVTLPPRKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIKGPIWLRGWKGNELQRCIRKKRMVGNRMFIDDLHNLNKRISYLYKHFNRHGKYR

Entity 43 Entity 43 polymer

Description description	mL52
Molecular weight formula_weight	13813.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bo

MAAWGILLSTGVRRLHCGTAAQAGSQWRLQQGFAANPSGYGPLTELPDWSYADGRPAPPMKGQLRRKAQREKFARRVVLLSQEMDAGLQAWQLRQQEKLQEEEGKQKNALKSKGALLQNPQPSQ

Entity 44 Entity 44 polymer

Description description	mL53
Molecular weight formula_weight	12015.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bp

MAAALARLGLRAVKQVRVQFCPFEKNVESTRTFLQAVSSEKVRCTNLNCSVIADVRHDGSEPCVDVLFGDGHRLIMRGAHLTAQEMLTAFASHIQARGAAGSGDKPSASTGR

Entity 45 Entity 45 polymer

Description description	mL54
Molecular weight formula_weight	15957.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bq

MAARRLFGAARSWAAWRAWELSDAAVSGRLHVRNYAKRPVIKGGKGGKGAVVGEALKDPEVCTDPFRLTTHAMGVNIYKEGQDVVLKPDSEYPEWLFEMNVGPPKKLEELDPETREYWRLLRKHNIWRHNRLSKNRKF

Entity 46 Entity 46 polymer

Description description	Mitochondrial ribosomal protein L57
Molecular weight formula_weight	12001.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bt

MFLTALLRRNRIPGRQWIGKHRRPRPVSAQAKQNMIRRLETEAENQYWLSRPFLTAEQERGHAAVRRAAAFQALKAAQAARFPAHRRLEEQLGHLLVTRKWS

Entity 47 Entity 47 polymer

Description description	mL62 (ICT1)
Molecular weight formula_weight	23545.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bu

MAAARCLRWGLNRAGAWLLPSPTRYPRRALHKQVEGTEFQSIYSLDKLYPESRGSDTAWRLPDDAKQANDIPVDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLASADWIAEPVRLKLAVKHKNRINRSGELILTSECSRYQFRNLADCLQKLRDMIAEASQPAKEPSREDAELRRSRIENMNRERLRKKRISSAIKTSRRVDVD

Entity 48 Entity 48 polymer

Description description	mL64
Molecular weight formula_weight	25815.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bv

MAAPVQQARTLLRLVTTLGQGSRGYRARPPPRRSQEPRWPDPDDPLTPRWQLSPRYAAKQFARHGAASGVAAGSLWPSQEQLRELEAEEREWYPSLAAMQESLRVQQLAEEQKRQAREQLIEECMAKMPQMIENWRQQQQERREKEQADKDRRARLQAEAQERLGYHVDPRSARFQELLQDMEKQHRKRLKEEKQRKKKEARAAAMAAAAAQDPADSETPSS

Entity 49 Entity 49 polymer

Description description	39S ribosomal protein S30, mitochondrial
Molecular weight formula_weight	49100.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bw

MAAARCWRFPLRGAGLSLHTAAKAAVTAPEVTGPDVPATPVARYPPIVASLTAKSKAARQRRVEQWQATVHAAKSVDEKLRILTKMQFMKYVVYPQTFALNADNWYQSFTKTVFLSGLPPTPAKLEPEPTLDITALREAVCDCLLQEHFFLRRKKRAPVIQDREAIASPFLDQLVASLTGLLSVHNPVLAAAALDCKRPVHFFWLRGEEIIPRGHRKGRVDALRYQINDKPHNQIRISRQLPEFVPLDYSIPIEVPVMSCKPDKLPLFKRQYENTIFIGSKTADPLCYGHTQFHLLPDKLKREKLLKQNCADQIEVVFRANAIASLFAWTGAQAMYQGFWSEADVTRPFVSQGVITDGKYFSFFCYQLNTLALTAQADQNNPRKNICWGTQSKPLYETIEDNNVKGFNDDVLLQLVQFLLNRPKEDKSQLLEN

Entity 50 Entity 50 polymer

Description description	Mitochondrial ribosomal protein S18A
Molecular weight formula_weight	22273.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bx

MVGLNVLVSGCGRLLRGLLAGPAATSWARPPSRGFREVVEILDGKTTIIEGRITETPQESPNPPNPTGQCPICRWNLKHKYNYEDVLLLSQFIRPHGGMLPRRITGLCQEEHLKIEECVKMAHRAGLLPNHRPKLPEGFVPKSKPRLNRYLTRWSPRSVKPIYNKGHRWNKVRMPVGSPLLKDNVSYSGRPLLLYH

Entity 51 Entity 51 polymer

Description description	12S rRNA
Molecular weight formula_weight	308989.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	AA

ACACAGGUUUGGUCCUGGCCUUUCUAUUAAUUCUUAAUAAAAUUACACAUGCAAGUAUCCGCGCCCCGGUGAGAAUGCCCUCCAGAUCUUAAAGAUCAAAAGGAGCAGGUAUCAAGCACACCUAUAACGGUAGCUCAUAACGCCUUGCUCAACCACACCCCCACGGGAAACAGCAGUGAUAAAAAUUAAGCCAUGAACGAAAGUUUGACUAAGUUAUAUUAAUUAGAGUUGGUAAAUCUCGUGCCAGCCACCGCGGUCAUACGAUUAACCCAAAUUAAUAGAUCCACGGCGUAAAGAGUGUUUAAGAAAAAAAAUCACAAUAGAGUUAAAUUAUAACUAAGCUGUAAAAAGCCCUAGUUAAAAUAAAAUAACCCACGAAAGUGACUCUAAUAAUCCUGACACACGAUAGCUAGGACCCAAACUGGGAUUAGAUACCCCACUAUGCCUAGCCCUAAACCCAAAUAGUUACAUAACAAAACUAUUCGCCAGAGUACUACUCGCAACUGCCUAAAACUCAAAGGACUUGGCGGUGCUUCACAUCCACCUAGAGGAGCCUGUUCUAUAAUCGAUAAACCCCGAUAGACCUUACCAACCCUUGCCAAUUCAGCCUAUAUACCGCCAUCUUCAGCAAACCCUAAAAAGGAACAAUAGUAAGCACAAUCAUAGCACAUAAAAACGUUAGGUCAAGGUGUAGCUUAUGGGUUGGAAAGAAAUGGGCUACAUUUUCUACAUAAGAAUAUCCACCACACGAAAGUUUUUAUGAAACUAAAAACCAAAGGAGGAUUUAGCAGUAAAUCAAGAAUAGAGUGCUUGAUUGAAUAAGGCCAUGAAGCACGCACACACCGCCCGUCACCCUCCUCAAGCAUGUAGUAAUAAAAAUAACCUAUAUUCAAUUACACAACCAUGCAAGAAGAGACAAGUCGUAACAAGGUAAGCAUACUGGAAAGUGUGCUUGGAUUACC

Entity 52 Entity 52 polymer

Description description	Ribosomal protein
Molecular weight formula_weight	10841.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B9

MATAFLRTVLSAVGPLLHLGGRPLSTFAAGPPRAALAVGAQPSPAAALLSARPLLGPQPALGFKTKGVLKKRCRDCYLVKRRGRWFIYCKTNPKHKQRQM

Entity 53 Entity 53 polymer

Description description	16S rRNA
Molecular weight formula_weight	504852.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	BA

ACCAAAGCUAGCUCAACAUACUAAACAAAUACAAAAAUACACCAAAAUAAAAUAAAACAUUCACCUAACAUUAAAGUAUAGGAGAUAGAAAUUUUUAUCCUGACGCUAUAGAGAUAGUACCGUAAGGGAAAGAUGAAAGAAUAAAAUAAAAGUAAAAAAAAGCAAAGAUUACCCCUUCUACCUUUUGCAUAAUGGUUUAACCAGAAAAAAUCUAACAAAGAGAACUUUAGCUAGAUACCCCGAAACCAGACGAGCUACCCAUGAGCAGUUUAAAAGAACCAACUCAUCUAUGUGGCAAAAUAGUGAGAAGACUUGUAGGUAGAGGUGAAAAGCCUAACGAGCCUGGUGAUAGCUGGUUGUCCGAGAAAGAAUUUUAGUUCAACCUUAAAAAUACCCCAAAAACCCUAAAUUCCAAUGUAUUUUUAAGAGAUAGUCUAAAAAGGUACAGCUUUUUAGAAACGGAUACAACCUUGACUAGAGAGUAAAAUCUUAAUACUACCAUAGUAGGCCUAAAAGCAGCCAUCAAUUGAGAAAGCGUUAAAGCUCAACAAAUUCACCAACAUAAUCCCAAAAACUAAUAACAAACUCCUAGCCCAAUACCGGACUAAUCUAUUGAAACAUAGAAGCAAUAAUGUUAAUAUGAGUAACAAGAAGCCUUUCUCCUCGCACACGCUUACAUCAGUAACUAAUAAUAUACUGAUAAUUAACAACCAAUAAACCAAAACAACACUAAAACGUUUAUUAAUUACAUUGUUAACCCAACACAGGAGUGCACCAAGGAAAGAUUAAAAGAAGUAAAAGGAACUCGGCAAACACAAACCCCGCCUGUUUACCAAAAACAUCACCUCUAGCAUUACUAGUAUUAGAGGCAAUGCCUGCCCAGUGACACCAGUUUAACGGCCGCGGUAUUCUGACCGUGCAAAGGUAGCAUAAUCACUUGUUCUCCAAAUAAGGACUUGUAUGAAUGGCCACACGAGGGUUUUACUGUCUCUUACUUCCAAUCAGUGAAAUUAACCUUCCCGUGAAGAGGCGGGAAUAAAAAAAUAAGACGAGAAGACCCUAUGGAGCUUUAAUUAACUAUUCCAAAAGUUAAACAACUCAACCACAAAGGGAUAAAACAUAACUUAACAUGGACUAGCAAUUUCGGUUGGGGUGACCUCGGAGUACAAAAAACCCUCCGAGUGAUUUUAAUCUAGACAAACCAGUCAAAAUAACCAUAACAUCACUUAUUGAUCCAAAAUUUUGAUCAACGGAACAAGUUACCCUAGGGAUAACAGCGCAAUCCUGUUCUAGAGUUCCUAUCGACAAUAGGGUUUACGACCUCGAUGUUGGAUCAGGACACCCAAAUGGUGCAACCGCUAUUAAAGGUUCGUUUGUUCAACGAUUAAAGUCCUACGUGAUCUGAGUUCAGACCGGAGCAAUCCAGGUCGGUUUCUAUCUAUUAUAAAUUUCUCCCAGUACGAAAGGACAAGAGAAAUGGGACCAACCUCACAAACGCGUCUCAGAGAUAAUUAAUGAUUUAAUCUUAACCUAAUUAACUCAUAAUAAAUCCAGCCCUAGAACAGGGCACA

Entity 54 Entity 54 polymer

Description description	Mitochondrial ribosomal protein S2
Molecular weight formula_weight	31731.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AB

MASGPLLPRLLGAGAPRRPLRLHLVPTATPGPAGPTGRTLGSNAAPAAREPELGNDLRDRILSEPLKHADFFNLKELFSVRSLFDARVHLGHKAGCRHRFMEPYLFGSRLGQDIIDLEQTAAHLQLALNFTAHVAYREGIILFVSRHRQFAHLIETTARDCGEYAHTRYFKGGLLTNAPLLLGPGVRLPDLIIFLHTLNNVFEPHVAVRDAAKMNIPTVGIVDTNCNPALITYPVPGNDDSPPAVRLFCRLFQVAISRAKEKRRQVEALYRLQGPAGAERGPAAPPPPE

Entity 55 Entity 55 polymer

Description description	Mitochondrial ribosomal protein S24
Molecular weight formula_weight	18935.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AC

MVASVCGGGLRPLVLSWSRELPCAWRALHISAVCAKNRAARVRVSKGDKPVTYEEAHAPHYIAHRKGWLSLHTGNLDGEDHAAERTVEDVFLRKFMLGTFPGCLADQLVLKRRANQLEICALVLRQLPPHKFYFLVGYSETLLSHFYKCPVHLHLQTVPSKVVYKYI

Entity 56 Entity 56 polymer

Description description	28S ribosomal protein S5, mitochondrial isoform X2
Molecular weight formula_weight	48213.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AE

MAAAVRAAGFFPGLFGASAGNLWSRQLYLNTFPAASILTSKTFPSNGPLSPPGTRDNHHFTSLACALQTQCSISSPSNWMGQQYRSYSFFTKLTADELWKGALAESGAGARKGRGKRTKKKRRKDLNRGQIIGEGRHGFLWPGLNIPLMRNGAVQTIAQRSKEDQEKVEADMVQQREEWDRRRKMKVKRERGWSGNTWGGVSLGPPDPGPNGETYDDFDTRILEVRNVFNMTAKEGRKRSVRVLVAVGNGKGAAGFAIGKATERADAFRKAKNRAVHYLHYIERYEDHTIYHDISLKFKRTHIKMKKQPRGYGLHCHRAIMTICRLIGIKDLYAKVSGSVNMLNLTRGLFLGLSRQETHQQLADKKSLHVVEFREECGPLPIVVASPQGALRKDPEPEDEVPDITLDWEDVKAAQGMKRSVWSGLKRAAT

Entity 57 Entity 57 polymer

Description description	bS6m
Molecular weight formula_weight	30365.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AF

MRRKAWKVPAGSRTIRSKRGGSGSCRVGGVCSSRWQLAEGTRGAALLQWLPGQGAGPRAGCRPQRAGLSRGRGAAALRRGRGVARGGAWLGEGAWRPVCAAARAFKPGLARPERAFAAWEPSGPAVRQVSAVPALFHPGRRFREEPRAVHSGMPRYELALILKAMQRPETAAALKRTLEALMDRGAVVRNLENLGERMLPYKISAHNQRHSRGGYFLVDFYAPATTVESMMEHLSRDIDVIRPNIVKHPLTQEVKECEGIVPVPLEEKLYSTKKRK

Entity 58 Entity 58 polymer

Description description	Mitochondrial ribosomal protein S7
Molecular weight formula_weight	28150.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AG

MAAPAVKAARGWSCSALGVRIAVLRFPGLTQVRWSRYGPEYKDPQIDKEYYRKPLAEQTEEEKYERDFKKTQLIKAAPATKTSSVFEDPVISKFTNMMMKGGNKVLARSLMTQTLEAVKRKQFAKYHAASAEEQATIERNPYTIFHQALKNCEPVIGLVPILKGGHFYQVPVPLADRRRRFLAMKWMIAECREKKHRRVLMPEKLSQELLEAFHNQGPVIKRKHDMHKMAEANRALAHYRWW

Entity 59 Entity 59 polymer

Description description	uS9m
Molecular weight formula_weight	45604.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AI

MAAPCVFCGAAVSYRLFLGCRVSFARGQVLWKAAAPELQAGARCQILRLRHTAVVTTKKNVAASRRETYTVDFIKKQIEEFNIGKRHLANMMGEDPETFTQEDIDRAIAYLFPSGLFEKRARPIMKHPEEIFPKQRAIQWGEDGRPFHFLFYTGKQSYYSLMHDTYGKLLDVEKHHNQLRAKDLLAEKTKILKDPIGSRWLIKEELEEMLVEKLSDQDYAQFIRLLERLSALPCGATEEDFVNRFRRSIPIQSKKQLIEPLQYDEQGMAFSRGEGKRKTAKAEVVVYGQGSGRIDVNGVDYLLYFPVTQDREQLMFPLHFLDRLGKHDMTCAVSGGGRSAQAGAVRLAMARALCSFVTEDEVEWMRQAGLLTADPRVRERKKPGQEGARRKFTWKKR

Entity 60 Entity 60 polymer

Description description	Mitochondrial ribosomal protein S10
Molecular weight formula_weight	23105.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AJ

MAARTAFGALARRLWQGSRNFSVSSSRSSTAKNGGFLLTTMKWVQFSNLHVDVPKDMTKPEITISDEPDTLYKRLSVLVKGHDKAVLDSYEYFAVLAAKELGISIKVHEPPRKIERFTLLKSVHIFKKHRVQYEMRTLYRCLELEHLTGSTADVYLEYIQRNLPEGVAMEVTKTKLEQLPEHIRKPIWETMPEEKEESKS

Entity 61 Entity 61 polymer

Description description	uS11m
Molecular weight formula_weight	20841.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AK

MQVVRNAGSRLLQSWAWPPKTRIVAGLPASTIHRSAPHLQDAAAKLDIEDKEEARTPSHSSFSIYPPIPGQENSLRWAGKKFEEIPIAHIKASYNNTQIQVVSAAHQPLAHASCGTEGFRNAKKGTGIAAQTAGIAAAAKATGKGVTHVRVVVKGLGPGRLSAIKGLTMGGLEVISITDNTPIPHNGCRPRKARRL

Entity 62 Entity 62 polymer

Description description	Mitochondrial ribosomal protein S12
Molecular weight formula_weight	15257.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AL

MSWSGLLRGLGTSLNCGLALVPRPWATRPMATLNQMHRLGPPKHPPGKMGPTAGRPQLKGVVLRTFIRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHSLQEHHVVLVQGGRTQDLPGVKLTVVRGKYDCGHVQKKK

Entity 63 Entity 63 polymer

Description description	Mitochondrial ribosomal protein S14
Molecular weight formula_weight	15120.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AN

MAASMLGFLLRTVRQMVPSSASGQVRSYYVDWKMLRDVKRRKMAYEYADERLRINSLRKNTILPKDLQEVADEEIASLPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGVQRAMW

Entity 64 Entity 64 polymer

Description description	uS15m
Molecular weight formula_weight	27411.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AO

MLRAAWRALSSIRTQAVTQAPVLGLPGGGCARFPSVQRALPSRPAGLILRAARGYAAQKPVQPNQDDPPPSMLLLDYQNVPGIHKVDDVVKRLLSLEMANQKEKLKIKKMQLMNKVLENPEDTSSLEARIVALTVKIRNYEEHMQKHRKDKAHKRFLLMSIDQRKKMLKNLRETNYAVFEKICKELGIEYTFPPPYHRKAHRRWVTKKALCTQVFREVQKLKKQKRALRAAAVAAHKQG

Entity 65 Entity 65 polymer

Description description	28S ribosomal protein S16, mitochondrial
Molecular weight formula_weight	15182.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AP

MVQLTTVLCRAYRGGHLTIRLALGGCTNRPFYRIVAAHSKCPRDGRFVEQLGSYDPLPNSHGEKLVALNFDRIRHWIGCGAHLSKPVEKLLGLSGFYPLHPMMITNAERLRRKRAREVLLASQKTDTEATETKAS

Entity 66 Entity 66 polymer

Description description	uS17m
Molecular weight formula_weight	14452.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AQ

MSIARSSVHAKWVVGKVIGTAMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTVGDIVLLKALPVPRTKHVKHELAEIIFKVGQVIDPVTGKPCAGTTYLESPISPESTRLTKNLEALQLSSTQ

Entity 67 Entity 67 polymer

Description description	Mitochondrial ribosomal protein S18C
Molecular weight formula_weight	16211.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AR

MAAVVSLCSRLGRRKSTDFVNAAVCLTDPGTHAVLWRSCSQYKQVASNEDLPVPMENPYKEPLKKCILCEKHVDYKNVQLLSQFISPFTGCIYGRHITGLCGKKQKEITKAIKRAQILGFMPVTYKDPAYLKDPKVCNIKYRE

Entity 68 Entity 68 polymer

Description description	bS21m
Molecular weight formula_weight	10682.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AU

MANHLKFIARTVMVQEGNVEGAYRTLNRILTMDGLIEDIKRRRYYEKPCRRRQRESYETCRRIYNMEMARKINFLMRKNRADPWQGC

Entity 69 Entity 69 polymer

Description description	unknown
Molecular weight formula_weight	1549.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AZ

XXXXXXXXXXXXXXXXXX

Entity 70 Entity 70 polymer

Description description	Mitochondrial ribosomal protein S22
Molecular weight formula_weight	43234.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Aa

MPHEPRETRNLSLPLPALVARIIMATLKASALLRSLQTNSCGTGRVCFPVRARPRPRALLQPLPGASGTGTLCRGLGSESESGNSEIRKPTFMDEEVQNILIKMTGLDLQKIFKPALQELKPPTYKLMTQAQLEEATKQAVEAAKVRLKMPPVLEERAPINDVLAEDKILEGTETAKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVYFPREGRRILTPVIFKEENLQTMYSQDQHVDVLNLCVAQFEPDSAEYIKIHHHTYEDIDKCGKYDLLRSTRHFGGMAWYFVNKKKIDGLLIDQIQRDLVSDATSLVHLYHILHPDGQSAQEAKKQGAEGLHLIKVFAKTEAQKGAYIELTLQAYQEAFITHSAAS

Entity 71 Entity 71 polymer

Description description	mS23
Molecular weight formula_weight	21666.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ab

MAGSRLETVGSIFSRTRDLIRAGVLKEKPLWLDIYNAFPPLREPVFRRPRLRYGKAKAAVQDIFYHEDRIRAKFYSAYGSGPKAFDLFNPNFKSTCQRFVEKYIELQRLGETDEEKLFVEAGKALLAEGVTLRRVGEARTQQEGSPISRKSEPTGIKPQTAVEENQPWKEVPQDQPLEAPEKESKGLPPP

Entity 72 Entity 72 polymer

Description description	Mitochondrial ribosomal protein S25
Molecular weight formula_weight	19954.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ac

MPMKGRFPIRRTLQYLGQGDVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQITMFKNMTPSPFLRFYLDSGEQVLVDVESKSNKEIVEHIRKILGKNEETLEKEEQEKKQLSHPAHFGPRKYCLRECMCEVEGQVPCPGLVPLPKEMTGKYKAALKATAQD

Entity 73 Entity 73 polymer

Description description	Mitochondrial ribosomal protein S26
Molecular weight formula_weight	23637.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ad

MLRVLGGLGARPAGRLPAPLLLPTRGRKTRHDPPAKSKAGRVATPPAVDPTEFFVLTERYRQYRQTVRALRLEFMSEVRKKLHEARAGVQAERKAQEDAAEHRELMAWNQAENQRLHELRLARLRQEALEQERRQAEEAVLQAREAQAWAQLKEQEVLQLQEEAKTFITRENLEARVEEALDSPKSYNWAITREGLVVRPQQKGS

Entity 74 Entity 74 polymer

Description description	Mitochondrial ribosomal protein S27
Molecular weight formula_weight	51946.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ae

MLSRAAPTEGTGGGRRSVDSTPPPRLPATPAPAFPLVCSKMASSIVRRGILRARKVSLPQLSLAGRRCLLSAAYVDSHKWEARDKEDCHLADLASLMDKTYERKLPVSSLTISRFVDNIASREDIDHAEYYLYKFRHSPNCWYLRDWTIHTWIRQCLKYGAQDKALYTLKNKVQYGIFPDNYTFNLLMDYFIKKENYKDALSVVFEIMMQEAFEVPSTQLLSLYVLYHCLAEKTDLSWEEERNFGASLLLPGLKQKNSVGLSSQLYGYALLGKVELQQGLRAVYCNMPLLWQPGYLHRALQVMEKVASSPEDGQLCGEALDVLDRVLKAVTAPAQGTSEEQPQEGEESQRSEELVEQLDVEETEQSKLPQYLERFEALRSKLQALGKVESESLLTLSTQLAKAQLPTCEAEDIAVYEQRLQQWHGERVRLIQREQEQRERARQDYEARRAAKASA

Entity 75 Entity 75 polymer

Description description	Mitoribosomal protein ms28, mrps28
Molecular weight formula_weight	21014.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Af

MAALCRTRAVTAKSHFLRVFFFSRPCRGTGTESGSGSESSESTEPKQRPGGFASALERHSELQQKAEFGRMRGSPKNVESFASMLRHSPLTQMGPAKNKLVIGQIFHIVEDDLYIDFGGKFHCVCKRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTILEADAVLLGLQESKDSKSKEERHEK

Entity 76 Entity 76 polymer

Description description	Death associated protein 3
Molecular weight formula_weight	46966.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ag

MAQLLANLTSIQVMLKGVTRLISRVHKLDPGHVLYMGTQAPQSLAAHLDNQVPVKSPRAISRTSEDDPAKHREQHEGQHYNISLQELKTVFPHGLPPRFAMQVKTFNEACLMVRKPALELLHYLKNTNFAHPAVRYVLYGEKGTGKTLSLCHILHFCAKQNWLILHIPDAHIWVKNCRDLLQSNYNKQRFDQPLEASTWLKNFKTANEHFLSQIKVQEKYVWNKRESTEKGRPLGEVVEQGIMRVRNATDAVGIVLKELKRQSSLGIFHLLVAVDGVNALWGRTTLKREDKSPIAPEELALIHNLRKMVKNDWQGGAIVLTVSQTGSLFKPRNAYLPQELLGKEGFDALDPFIPILVSNYNPKEFESCIQYYLENNWLQHEKAHTEEGKKELLFLSNRNPGQLERLCAYL

Entity 77 Entity 77 polymer

Description description	28S ribosomal protein S31, mitochondrial
Molecular weight formula_weight	44092.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ah

MLPRVSAVIPLRPLSRLPLCSGGPEASAAAILLLDSLRGTVRTENNIQRYFGTNNLVYSKKDEQSGPTCEISKETESKGSVKENSKKDLLNIIKGMKVELSTVNVQTTKPSNKRQLKNLETAIGRIKKAPEDTPQKRSESLSSELVAAVSAVADSLPFDRRMTKSELLRQLQKHEEDSRXQKDGEKPKISFSNIISDMKVARSATARVSTRPVHQIQFDEGTDDFADQEKTLNLKKSFRKNIFKGRRLNIFEPQAVTEEAPETEAVPSLWDIEFAKQLAAVTERPFQNGFEEMIQWTKEGKLWEFPINNEAGFDDDGSEFHEHIFLDKYLQDFPKQGPIRHFMELVTCGLSKNPYLSVKQKVEHIEWFRNYFNEKRVILKESGIQLN

Entity 78 Entity 78 polymer

Description description	mS33
Molecular weight formula_weight	12544.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ai

MSSLSEYAVRMSRLSARLFGEVARPTDSKSMKVVKLFSEQPLAKRKETYDWYPNHNTYFALMGTLRFLGLYRDEHQDFRDEQLRLKKLRGKGKPRKGEGKRAMKKK

Entity 79 Entity 79 polymer

Description description	mS34
Molecular weight formula_weight	25843.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Aj

MARKKVRPRLIAELARRVRALREQRERPRDSQRYALDYETMMRPHSGNRLPMRAWADVRHESRLLQLLNRLPLFGLGRLVTRKSWLWQHDEPCYWRLTRVRPDYAAENLDHGKAWGILTFKGKTESEAREIEQVMYHDWRLVPKHEEEAFTAFTLVPEDTPLSVPYPPLLRAMILAQRQKYGDTSTEEPMLNLERARIDPWDYPAKLEAKTKTKGAAV

Entity 80 Entity 80 polymer

Description description	Mitochondrial ribosomal protein S35
Molecular weight formula_weight	37104.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ak

MAATSLPAWLILKSRAGTFRAFSTAMSPATRSPRPALRTTERTSKPERALRRKALPPRTEKMAVDQDWPSVYPVAAPFKPSAVPLPVRMGYPVKRGVPMAKEGNLELLKIPNFLHLTPVAIKRHCEALKDFCTEWPAALDSDEKCEKHFPIEIDTADYVSAGPSIRNPKARVVTLRVKLSSLNLDDHAKKKLIKLVGDRYCKSTDVLTIKTDRCPLKRQNYDYAVYLLTVLYHESWKTEEWEKKKTEADMEEYIWENSTSEKNILETLLQIKAAEKNLELSKEELLGTKEVEDYRKSVVSLKNEGDNENTLSQYKESVKRLLNLA

Entity 81 Entity 81 polymer

Description description	mS37
Molecular weight formula_weight	13561.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Am

MATPSLRGRLARLGNPRRPILKPNKPLILANHVGERRREKGEATCITEMSVMMACWKQNEFRDEACRKEIQDFFDCASRAEAARKMRSIQENLGELGSLPPKKLNKLLHRFPNKPHVS

Entity 82 Entity 82 polymer

Description description	Aurora kinase A interacting protein 1
Molecular weight formula_weight	22843.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	An

MFLVRLTSQLLRAVPGAGRSGSPRVSEVLGRHACRPRYSTQPPGPSGIASLPGKHVHPELEEMLVPRKMSISPLESWLTIRYLLPRLGAGTPGTVSPAQLYQCPPSQVGEGVKQGDKEVRDTPQMQCKNILKIRRRKMNHHKYRKLVKRTRFLRRKVREGRLRQKQVKFERDLKRIWQKAGLKEAPAGWQTPKIYLKNQ

Entity 83 Entity 83 polymer

Description description	;Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,mS39,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3,Pentatricopeptide repeat domain 3 ;
Molecular weight formula_weight	76524.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ao

MPCSRRQGMFFEPNILQVGSKLCYPDRYSSGHGFYSGSAAHPEVEGANVTGIEEVVIPKKKTWDKVAILQALASTVHRDSTAAPYVFQDDPYLIPTSSVESHSFLLAKKSGENAAKFIINSYPKYFQKDIAEPHIPCLMPEYFEPQIEDVSEAALQERIKLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTWRTKNNAERIFALMPEKNAHSYCTMIRGMVKHQAPTQALNLYTVLLNNRLRADVYTFNSLIEATALVVNEKFEEKWNNILDLLKQMVTQNVKPNLQTFNTILKCLRRFYAFGKLPALQTLREMKAIGIEPSLATYHYVIQLFYQHESPSKGSSLIIYDIMNEVMGKRFSPRDPDDDMFFQSAMRVCSSLRDLELAYQVHGLLNTGDNWKLIGSDHRRNFYYSKFFNLLCFMEQIDVTLKWYKDLIPSVFFPHSQTMIDLLQALDVANRLDMVPQIWKDSKEYGHTFRNELKEEILMLMARDQHPPELQVAFADCAADIKSTYESQDARQTAPEWPASSLNYVAVLFLRAGRTQEAWKMLGLFRKHNKIPRAELLNEFLDSAKASSSPAQAIELVKLASAFSLPVCEGLTRRVMAEFTLTQEQREALGELTALTSDSSSDSDSDSDSDISEGK

Entity 84 Entity 84 polymer

Description description	28S ribosomal protein S18b, mitochondrial
Molecular weight formula_weight	29220.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ap

MAASILNVLLRRLPGVSPFRGAYGVQVLLQTLCTKAPPEDDSLPQVPISPYKDEPWKYLDSEEYQNRYGSRPVWADYRRNHKGGIPPQRTRKMCIRGNKVAGNPCPICRDQKLHVDFRNVKLLEQFVCAHTGIIFHAPYTGVCMKQHKKLTQAIQKARDHGLLRYHIPQVEPRDLDFSTTHGAVSSTPPAPTLVSGDPWYPWYSWKQPPERELSRLRRLYQGRLREESGPPPELMPEVPLTAPAEASSTEPGAPQSAL

Entity 85 Entity 85 polymer

Description description	Mitochondrial ribosomal protein L12
Molecular weight formula_weight	21269.0 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	CL,DL,EL,FL,GL,HL

MLPAAASSLWGPCFGLRAAALRVARHQGPRLCGVRLMRCSSHRKGEALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGFMPMGAVAPGAPPAAAAPEAAEEDLPKRKEQTHFTVRLTEAKPVDKVKLIKEIKSHIQGINLVQAKKLVESLPQEIKANVPKAEAEKIKAALEAVGGTVVLE

Entity 86 Entity 86 polymer

Description description	tRNA(P/P) and tRNA(E*)
Molecular weight formula_weight	21713.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	AV,AY

UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUCCA

Entity 87 Entity 87 polymer

Description description	mRNA
Molecular weight formula_weight	1792.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	AX

UUUUUU

Entity 88 Entity 88 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	324

Entity 89 Entity 89 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 90 Entity 90 non-polymer

Description description	SPERMINE
Molecular weight formula_weight	202.3 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 91 Entity 91 non-polymer

Description description	GUANOSINE-5'-MONOPHOSPHATE
Molecular weight formula_weight	363.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 92 Entity 92 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 93 Entity 93 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	3

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	26001

55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mitochondrial ribosomal protein L27

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial ribosomal protein L28

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial ribosomal protein L47

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

uL30m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

bL31m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

bL32m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

bL33m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial ribosomal protein L34

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

uL2m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ICT1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer