8oin

55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mitochondrial ribosomal protein L12

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8D0VGD9_PIG
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B1； PDBConstruct 1–198； UniProt 1–198 Author chain B2； PDBConstruct 1–198； UniProt 1–198 Author chain B3； PDBConstruct 1–198； UniProt 1–198 Author chain B4； PDBConstruct 1–198； UniProt 1–198 Author chain B5； PDBConstruct 1–198； UniProt 1–198 Author chain B6； PDBConstruct 1–198； UniProt 1–198

Large ribosomal subunit protein uL22m

OrganismNot specified

UniProt A0A4X1TXR4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1TXR4_PIG
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain BA； PDBConstruct 1–210； UniProt 1–210

39S ribosomal protein L23, mitochondrial

OrganismNot specified

UniProt A0A480JJI1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A480JJI1_PIG
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain BB； PDBConstruct 1–150； UniProt 1–150

uL24m

OrganismNot specified

UniProt F1RHJ1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RHJ1_PIG
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain BC； PDBConstruct 1–216； UniProt 1–216

39S ribosomal protein L27, mitochondrial

OrganismNot specified

UniProt A0A4X1U0F6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1U0F6_PIG
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain BD； PDBConstruct 1–148； UniProt 1–148

Mitochondrial ribosomal protein L28

OrganismNot specified

UniProt A0A286ZTW8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZTW8_PIG
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain BE； PDBConstruct 1–256； UniProt 1–256

Mitochondrial ribosomal protein L47

OrganismNot specified

UniProt F1SGC7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SGC7_PIG
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain BF； PDBConstruct 1–250； UniProt 1–250

Large ribosomal subunit protein uL30m

OrganismNot specified

UniProt A0A8D0VJF4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8D0VJF4_PIG
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain BG； PDBConstruct 1–161； UniProt 1–161

Mitochondrial ribosomal protein L32

OrganismNot specified

UniProt I3LTC4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LTC4_PIG
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain BH； PDBConstruct 1–207； UniProt 1–207

Large ribosomal subunit protein bL33m

OrganismNot specified

UniProt A0A4X1TLP9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1TLP9_PIG
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain BI； PDBConstruct 1–65； UniProt 1–65

Large ribosomal subunit protein bL34m

OrganismNot specified

UniProt A0A8D1JE64

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8D1JE64_PIG
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain BJ； PDBConstruct 1–95； UniProt 1–95

39S ribosomal protein L35, mitochondrial

OrganismNot specified

UniProt A0A5G2QZK0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A5G2QZK0_PIG
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain BK； PDBConstruct 1–188； UniProt 1–188

Mitochondrial ribosomal protein L2

OrganismNot specified

UniProt A0A287A143

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287A143_PIG
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain BL； PDBConstruct 1–306； UniProt 1–306

ICT1

OrganismNot specified

UniProt A0A140UHW4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A140UHW4_PIG
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain BM； PDBConstruct 1–399； UniProt 1–399

Mitochondrial ribosomal protein L4

OrganismNot specified

UniProt A0A287B9C4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287B9C4_PIG
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain BN； PDBConstruct 1–294； UniProt 1–294

Mitochondrial ribosomal protein L9

OrganismNot specified

UniProt I3LR45

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LR45_PIG
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain BO； PDBConstruct 1–268； UniProt 1–268

Mitochondrial ribosomal protein L10

OrganismNot specified

UniProt F1RWJ0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RWJ0_PIG
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain BP； PDBConstruct 1–257； UniProt 1–257

Mitochondrial ribosomal protein L11

OrganismNot specified

UniProt F1RU54

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RU54_PIG
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain BQ； PDBConstruct 1–192； UniProt 1–192

39S ribosomal protein L13, mitochondrial

OrganismNot specified

UniProt K7GP19

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	K7GP19_PIG
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain BR； PDBConstruct 1–197； UniProt 1–197

Mitochondrial ribosomal protein L14

OrganismNot specified

UniProt A0A287BMZ6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287BMZ6_PIG
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain BS； PDBConstruct 1–325； UniProt 1–325

39S ribosomal protein L15, mitochondrial

OrganismNot specified

UniProt A0A5G2RG26

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A5G2RG26_PIG
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain BT； PDBConstruct 1–296； UniProt 1–296

uL16m

OrganismNot specified

UniProt F1RI89

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RI89_PIG
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain BU； PDBConstruct 1–251； UniProt 1–251

bL17m

OrganismNot specified

UniProt F1RMQ4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RMQ4_PIG
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain BV； PDBConstruct 1–169； UniProt 1–169

Mitochondrial ribosomal protein L18

OrganismNot specified

UniProt A0A4X1VX01

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1VX01_PIG
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain BW； PDBConstruct 1–188； UniProt 1–188

39S ribosomal protein L19, mitochondrial

OrganismNot specified

UniProt I3LNJ0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LNJ0_PIG
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain BX； PDBConstruct 1–303； UniProt 1–303

Mitochondrial ribosomal protein L20

OrganismNot specified

UniProt A0A286ZU56

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZU56_PIG
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain BY； PDBConstruct 1–149； UniProt 1–149

Mitochondrial ribosomal protein L21

OrganismNot specified

UniProt F1RY70

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RY70_PIG
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain BZ； PDBConstruct 1–209； UniProt 1–209

39S ribosomal protein L52, mitochondrial

OrganismNot specified

UniProt F1S9B7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1S9B7_PIG
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain Ba； PDBConstruct 1–160； UniProt 1–160

Mitochondrial ribosomal protein L53

OrganismNot specified

UniProt A0A8D0LKT0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8D0LKT0_PIG
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain Bb； PDBConstruct 1–112； UniProt 1–112

mL54

OrganismNot specified

UniProt I3LN63

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LN63_PIG
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain Bc； PDBConstruct 1–138； UniProt 1–138

Mitochondrial ribosomal protein L55

OrganismNot specified

UniProt A0A4X1ULI6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1ULI6_PIG
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain Bd； PDBConstruct 1–126； UniProt 1–126

Mitochondrial ribosomal protein L57

OrganismNot specified

UniProt A0A287BP93

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287BP93_PIG
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain Be； PDBConstruct 1–102； UniProt 1–102

mL62 (ICT1)

OrganismNot specified

UniProt A0A286ZJR2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZJR2_PIG
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain Bf； PDBConstruct 1–205； UniProt 1–205

mL64

OrganismNot specified

UniProt A0A286ZXA6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZXA6_PIG
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain Bg； PDBConstruct 1–222； UniProt 1–222

Mitochondrial ribosomal protein S18A

OrganismNot specified

UniProt F1RRH6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RRH6_PIG
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain Bh； PDBConstruct 1–196； UniProt 1–196

39S ribosomal protein S30, mitochondrial

OrganismNot specified

UniProt A0A480QIM3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A480QIM3_PIG
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain Bi； PDBConstruct 1–433； UniProt 1–433

39S ribosomal protein L1, mitochondrial

OrganismNot specified

UniProt A0A287AF82

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287AF82_PIG
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain Bj； PDBConstruct 1–304； UniProt 1–304

Ribosomal protein

OrganismNot specified

UniProt A0A287A731

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287A731_PIG
Isoform	—
PDB entities	41
Chains and sequence ranges	Author chain Bl； PDBConstruct 1–100； UniProt 1–100

Mitochondrial ribosomal protein L37

OrganismNot specified

UniProt A0A287BIV6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287BIV6_PIG
Isoform	—
PDB entities	42
Chains and sequence ranges	Author chain Bm； PDBConstruct 1–423； UniProt 1–423

Mitochondrial ribosomal protein L38

OrganismNot specified

UniProt F1RW03

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RW03_PIG
Isoform	—
PDB entities	43
Chains and sequence ranges	Author chain Bn； PDBConstruct 1–380； UniProt 1–380

Mitochondrial ribosomal protein L39

OrganismNot specified

UniProt F1SHP6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SHP6_PIG
Isoform	—
PDB entities	44
Chains and sequence ranges	Author chain Bo； PDBConstruct 1–334； UniProt 1–334

Mitochondrial ribosomal protein L40

OrganismNot specified

UniProt A0A286ZP98

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZP98_PIG
Isoform	—
PDB entities	45
Chains and sequence ranges	Author chain Bp； PDBConstruct 1–162； UniProt 1–162

39S ribosomal protein L41, mitochondrial

OrganismNot specified

UniProt A0A8D1BPA5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8D1BPA5_PIG
Isoform	—
PDB entities	46
Chains and sequence ranges	Author chain Bq； PDBConstruct 1–135； UniProt 1–135

mL42

OrganismNot specified

UniProt A0A287BQA1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287BQA1_PIG
Isoform	—
PDB entities	47
Chains and sequence ranges	Author chain Br； PDBConstruct 1–142； UniProt 1–142

Large ribosomal subunit protein mL43

OrganismNot specified

UniProt F1S8U4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1S8U4_PIG
Isoform	—
PDB entities	48
Chains and sequence ranges	Author chain Bs； PDBConstruct 2–159； UniProt 2–159

mL44

OrganismNot specified

UniProt F1SR64

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SR64_PIG
Isoform	—
PDB entities	49
Chains and sequence ranges	Author chain Bt； PDBConstruct 1–332； UniProt 1–332

Mitochondrial ribosomal protein L45

OrganismNot specified

UniProt I3LGM5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LGM5_PIG
Isoform	—
PDB entities	50
Chains and sequence ranges	Author chain Bu； PDBConstruct 1–306； UniProt 1–306

Mitochondrial ribosomal protein L46

OrganismNot specified

UniProt F1SRT0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SRT0_PIG
Isoform	—
PDB entities	51
Chains and sequence ranges	Author chain Bv； PDBConstruct 1–279； UniProt 1–279

39S ribosomal protein L48, mitochondrial

OrganismNot specified

UniProt A0A480J9Z6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A480J9Z6_PIG
Isoform	—
PDB entities	52
Chains and sequence ranges	Author chain Bw； PDBConstruct 1–269； UniProt 1–269

Mrpl34

OrganismNot specified

UniProt A0A0R4J8D6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0R4J8D6_PIG
Isoform	—
PDB entities	53
Chains and sequence ranges	Author chain Bx； PDBConstruct 1–166； UniProt 1–166

Mitochondrial ribosomal protein L50

OrganismNot specified

UniProt I3L9H6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3L9H6_PIG
Isoform	—
PDB entities	54
Chains and sequence ranges	Author chain By； PDBConstruct 1–198； UniProt 1–198

Large ribosomal subunit protein mL51

OrganismNot specified

UniProt A0A8D1VKN8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8D1VKN8_PIG
Isoform	—
PDB entities	55
Chains and sequence ranges	Author chain Bz； PDBConstruct 1–128； UniProt 1–128

28S ribosomal protein S35, mitochondrial isoform 1

OrganismNot specified

UniProt F1SG95

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SG95_PIG
Isoform	—
PDB entities	57
Chains and sequence ranges	Author chain AB； PDBConstruct 1–366； UniProt 1–366

Mitochondrial ribosomal protein S24

OrganismNot specified

UniProt A0A287ANU4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287ANU4_PIG
Isoform	—
PDB entities	58
Chains and sequence ranges	Author chain AC； PDBConstruct 1–167； UniProt 1–167

Small ribosomal subunit protein mS38

OrganismNot specified

UniProt A0A8D1P8R7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8D1P8R7_PIG
Isoform	—
PDB entities	59
Chains and sequence ranges	Author chain AD； PDBConstruct 1–199； UniProt 1–199

Mitoribosomal protein bs6m, mrps6

OrganismNot specified

UniProt A0A5K1V0G5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A5K1V0G5_PIG
Isoform	—
PDB entities	60
Chains and sequence ranges	Author chain AE； PDBConstruct 1–124； UniProt 1–124

Mitochondrial ribosomal protein S7

OrganismNot specified

UniProt A0A286ZJ25

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZJ25_PIG
Isoform	—
PDB entities	61
Chains and sequence ranges	Author chain AF； PDBConstruct 1–242； UniProt 1–242

Mitochondrial ribosomal protein S10

OrganismNot specified

UniProt F1RUU2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RUU2_PIG
Isoform	—
PDB entities	63
Chains and sequence ranges	Author chain AH； PDBConstruct 1–200； UniProt 1–200

Mitochondrial ribosomal protein S12

OrganismNot specified

UniProt A0A0M3KL52

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M3KL52_PIG
Isoform	—
PDB entities	65
Chains and sequence ranges	Author chain AJ； PDBConstruct 1–139； UniProt 1–139

Mitochondrial ribosomal protein S14

OrganismNot specified

UniProt A0A0M3KL53

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M3KL53_PIG
Isoform	—
PDB entities	66
Chains and sequence ranges	Author chain AK； PDBConstruct 1–128； UniProt 1–128

28S ribosomal protein S15, mitochondrial

OrganismNot specified

UniProt A0A287AKS1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287AKS1_PIG
Isoform	—
PDB entities	67
Chains and sequence ranges	Author chain AL； PDBConstruct 1–259； UniProt 1–259

28S ribosomal protein S16, mitochondrial

OrganismNot specified

UniProt A0A480JTD7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A480JTD7_PIG
Isoform	—
PDB entities	68
Chains and sequence ranges	Author chain AM； PDBConstruct 1–135； UniProt 1–135

28S ribosomal protein S17, mitochondrial

OrganismNot specified

UniProt A0A8D1IXU1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8D1IXU1_PIG
Isoform	—
PDB entities	69
Chains and sequence ranges	Author chain AN； PDBConstruct 1–130； UniProt 1–130

28S ribosomal protein S18b, mitochondrial

OrganismNot specified

UniProt Q767K8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RT18B_PIG
Isoform	—
PDB entities	70
Chains and sequence ranges	Author chain AO； PDBConstruct 1–258； UniProt 1–258

Mitochondrial ribosomal protein S18C

OrganismNot specified

UniProt A0A0M3KL54

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M3KL54_PIG
Isoform	—
PDB entities	71
Chains and sequence ranges	Author chain AP； PDBConstruct 1–143； UniProt 1–143

28S ribosomal protein S21, mitochondrial

OrganismNot specified

UniProt A0A286ZNB3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZNB3_PIG
Isoform	—
PDB entities	72
Chains and sequence ranges	Author chain AQ； PDBConstruct 1–87； UniProt 1–87

Mitochondrial ribosomal protein S22

OrganismNot specified

UniProt A0A287AQT5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287AQT5_PIG
Isoform	—
PDB entities	73
Chains and sequence ranges	Author chain AR； PDBConstruct 1–382； UniProt 1–382

mS23

OrganismNot specified

UniProt A0A287AEW3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287AEW3_PIG
Isoform	—
PDB entities	74
Chains and sequence ranges	Author chain AS； PDBConstruct 1–190； UniProt 1–190

Mitochondrial ribosomal protein S25

OrganismNot specified

UniProt A0A0M3KL55

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M3KL55_PIG
Isoform	—
PDB entities	75
Chains and sequence ranges	Author chain AT； PDBConstruct 1–173； UniProt 1–173

Mitochondrial ribosomal protein S26

OrganismNot specified

UniProt A0A287AY01

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287AY01_PIG
Isoform	—
PDB entities	76
Chains and sequence ranges	Author chain AU； PDBConstruct 1–205； UniProt 1–205

Mitochondrial ribosomal protein S27

OrganismNot specified

UniProt A0A5G2R1I0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A5G2R1I0_PIG
Isoform	—
PDB entities	77
Chains and sequence ranges	Author chain AV； PDBConstruct 1–395； UniProt 1–395

Mitoribosomal protein ms28, mrps28

OrganismNot specified

UniProt A0A0M3KL56

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M3KL56_PIG
Isoform	—
PDB entities	78
Chains and sequence ranges	Author chain AW； PDBConstruct 1–188； UniProt 1–188

Small ribosomal subunit protein mS29

OrganismNot specified

UniProt A0A8D1XNL0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8D1XNL0_PIG
Isoform	—
PDB entities	79
Chains and sequence ranges	Author chain AX； PDBConstruct 1–410； UniProt 1–410

28S ribosomal protein S31, mitochondrial

OrganismNot specified

UniProt F1RME2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1RME2_PIG
Isoform	—
PDB entities	80
Chains and sequence ranges	Author chain AY； PDBConstruct 1–381； UniProt 1–381

Mitochondrial ribosomal protein S33

OrganismNot specified

UniProt F1S8G3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1S8G3_PIG
Isoform	—
PDB entities	81
Chains and sequence ranges	Author chain AZ； PDBConstruct 1–148； UniProt 1–148

Peptide chain release factor 1, mitochondrial

Homo sapiens

UniProt O75570

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RF1M_HUMAN
Isoform	—
PDB entities	82
Chains and sequence ranges	Author chain Aa； PDBConstruct 1–445； UniProt 1–445

Mitochondrial ribosomal protein S2

OrganismNot specified

UniProt F1S001

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1S001_PIG
Isoform	—
PDB entities	83
Chains and sequence ranges	Author chain Ab； PDBConstruct 1–289； UniProt 1–289

Coiled-coil-helix-coiled-coil-helix domain containing 1

OrganismNot specified

UniProt F1SU49

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SU49_PIG
Isoform	—
PDB entities	84
Chains and sequence ranges	Author chain Ac； PDBConstruct 1–118； UniProt 1–118

28S ribosomal protein S5, mitochondrial isoform X2

OrganismNot specified

UniProt F1SU66

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SU66_PIG
Isoform	—
PDB entities	85
Chains and sequence ranges	Author chain Ad； PDBConstruct 1–430； UniProt 1–430

mS39

OrganismNot specified

UniProt K7GKS8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	K7GKS8_PIG
Isoform	—
PDB entities	86
Chains and sequence ranges	Author chain Ae； PDBConstruct 1–692； UniProt 1–692

uS9m

OrganismNot specified

UniProt I3LU08

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LU08_PIG
Isoform	—
PDB entities	87
Chains and sequence ranges	Author chain Ag； PDBConstruct 1–397； UniProt 1–397

Mitochondrial ribosomal protein S11

OrganismNot specified

UniProt A0A286ZJJ6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S34 × 1 （A0A287AVS9） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A286ZJJ6_PIG
Isoform	—
PDB entities	88
Chains and sequence ranges	Author chain Ai； PDBConstruct 1–196； UniProt 1–196

Mitochondrial ribosomal protein S34

OrganismNot specified

UniProt A0A287AVS9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 88 RNA 6	Mitochondrial ribosomal protein L12 × 6 （A0A8D0VGD9） E-site tRNA × 1 16S rRNA × 1 CP Phe-tRNA × 1 Large ribosomal subunit protein uL22m × 1 （A0A4X1TXR4） 39S ribosomal protein L23, mitochondrial × 1 （A0A480JJI1） uL24m × 1 （F1RHJ1） 39S ribosomal protein L27, mitochondrial × 1 （A0A4X1U0F6） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） Large ribosomal subunit protein uL30m × 1 （A0A8D0VJF4） Mitochondrial ribosomal protein L32 × 1 （I3LTC4） Large ribosomal subunit protein bL33m × 1 （A0A4X1TLP9） Large ribosomal subunit protein bL34m × 1 （A0A8D1JE64） 39S ribosomal protein L35, mitochondrial × 1 （A0A5G2QZK0） Mitochondrial ribosomal protein L2 × 1 （A0A287A143） ICT1 × 1 （A0A140UHW4） Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） 39S ribosomal protein L13, mitochondrial × 1 （K7GP19） Mitochondrial ribosomal protein L14 × 1 （A0A287BMZ6） 39S ribosomal protein L15, mitochondrial × 1 （A0A5G2RG26） uL16m × 1 （F1RI89） bL17m × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A4X1VX01） 39S ribosomal protein L19, mitochondrial × 1 （I3LNJ0） Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） 39S ribosomal protein L52, mitochondrial × 1 （F1S9B7） Mitochondrial ribosomal protein L53 × 1 （A0A8D0LKT0） mL54 × 1 （I3LN63） Mitochondrial ribosomal protein L55 × 1 （A0A4X1ULI6） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） mL62 (ICT1) × 1 （A0A286ZJR2） mL64 × 1 （A0A286ZXA6） Mitochondrial ribosomal protein S18A × 1 （F1RRH6） 39S ribosomal protein S30, mitochondrial × 1 （A0A480QIM3） 39S ribosomal protein L1, mitochondrial × 1 （A0A287AF82） Ribosomal protein × 1 （A0A287A731） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） 39S ribosomal protein L41, mitochondrial × 1 （A0A8D1BPA5） mL42 × 1 （A0A287BQA1） Large ribosomal subunit protein mL43 × 1 （F1S8U4） mL44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） 39S ribosomal protein L48, mitochondrial × 1 （A0A480J9Z6） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Large ribosomal subunit protein mL51 × 1 （A0A8D1VKN8） 12S rRNA × 1 28S ribosomal protein S35, mitochondrial isoform 1 × 1 （F1SG95） Mitochondrial ribosomal protein S24 × 1 （A0A287ANU4） Small ribosomal subunit protein mS38 × 1 （A0A8D1P8R7） Mitoribosomal protein bs6m, mrps6 × 1 （A0A5K1V0G5） Mitochondrial ribosomal protein S7 × 1 （A0A286ZJ25） P-site Met-tRNA(fMet) × 1 Mitochondrial ribosomal protein S10 × 1 （F1RUU2） mRNA × 1 Mitochondrial ribosomal protein S12 × 1 （A0A0M3KL52） Mitochondrial ribosomal protein S14 × 1 （A0A0M3KL53） 28S ribosomal protein S15, mitochondrial × 1 （A0A287AKS1） 28S ribosomal protein S16, mitochondrial × 1 （A0A480JTD7） 28S ribosomal protein S17, mitochondrial × 1 （A0A8D1IXU1） 28S ribosomal protein S18b, mitochondrial × 1 （Q767K8） Mitochondrial ribosomal protein S18C × 1 （A0A0M3KL54） 28S ribosomal protein S21, mitochondrial × 1 （A0A286ZNB3） Mitochondrial ribosomal protein S22 × 1 （A0A287AQT5） mS23 × 1 （A0A287AEW3） Mitochondrial ribosomal protein S25 × 1 （A0A0M3KL55） Mitochondrial ribosomal protein S26 × 1 （A0A287AY01） Mitochondrial ribosomal protein S27 × 1 （A0A5G2R1I0） Mitoribosomal protein ms28, mrps28 × 1 （A0A0M3KL56） Small ribosomal subunit protein mS29 × 1 （A0A8D1XNL0） 28S ribosomal protein S31, mitochondrial × 1 （F1RME2） Mitochondrial ribosomal protein S33 × 1 （F1S8G3） Peptide chain release factor 1, mitochondrial × 1 （O75570） Mitochondrial ribosomal protein S2 × 1 （F1S001） Coiled-coil-helix-coiled-coil-helix domain containing 1 × 1 （F1SU49） 28S ribosomal protein S5, mitochondrial isoform X2 × 1 （F1SU66） mS39 × 1 （K7GKS8） uS9m × 1 （I3LU08） Mitochondrial ribosomal protein S11 × 1 （A0A286ZJJ6） MAGNESIUM ION × 332 POTASSIUM ION × 41 PHENYLALANINE × 1 ZINC ION × 3 FE2/S2 (INORGANIC) CLUSTER × 3 SPERMINE × 1 SPERMIDINE × 1 N-FORMYLMETHIONINE × 1 ADENOSINE-5'-TRIPHOSPHATE × 1 GUANOSINE-5'-DIPHOSPHATE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287AVS9_PIG
Isoform	—
PDB entities	89
Chains and sequence ranges	Author chain Aj； PDBConstruct 1–505； UniProt 1–505

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8oin
Deposition date deposition_date	2023-03-23
Structure title title	55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA
Keywords keywords	mammalian mitochondrial ribosome, release factor mtRF1, non-canonical stop codon, RIBOSOME; RIBOSOME
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8oin__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8oin__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8oin__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	92.40 Å
Rg (electron density)	96.93 Å
Total Rg	96.21 Å
Atom count	180605
Residues	17816
Excluded volume	3015600 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8oin__assembly_1__model_1`	94-meric （94）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (100)

Entity 1 Entity 1 polymer

Description description	Mitochondrial ribosomal protein L12
Molecular weight formula_weight	21269.0 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B1,B2,B3,B4,B5,B6
Atom count atom_count	180624

MLPAAASSLWGPCFGLRAAALRVARHQGPRLCGVRLMRCSSHRKGEALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGFMPMGAVAPGAPPAAAAPEAAEEDLPKRKEQTHFTVRLTEAKPVDKVKLIKEIKSHIQGINLVQAKKLVESLPQEIKANVPKAEAEKIKAALEAVGGTVVLE

Entity 2 Entity 2 polymer

Description description	E-site tRNA
Molecular weight formula_weight	894.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	B7

CCA

Entity 3 Entity 3 polymer

Description description	16S rRNA
Molecular weight formula_weight	504908.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	B8

ACCAAAGCUAGCUCAACAUACUAAACAAAUACAAAAAUACACCAAAAUAAAAUAAAACAUUCACCUAACAUUAAAGUAUAGGAGAUAGAAAUUUUUAUCCUGACGCUAUAGAGAUAGUACCGUAAGGGAAAGAUGAAAGAAUAAAAUAAAAGUAAAAAAAAGCAAAGAUUACCCCUUCUACCUUUUGCAUAAUGGUUUAACCAGAAAAAAUCUAACAAAGAGAACUUUAGCUAGAUACCCCGAAACCAGACGAGCUACCCAUGAGCAGUUUAAAAGAACCAACUCAUCUAUGUGGCAAAAUAGUGAGAAGACUUGUAGGUAGAGGUGAAAAGCCUAACGAGCCUGGUGAUAGCUGGUUGUCCGAGAAAGAAUUUUAGUUCAACCUUAAAAAUACCCCAAAAACCCUAAAUUCCAAUGUAUUUUUAAGAGAUAGUCUAAAAAGGUACAGCUUUUUAGAAACGGAUACAACCUUGACUAGAGAGUAAAAUCUUAAUACUACCAUAGUAGGCCUAAAAGCAGCCAUCAAUUGAGAAAGCGUUAAAGCUCAACAAAUUCACCAACAUAAUCCCAAAAACUAAUAACAAACUCCUAGCCCAAUACCGGACUAAUCUAUUGAAACAUAGAAGCAAUAAUGUUAAUAUGAGUAACAAGAAGCCUUUCUCCUCGCACACGCUUACAUCAGUAACUAAUAAUAUACUGAUAAUUAACAACCAAUAAACCAAAACAACACUAAAACGUUUAUUAAUUACAUUGUUAACCCAACACAGGAGUGCACCAAGGAAAGAUUAAAAGAAGUAAAAGGAACUCGGCAAACACAAACCCCGCCUGUUUACCAAAAACAUCACCUCUAGCAUUACUAGUAUUAGAGGCAAUGCCUGCCCAGUGACACCAGUUUAACGGCCGCGGUAUUCUGACCGUGCAAAGGUAGCAUAAUCACUUGUUCUCCAAAUAAGGACUUGUAUGAAUGGCCACACGAGGGUUUUACUGUCUCUUACUUCCAAUCAGUGAAAUUAACCUUCCCGUGAAGAGGCGGGAAUAAAAAAAUAAGACGAGAAGACCCUAUGGAGCUUUAAUUAACUAUUCCAAAAGUUAAACAACUCAACCACAAAGGGAUAAAACAUAACUUAACAUGGACUAGCAAUUUCGGUUGGGGUGACCUCGGAGUACAAAAAACCCUCCGAGUGAUUUUAAUCUAGACAAACCAGUCAAAAUAACCAUAACAUCACUUAUUGAUCCAAAAUUUUGAUCAACGGAACAAGUUACCCUAGGGAUAACAGCGCAAUCCUGUUCUAGAGUUCCUAUCGACAAUAGGGUUUACGACCUCGAUGUUGGAUCAGGACACCCAAAUGGUGCAACCGCUAUUAAAGGUUCGUUUGUUCAACGAUUAAAGUCCUACGUGAUCUGAGUUCAGACCGGAGCAAUCCAGGUCGGUUUCUAUCUAUUAUAAAUUUCUCCCAGUACGAAAGGACAAGAGAAAUGGGACCAACCUCACAAACGCGUCUCAGAGAUAAUUAAUGAUUUAAUCUUAACCUAAUUAACUCAUAAUAAAUCCAGCCCUAGAACAGGGCACA

Entity 4 Entity 4 polymer

Description description	CP Phe-tRNA
Molecular weight formula_weight	23516.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	B9

GUUAAUGUAGCUUAAAUUAUCAAAGCAAGGCACUGAAAAUGCCUAGAUGAGCCUCACAGCUCCAUAAACACCA

Entity 5 Entity 5 polymer

Description description	Large ribosomal subunit protein uL22m
Molecular weight formula_weight	24313.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BA

MAAAVLERLGGLWMQNLRGKLALRLLSSHSILPQSHIHTSASVEISRKWEKKNKIVYPPQLPGEPRRPAEIYHCRRQIKYSKDKMWYLAKLIRGMSIDQALAQLEFSDKKGAQIIKEVLLEAQDMAVRDHNVEFRSNLYVAESTSGRGQYLKRIRYHGRGRFGIMEKVFCHYFVKLVEGPPPPREAPKTAVAHAREYIQELRNRTITHAL

Entity 6 Entity 6 polymer

Description description	39S ribosomal protein L23, mitochondrial
Molecular weight formula_weight	17685.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BB

MARNVLYPLYQLGNPQLRVFRTNFFIQLVRPGTAQPEDTVQFRIPMEMTRVDLRNYLERIYNVPVAAVRTRVQYGSNRRRDHRNIRIKKPDYKVAYVQLALGQTFTFPDLFPERKGASVDVDVRDQVLEDQRQKHSPDPRRGGVPGWFGL

Entity 7 Entity 7 polymer

Description description	uL24m
Molecular weight formula_weight	24893.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BC

MRLSALLALASKVTLPPNYRYGMSRPGSLSDKRKNPPGTRRRRVPVEPISDEDWHLFCGDKVEILEGKDAGKQGKVVQVIRQRNWVVVEGLNTHYRYVGKTVDYRGTMIPSEAPLLHNQVKLVDPTDRKPTDVEWRFTEAGERVRVSTRSGRIIPKPEFPRADGIVPETWIDGPKDTSVEDALEKTYVPRLKTLEEEVMEAMGIQETRRHKKVYWY

Entity 8 Entity 8 polymer

Description description	39S ribosomal protein L27, mitochondrial
Molecular weight formula_weight	15943.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BD

MALAVLALRTRAAVTALLSPPQAAALAVRYASKKTGGSSKNLGGKSPGKRFGIKKMEGHYVHAGNILATQRHFRWHPGAHVGLGKNKCLYALEEGVVRYTKEVYVPNPSNSEAVDLVTRLPQGAVLYKTFVHVVPAKPEGTFKLVAML

Entity 9 Entity 9 polymer

Description description	Mitochondrial ribosomal protein L28
Molecular weight formula_weight	30149.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BE

MPLHKVPVGLWKQLRLWEGIYSRLPRHYLRSLEEARTPTPVHYRPHGAKFKINPKNWQRERVEDVPIPVHYPPESQLGLWGGEGWVLGHRYVNNDKLSKRVRKVWKPQLFQRELYSEILDKRFTVTVTMRTLDLIDQACGFDFYILKTPKEDLCSKFGMDLKRGMLLRLARQDPQLHPDDPARRAAIYDRYKAFVIPEAEAEWVGLTLDEAVEKQRLLEEKDPIPLFKIFVEELLGQLQQQALSEPAVVQTRASRK

Entity 10 Entity 10 polymer

Description description	Mitochondrial ribosomal protein L47
Molecular weight formula_weight	29894.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BF

MAAAGLAVFCRRVSAALKACRLLIRPQAPPSTRFSPSLLPKNTPNVTSFHQFRIFHTTFSRRGLEEFFDDPKNWGEEKVKSGASWTCQQLRNKSNEDLHKLWYVLLKERNMLLTLEQEAKRQRLPMPSPERLEKVVDSMDALDKVVQEREDALRLLQTGQEKARPGAWRRDIFGRIIWHKFKQWPIPWYLNKKYNRKRFFAMPYVERFVRMRIEKQARIKARKRSLERKKEKFLQEKFPHLSETQKSSHV

Entity 11 Entity 11 polymer

Description description	Large ribosomal subunit protein uL30m
Molecular weight formula_weight	18921.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BG

HPPRQDFLVRRQPHRNRTVTKGMESLICTDWIRHKFTRSRIPDKVFQPSPEDHEKYGGDPQYPHKLHIVTRIKSTKRRPYWEKDIIKMLGLEKAHTPQVHKNIPSVNAKLKVVKHLIRIKPLKLPQGLPTEEDMANTCLKSNGELVVRWLLNPANQEARKS

Entity 12 Entity 12 polymer

Description description	Mitochondrial ribosomal protein L32
Molecular weight formula_weight	23567.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BH

MLEVGVGPRPDGRGFWASNMASAMLVLVVPPWPAARGLLRNWWEQLQRKLQHNRLGLPLHPWGPALAVQGPAICTEPANDTNGSKAISSLLDSVFWMAAPKNRRSIEVNRCRRRNPQKLIKVKNNIDVCPECGHLKQKHILCGYCYEKVRKETAEIRRQMGKQEGGPFRAPTTETVVLYSGETPSEQDQGKRIIERERKRPSWFTQN

Entity 13 Entity 13 polymer

Description description	Large ribosomal subunit protein bL33m
Molecular weight formula_weight	7508.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BI

MFLSAVTFAKSKSKTILVKMMSQAGTGFSFNTKRSRLREKLTLLHYDPVVKKKVLFVEQKKIRSL

Entity 14 Entity 14 polymer

Description description	Large ribosomal subunit protein bL34m
Molecular weight formula_weight	10871.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BJ

MAFLARSVGRLLDPVSRSAALVGGRWLQPQAWLGFPDTWGLPAMQQTRGKARGNEYQPSNIKRKHKHGWVRRLRTPTGVQVILRRMHKGRKSLSH

Entity 15 Entity 15 polymer

Description description	39S ribosomal protein L35, mitochondrial
Molecular weight formula_weight	21548.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BK

MAASAFAGAVRAATGILRPLHILASSAYQNCAKNACLSSVLSSRHFSHIQTSALLSAPRLITSVRNLMCGPTAPVLNRVAPLLPHVLKPPVRTVTYFSSRKGKRKTVKAVIYRFLRLHSGLWLRRKAGYKKKLWKKTAARKRRLREFVFCNKTQSKLLDKMTTSFWKRRNWYADDPYQKYQDRTNLKV

Entity 16 Entity 16 polymer

Description description	Mitochondrial ribosomal protein L2
Molecular weight formula_weight	33270.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BL

MALRVLTRALSSLSLTPRIAVAPGLNLLPAVQVTNNVLLTLPSGLMSLPCRPILTSVALSATSVSWKSRTKYTVMPVKMRKSGGRNHTGQIQVHGIGGGHKQRYRMIDFLRFRPEHESKPGPFEEKVIAVRYDPCRSADIALVAGGNRKRWIIATENMKAGDTVLNSDHIGRMAVAAREGDAHPLGALPVGTLINNVESEPGRGAQYIRAAGTCGVLLRKVNGTAIIQLPSKRQMQVLETCIATVGRVSNVDHNKRVIGKAGRNRWLGKRPNSGLWQRKGGWAGRKIRPLPPMKSYVKLPSAAAQS

Entity 17 Entity 17 polymer

Description description	ICT1
Molecular weight formula_weight	43708.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BM

MAPAALLPSWGQRGAAAGGGGKAWEGRRRNALKAEWRGAQRCSGRALLGLTMPGWGLLGRAGARVLGCGADGLGASRGLGNRTDICLLVRSLHGKSVTWWDEHLSEENVPFVKQLVSDENKAQLASKLCPLKDEPWPIHPWEPGSSRVGLIALKLGMMPLWTKDGQKHVVTLLQVQDCHVLKYTPKENHNGRMAALTVGGKTVSHFHKSASILEFYQELGLPPKQKVKIFNVTENAVIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMRRWGFKGQPATHGQTKTHRRPGAISTGDVARVWPGTKMPGQLGNIDRTAFGLKVWRINTKHNIIYVNGSVPGHKNCLVKIKDSKLPAYKDFCKNLPFPTYFPDGDEEALPEDLYDENVCQPGAPSITFT

Entity 18 Entity 18 polymer

Description description	Mitochondrial ribosomal protein L4
Molecular weight formula_weight	33251.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BN

MLQLVRAGARTWFRPSGCRGLNTLAEEAVQQAEKPESVASLGLQPPVLRKCELPVPAHRRPVQAWIESLRGYEQERVGLTELHPDVFSTAPRLDILHQVAIWQKNFKRISYAKTKTRAEVRGGGRKPWVQKGSGRARHGSIRSPIWRGGGVAHGPRGPTSYYYMLPMKVRVQGLKVALTVKLAQDDLHIVDSLELPTADPQYLIELARYRRWGDSVLLVDLEHEDMPQNVVAATSGLKTFNLVPAVGLNVHSMLKHQTLVLTLPTVAFLEEKLLWHNSRYTPLYPFRLPYCDFP

Entity 19 Entity 19 polymer

Description description	Mitochondrial ribosomal protein L9
Molecular weight formula_weight	30373.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BO

MAAAACTAAGGGLLRAGLERLLRGGVRALLRPRLEGVTPRSERAFSLSLSRSTVIVERWWKVPLAGEGRKPRLHRRHRVYKLVEDTKHRPKDNLELVLTQSVEELGVRGDLVSVKKSVGRNRLLPQGLAVYASPENKKLFEEEKLLRQEGKLEKLQTKAGEATVKFLRRCHLEVGMKNNVKWELNPEIVARHFLRNLGVVVAPHALKLPEEPITQRGEYWCEVTVNGLDTVRVPMSVVNFERPKTKRYKYWLAQQAAKGDVPTSSQMI

Entity 20 Entity 20 polymer

Description description	Mitochondrial ribosomal protein L10
Molecular weight formula_weight	29238.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BP

MSSQAFRRHPPQGRLPTFQTVRYGSKAVTRHRRVMHFERQKLMAVTEYIPPKPTINPRCLPPPPTPPQEETGLVRLLRREIAAVFRDNRMIAVCQHVALSAEDKLLLRHQLRKHKILMKIFPNQVLKPFLEESKYQNLLPLFVGHNLLLVSEEPKVKEMVRILKGIPFLPLLGGCIDDTILSRQGFINYSKLPSLALVQGELVGGLTFLTAQTYSMLQHQPRQLTALLDQYVKQQQEGHPAVPASGQPEPPDPVPDP

Entity 21 Entity 21 polymer

Description description	Mitochondrial ribosomal protein L11
Molecular weight formula_weight	20809.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BQ

MSKLSRATRALKKPEASGMIRAIVRAGQARPGPPLGPILGQRGVSINQFCKEFNEKTKDIKEGIPLPTKIFVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARHTGKEVAGLVTLKHVYEIARVKAQDDAFALQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAAFQKERALFLAAQREADLAAQAEAAKK

Entity 22 Entity 22 polymer

Description description	39S ribosomal protein L13, mitochondrial
Molecular weight formula_weight	22988.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BR

MRRDTSWILRKGRSCCWGNMSSFSKAPQQWATFARVWYLLDGKMQPPGKLAAMASVKLQGLHKPVYHQLSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHQKDPVAIVKLAIYGMLPKNLHRRTMMQRLHLFPDEDIPEDILKNLVEELPQPRKVPRRLDEYTQEEIEAFPRVWSPPEDYRL

Entity 23 Entity 23 polymer

Description description	Mitochondrial ribosomal protein L14
Molecular weight formula_weight	34796.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BS

MVRGWGQRPAPLGPAGPGTSGSRRRLKGGDAQPSPGFFFGWWWDPQRKERGPGKGRVLTPRRRLGSSSEPRVGAGRGWGRGRGSRWAARAPGSCGGRGCVWGRGSGRREGEEEGRGHEGPTPHASSRKARAHSQIAARPAGSDAQAQDYRPRGGEGGPGPVGPAAGYSRAAKAGLPSRDCMAFCTGLRGPFAQVSRALSQRCFSTTGSLSAIQKMTRVRVVDNSALGTTPYHRPPRCIHVYNKTGVGKVGDRILLAIRGQKKKALIVGHRMPGPRMTPRFDSNNVVLLEDNGNPVGTRIKTPIPSSLRQREGEFSKVLAIAQNFV

Entity 24 Entity 24 polymer

Description description	39S ribosomal protein L15, mitochondrial
Molecular weight formula_weight	33481.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BT

MGGPVQGGGPRALDLLRALPRVSLANLKPNPGSRKPERRPRGRRRGRKCGRGHKGERQRGTRPRLGFEGGQTPFYLRIPKYGFNEGHSFRHQYQPLSLNRLQYLIDLGRVDPTQPIDLTQLVNGRGVTIQPSKRDYGVQLVEEGADTFKAKVNIEVQMASELAIAAIEKNGGVVTTAFYDPRSLEILCKPVPFFLRGQPIPKRMLPPEALVPYYTDAKNRGYLADPARFPEARLELARKYGYVLPDITKDELFKMLSTRKDPRQIFFGLAPGWVVNMADKKILKPTDENLLKYYSS

Entity 25 Entity 25 polymer

Description description	uL16m
Molecular weight formula_weight	28680.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BU

MWRLLARACAPLLRAPLSDSWAAPSATAGFKTLLPVPTFEDVAIPEKPKLRFVERVPLVPKVRRERKNLSDIRGPSTEATEFTEGRFAILALGGGYLHWGHFEMMRLTINRSMDPKNMFALWRVPAPFKPITRKGMGQRMGGGKGAIDHYVTPVKAGRLIVEMGGRCEFKEVQGFLDLVAHKLPFPAKAVSRETLEKMRKDQEERERNNQNPWTFERIATANMLGIRKVLSPYDLTHKGRYWGKFYTPERV

Entity 26 Entity 26 polymer

Description description	bL17m
Molecular weight formula_weight	19268.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BV

MRLSVAAAISHGRVFRRLGLGPESRIHLLQNLLTGLVRHERIEASWARVDELRGYAEKLIDYGKLGDTNERAMRMADFWLTEKDLIPKLFQVLAPRFQGQNGGYTRMLQIPNRNEQDRAKMAVIEYKGNCLPPLPLPRRDSNLTLLNQLLQGLRQDQEASSHTAQTPAV

Entity 27 Entity 27 polymer

Description description	Mitochondrial ribosomal protein L18
Molecular weight formula_weight	21422.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BW

MVLRSSVPLKQVAHARLHFLVPSRKGCRAAALSTSCKPATNPETDPVENEAVAPEFTNRNPRNLELLAVARKERGWGTVWPSREFWHRLRVIRTQHHIEALVEHRNGQVVVSASTREWAIKKHLYSTRNVVACESVGRVLAERCLEAGINFMVYHPTPWEAASDSIKRLQHAMTEGGVVLREPRRIYE

Entity 28 Entity 28 polymer

Description description	39S ribosomal protein L19, mitochondrial
Molecular weight formula_weight	34528.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BX

MGVVVSTQRAGMAASITRGSWAAVGLGQSFPPTRALLPAPASVICRTLAGSGRQQVTGSSEPGAFQPPPKPVIVDKRRPQRPETRFLSPEFIPPRGRTNPLKFQIERKDMLERRKILHIPEFYVGSILRVTTADPYASAKTSQFLGICIQRSGSGLGATFILRNTIEGQGVEICFELYNPRIQEIQVVKLEKRLDNSLLYLRDALPEYSTFDVNMKPITQEFNQEVPVNQLKVKMKPKPWSKRWERPKFNIKGIRFDLCLTEEQMREAQKWSQPWLEFDMMREYDTSKIEAAIWDEIEASKNS

Entity 29 Entity 29 polymer

Description description	Mitochondrial ribosomal protein L20
Molecular weight formula_weight	17554.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BY

MVFLTVPLWLRSRVTDRYWRVQEVLKHARHFRGRKNRCYRLAVRAVTRAFVKCTRARRLKKRSLRTLWINRITAASQEHGLKYPAFIINLIKCQVELNRKVLADLAIYEPKTFKSLAALAKRRREEGFAAALGDGKEPDGIFSRVVQHR

Entity 30 Entity 30 polymer

Description description	Mitochondrial ribosomal protein L21
Molecular weight formula_weight	23154.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BZ

MAAAVAASVLQGTFGRLVSAYSRSVLRTSRPGTAPPWSAPRRLSSQHTSSLRGCVPKTSLGSPPWPDIVLPDPVEETRHHAEVVGQVNELIAAGRYGRLFAVVHFAGHQWKVTAEDLILIENELDVACGERIRLEKVLLVGADNFTLLGKPLLGKELVRVEATVIEKTESWPKINMKFQKRKNYQRKRITVNPQTVLRINSIEIAPCLC

Entity 31 Entity 31 polymer

Description description	39S ribosomal protein L52, mitochondrial
Molecular weight formula_weight	17989.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ba

MAGPVIENQIQDGYFRLPPQRPAWPSRPRPFPALRLSMAAWGILLSSVRRLHCGTAAQAGSQWRLQQGFAANPSGYGPLTELPDWSYADGRPAPPMKGQLRRKAQREKFARRVVLLSQEMDAGLQAWQLRQQEKLQEEEGKQKNALKSKGALLQNPQPSQ

Entity 32 Entity 32 polymer

Description description	Mitochondrial ribosomal protein L53
Molecular weight formula_weight	12057.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bb

MAAALARLGLRAVKQVRVQFCPFEKNVESTRTFLQAVSSEKVRCTNLNCSVIADVRHDGSEPCVDVLFGDGHRLIMRGAHLTAQEMLTAFASHIQARGAAGSGDKPSASTGR

Entity 33 Entity 33 polymer

Description description	mL54
Molecular weight formula_weight	15957.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bc

MAARRLFGAARSWAAWRAWELSDAAVSGRLHVRNYAKRPVIKGGKGGKGAVVGEALKDPEVCTDPFRLTTHAMGVNIYKEGQDVVLKPDSEYPEWLFEMNVGPPKKLEELDPETREYWRLLRKHNIWRHNRLSKNRKF

Entity 34 Entity 34 polymer

Description description	Mitochondrial ribosomal protein L55
Molecular weight formula_weight	15156.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bd

MAAKGSLLRLLWQRVVTGAAPESCRHLYTSSWRADCNRALLTRLHRQTYARLYPVLLVKQDGSTIHIRYREPRRMLTMPVDLDSLSPEERRARFRKREAKFKEKKEEPELSDDFDVEQYKRFWTKK

Entity 35 Entity 35 polymer

Description description	Mitochondrial ribosomal protein L57
Molecular weight formula_weight	12001.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Be

MFLTALLRRNRIPGRQWIGKHRRPRPVSAQAKQNMIRRLETEAENQYWLSRPFLTAEQERGHAAVRRAAAFQALKAAQAARFPAHRRLEEQLGHLLVTRKWS

Entity 36 Entity 36 polymer

Description description	mL62 (ICT1)
Molecular weight formula_weight	23545.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bf

MAAARCLRWGLNRAGAWLLPSPTRYPRRALHKQVEGTEFQSIYSLDKLYPESRGSDTAWRLPDDAKQANDIPVDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLASADWIAEPVRLKLAVKHKNRINRSGELILTSECSRYQFRNLADCLQKLRDMIAEASQPAKEPSREDAELRRSRIENMNRERLRKKRISSAIKTSRRVDVD

Entity 37 Entity 37 polymer

Description description	mL64
Molecular weight formula_weight	25815.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bg

MAAPVQQARTLLRLVTTLGQGSRGYRARPPPRRSQEPRWPDPDDPLTPRWQLSPRYAAKQFARHGAASGVAAGSLWPSQEQLRELEAEEREWYPSLAAMQESLRVQQLAEEQKRQAREQLIEECMAKMPQMIENWRQQQQERREKEQADKDRRARLQAEAQERLGYHVDPRSARFQELLQDMEKQHRKRLKEEKQRKKKEARAAAMAAAAAQDPADSETPSS

Entity 38 Entity 38 polymer

Description description	Mitochondrial ribosomal protein S18A
Molecular weight formula_weight	22273.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bh

MVGLNVLVSGCGRLLRGLLAGPAATSWARPPSRGFREVVEILDGKTTIIEGRITETPQESPNPPNPTGQCPICRWNLKHKYNYEDVLLLSQFIRPHGGMLPRRITGLCQEEHLKIEECVKMAHRAGLLPNHRPKLPEGFVPKSKPRLNRYLTRWSPRSVKPIYNKGHRWNKVRMPVGSPLLKDNVSYSGRPLLLYH

Entity 39 Entity 39 polymer

Description description	39S ribosomal protein S30, mitochondrial
Molecular weight formula_weight	49100.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bi

MAAARCWRFPLRGAGLSLHTAAKAAVTAPEVTGPDVPATPVARYPPIVASLTAKSKAARQRRVEQWQATVHAAKSVDEKLRILTKMQFMKYVVYPQTFALNADNWYQSFTKTVFLSGLPPTPAKLEPEPTLDITALREAVCDCLLQEHFFLRRKKRAPVIQDREAIASPFLDQLVASLTGLLSVHNPVLAAAALDCKRPVHFFWLRGEEIIPRGHRKGRVDALRYQINDKPHNQIRISRQLPEFVPLDYSIPIEVPVMSCKPDKLPLFKRQYENTIFIGSKTADPLCYGHTQFHLLPDKLKREKLLKQNCADQIEVVFRANAIASLFAWTGAQAMYQGFWSEADVTRPFVSQGVITDGKYFSFFCYQLNTLALTAQADQNNPRKNICWGTQSKPLYETIEDNNVKGFNDDVLLQLVQFLLNRPKEDKSQLLEN

Entity 40 Entity 40 polymer

Description description	39S ribosomal protein L1, mitochondrial
Molecular weight formula_weight	34372.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bj

MVSQMPLYPRSVYIQLPNRHFAAAATKPAKKTQKGAKGKASDEKKDDIEKIKSYPFMEGEPEDDVYLKRLYPRQIYEVEKAIHLLKKFQVLDFTNPNQGVYLDLTLDMTLGKKKKVEPFASVLSLPYPFTSEINKVAVFTGNASEIKIAEEKGAAFAGGTNLIQKILDDEIQPDFYVAVPEIMPELNPLRKKLKKRFPKLTRNSIGRDIPKMLELFKTGHEIKVDEERENFLETKIATLNMSSDQIAANLQAVINEVCRQRPLNLGPFVVRAFLRSSTSEGLLIKIEPLLPKEVEAKESGTLTA

Entity 41 Entity 41 polymer

Description description	Ribosomal protein
Molecular weight formula_weight	10841.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bl

MATAFLRTVLSAVGPLLHLGGRPLSTFAAGPPRAALAVGAQPSPAAALLSARPLLGPQPALGFKTKGVLKKRCRDCYLVKRRGRWFIYCKTNPKHKQRQM

Entity 42 Entity 42 polymer

Description description	Mitochondrial ribosomal protein L37
Molecular weight formula_weight	47918.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bm

MALASGPARRALARLGRLGLGGCGAPRRGAYEWGVRSTRKPEPPPLDRVYEIPGLEPITYAGKMHFMPGLARPVFPPWDPGWTHPKFRRLPPLHEHPLYKDQACYVFHQRCRLLEGVKQALWLTKTQLIEGLPEKVLRLADDPRNHIENQDERVLNAISHARLWHSTEDIPKRETYCPVIVDSLIQLCKSQILKHPSLARRICAQNNTLSATWNRESILLQVHGSSGARLNAKDPLPPVASQEEVEATKNHVLETFYPISPTMGLQECNVYDVNDDTGFQEGYPYPCPHTLYFLESANLRPRRFQPDQLRAKMILFAFGSALAQARLLYGNDSKVLEQPVVVQSVGTDGRLFQFLVLQLNTTDLASDEGVKNLAWVDSDQLLYQHFWCLPVIKKKVVVEPVGPIGFQPETFRKFLALYLHGAV

Entity 43 Entity 43 polymer

Description description	Mitochondrial ribosomal protein L38
Molecular weight formula_weight	44656.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bn

MAAPWWRAALCASRRWRGFSTSAALSRRAAPLGPMPNEDIDVSDLERLKKYRSFDRYRRRAEQEARKPHWWRTYREHFGEESGPKDRVDIGLPPPKVSRTQQLLERKQALRELRANVEEERAARLQTARIPLEAVRAEWERTCGPYHKQRLAEYCGLYRDLFHGATFVPRVPLHVAYAVGEDDLMPVYHGNEVTPTEAAQAPEVTYEADEGSLWTLLLTNLDGHLLEPDAEYVHWLVTNIPGNRVTEGQETCPYLPPFPARGSGFHRFAFLLFKQDKRIDFSGDTRPSPCYQLAQRTFHTFDFYKKHQDAMTPAGLAFFQCRWDDSVTRVFHQLLDMREPVFEFVRPPPYHPKQKRFPHRQPLRYLDRYRDSHEPTYGIY

Entity 44 Entity 44 polymer

Description description	Mitochondrial ribosomal protein L39
Molecular weight formula_weight	38523.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bo

MAMGAWGLRLWRAVPRGEAGWRLIATSPASQLSPTELIEMQNDLFNKEKNRQLSLTPRTEKIEVKHVGKTDPGTVFVMNKNISTPYSCAMHLSEWYCRKSILALVDGQPWDMYKPLTKSCEIKFLTFKDDDPGEVNKAYWRSCAMMMGCVIERAFKDEYVVSLVRAPEVPVIAGAFCYDVVLDKRLDEWMPTKENLHSFTKDARALIYKDLPFETLEVEAKVALEIFQHNKYKLDFIEEKASQNPERIVKLHRFGDFIDVSEGPLIPRTSICFQYEVSAVHNLQTQSSLVRRFQGLSLPVHLRAHFTIWNKLLERSRKMVTEDKTKPTEESAST

Entity 45 Entity 45 polymer

Description description	Mitochondrial ribosomal protein L40
Molecular weight formula_weight	19406.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bp

MRAEPLRKKKKVDPKKDQAAKDRLKKRIRRLEKASQELIPIEDFITPVKFLNKERQRPPVELPFEESERRALLLKRWSLYKQREHEMERSAIRSLLEAQEEALQELRLSSPELHAEATKRDPSLFPFERQGPDYTPPISDYQPPEGRYQDITKVYTQVEFKK

Entity 46 Entity 46 polymer

Description description	39S ribosomal protein L41, mitochondrial
Molecular weight formula_weight	15073.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bq

MGLLSGAARALVRGADRMSKWTSKRGPRTFCKGRGAKGTGFHGRDGKFVQIKEMIPELVVPELAGFKLKPYVNYRAPEGTDTPLTAKQLFLETAAPAIEKDFKAGTFDPEHLEKYGFEPTQEGKLFQLYPKNFPR

Entity 47 Entity 47 polymer

Description description	mL42
Molecular weight formula_weight	16680.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Br

MALAAVKWVISSRTILKHLFPIQNSASYCVCHKSTYSSLPDDYNCKVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNIEETHDLVLKTRLEEKGEHLEQGPMIEQLSKMFFTTKHRWYPRGQYHRRRRKPNPPKDR

Entity 48 Entity 48 polymer

Description description	Large ribosomal subunit protein mL43
Molecular weight formula_weight	17623.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bs

XTARGTASRFLTSVLHNGLGRYVQQLQRLSFSLSRDAPSSRGAREFVEREVTDFARRNPGVVIYVNPRPCCVPRVVAEYLNGAVREESIHCKSVEEIAALVQKLADQSGLDVIRIRKPFHTDSPSIQGQWHPFTNKPTTLGGLRPREVQDPAPAQVQAQ

Entity 49 Entity 49 polymer

Description description	mL44
Molecular weight formula_weight	37527.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bt

MASGLVRLLQWGPRRLLAPAAPTLAPPVRGAKKGFRAAYRFQKELERWRLLRCPPPPVRRSEKPNWDYHAEIQAFGHRLQETFSLDLLKTAFVNSCYIKSEEAKRQKLGIDKEAALLNLKDNQELSEQGISFSQTCLTQFFEDAFPDLPTEGVTSLVDFLTSEEVVCHVARNLAVEQLALSAEFPVPPPVLRQTFFAVIGALLQSSGPERTALFIRDFLITQMTGKELFEMWTITNPMGLLVEELKKRKISAPESRLTRQSGSTTALPVYFVGLYCDRKLIAEGPGETVLVAEEEAARVALRKLFGFTENRRPWDYSKPKEHVRAEKTITAS

Entity 50 Entity 50 polymer

Description description	Mitochondrial ribosomal protein L45
Molecular weight formula_weight	35331.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bu

MAAPVTRGLSCLPRVLGWWSRQPVLVTQSTAVVPVRTKKRFTPPTYQPKYKSEKEFVEHARKAGLVIPHERLERPIHLACTAGIFDAYVPPEGDARISSLSKEGLAQRAERLKKNVASQLSIRKIRESDPNFKIKDFPEKAKDIFIEAHLCLNNSDHDRLHTLVTENCFPDMVWDIRYKTVRWSFVESLEPPQVVQVRCSSLMNQGNIYGQVTVRMHTRQTLAIYDRFGRLMYGQEDVPRDVLEYVVFEKHLVDPYGSWRMHGKIIPPWAPPKQPILKTVMIPGPQLKPWEEFEEPQGEVHKPQPA

Entity 51 Entity 51 polymer

Description description	Mitochondrial ribosomal protein L46
Molecular weight formula_weight	32216.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bv

MAAPVRRTMLRVVRGWRRFEGPWAHSLGSRNLALAVAPSSSSSPWRLLGALCLQRPPLVTKPLTPLQEEMADLLQQIEIERSLYSDHELRALDEAQQLAKKKSDLYEEEDEQNILLAQDLEDMWEQKFLHFKLGARLTEADKKDDRTSLHRKLDRNLILLVREKLGDQDIWMLPQSDWQPGETLRQTAERTLATLSENNMEAKFLGNAPCGHYKFKFPQAMRTETSLGAKVFFFKALLLTGDFSQAGKKGHHVWVSKEELGDYLKPKYLAQVRRFLLDL

Entity 52 Entity 52 polymer

Description description	39S ribosomal protein L48, mitochondrial
Molecular weight formula_weight	29942.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bw

MSEAAGTKVLRELNASRSDIVTGPDQGRSVSIFRPPGIAAAWADLQLARLHTTRQQRMNGALGKALCLRNDTVLKQALSLIRVRASGESPICSAGGILLSTSRHYRSKPTHGIGRYKHLVKAQEPKKKKGKVEVRPINLGTDYEYGVLNIHLIAYDMALAESYAQYVHNLCNHLAIKVEESYAMPTKTMEVLQLQEQGSKMFLDAVLTTHERVVQISGLSATFAEIFLEIIHSNLPEGVKLSVREHTEEDFKGRFKARPELEELLAKLN

Entity 53 Entity 53 polymer

Description description	Mrpl34
Molecular weight formula_weight	18957.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bx

MAATVLCGVLRAWRTGVPLGCGLRRLSQTQGTPEYPSFVESVDEYHFVERLLPPASIPRPPKHEHYPTPSGWQPPRDPAPSLPYFVRRSRMHNIPVYRDITHGNRQMTVIRKVEGDIWALQKDVEDFLSPLLGKTPVTQVNEVTGTLRVKGYFDQQLKAWLLEKGF

Entity 54 Entity 54 polymer

Description description	Mitochondrial ribosomal protein L50
Molecular weight formula_weight	22785.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	By

MVRLRGKRECLTLSLRLIGWSWRVTAGGGRCFVSKFSSKMAARWVSGLARRSLTCAVSGAPRREFWSPFRKEKQPVVAETVEEVKKEPILVCPPIQSRTYIPPEDLQSRLESHVKEVFGSSVPSNWQDISLEDVHLKFSFLARLANDLRHAVPNSRLHQMCRVRDVLDFYNVPVQDRSKFDELIASNLPHNLKITWGY

Entity 55 Entity 55 polymer

Description description	Large ribosomal subunit protein mL51
Molecular weight formula_weight	15249.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bz

MAGSLSWVTGRGLWGRLPLTCRSFSLGIPRLFHVRVTLPPRKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIKGPIWLRGWKGNELQRCIRKKRMVGNRMFIDDLHNLNKRISYLYKHFNRHGKYR

Entity 56 Entity 56 polymer

Description description	12S rRNA
Molecular weight formula_weight	308452.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	AA

ACAGGUUUGGUCCUGGCCUUUCUAUUAAUUCUUAAUAAAAUUACACAUGCAAGUAUCCGCGCCCCGGUGAGAAUGCCCUCCAGAUCUUAAAGAUCAAAAGGAGCAGGUAUCAAGCACACCUAUAACGGUAGCUCAUAACGCCUUGCUCAACCACACCCCCACGGGAAACAGCAGUGAUAAAAAUUAAGCCAUGAACGAAAGUUUGACUAAGUUAUAUUAAUUAGAGUUGGUAAAUCUCGUGCCAGCCACCGCGGUCAUACGAUUAACCCAAAUUAAUAGAUCCACGGCGUAAAGAGUGUUUAAGAAAAAAAAUCACAAUAGAGUUAAAUUAUAACUAAGCUGUAAAAAGCCCUAGUUAAAAUAAAAUAACCCACGAAAGUGACUCUAAUAAUCCUGACACACGAUAGCUAGGACCCAAACUGGGAUUAGAUACCCCACUAUGCCUAGCCCUAAACCCAAAUAGUUACAUAACAAAACUAUUCGCCAGAGUACUACUCGCAACUGCCUAAAACUCAAAGGACUUGGCGGUGCUUCACAUCCACCUAGAGGAGCCUGUUCUAUAAUCGAUAAACCCCGAUAGACCUUACCAACCCUUGCCAAUUCAGCCUAUAUACCGCCAUCUUCAGCAAACCCUAAAAAGGAACAAUAGUAAGCACAAUCAUAGCACAUAAAAACGUUAGGUCAAGGUGUAGCUUAUGGGUUGGAAAGAAAUGGGCUACAUUUUCUACAUAAGAAUAUCCACCACACGAAAGUUUUUAUGAAACUAAAAACCAAAGGAGGAUUUAGCAGUAAAUCAAGAAUAGAGUGCUUGAUUGAAUAAGGCCAUGAAGCACGCACACACCGCCCGUCACCCUCCUCAAGCAUGUAGUAAUAAAAAUAACCUAUAUUCAAUUACACAACCAUGCAAGAAGAGACAAGUCGUAACAAGGUAAGCAUACUGGAAAGUGUGCUUGGAUUACC

Entity 57 Entity 57 polymer

Description description	28S ribosomal protein S35, mitochondrial isoform 1
Molecular weight formula_weight	41357.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AB

MITVSCSRGGRARHVSLRSRASGPPVDSLRACPLPLAVCADMAATSLPAWLILKSRAGTFRAFSTAMSPATRSPRPALRTTERTSKPERALRRKALPPRTEKMAVDQDWPSVYPVAAPFKPSAVPLPVRMGYPVKRGVPMAKEGNLELLKIPNFLHLTPVAIKRHCEALKDFCTEWPAALDSDEKCEKHFPIEIDTADYVSAGPSIRNPKARVVTLRVKLSSLNLDDHAKKKLIKLVGDRYCKSTDVLTIKTDRCPLKRQNYDYAVYLLTVLYHESWKTEEWEKKKTEADMEEYIWENSTSEKNILETLLQIKAAEKNLELSKEELLGTKEVEDYRKSVVSLKNEGDNENTLSQYKESVKRLLNLA

Entity 58 Entity 58 polymer

Description description	Mitochondrial ribosomal protein S24
Molecular weight formula_weight	18935.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AC

MVASVCGGGLRPLVLSWSRELPCAWRALHISAVCAKNRAARVRVSKGDKPVTYEEAHAPHYIAHRKGWLSLHTGNLDGEDHAAERTVEDVFLRKFMLGTFPGCLADQLVLKRRANQLEICALVLRQLPPHKFYFLVGYSETLLSHFYKCPVHLHLQTVPSKVVYKYI

Entity 59 Entity 59 polymer

Description description	Small ribosomal subunit protein mS38
Molecular weight formula_weight	22843.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AD

MFLVRLTSQLLRAVPGAGRSGSPRVSEVLGRHACRPRYSTQPPGPSGIASLPGKHVHPELEEMLVPRKMSISPLESWLTIRYLLPRLGAGTPGTVSPAQLYQCPPSQVGEGVKQGDKEVRDTPQMQCKNILKIRRRKMNHHKYRKLVKRTRFLRRKVREGRLRQKQVKFERDLKRIWQKAGLKEAPAGWQTPKIYLKNQ

Entity 60 Entity 60 polymer

Description description	Mitoribosomal protein bs6m, mrps6
Molecular weight formula_weight	14283.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AE

MPRYELALILKAMQRPETAAALKRTLEALMDRGAVVRNLENLGERMLPYKISAHNQRHSRGGYFLVDFYAPATTVESMMEHLSRDIDVIRPNIVKHPLTQEVKECEGIVPVPLEEKLYSTKKRK

Entity 61 Entity 61 polymer

Description description	Mitochondrial ribosomal protein S7
Molecular weight formula_weight	28150.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AF

MAAPAVKAARGWSCSALGVRIAVLRFPGLTQVRWSRYGPEYKDPQIDKEYYRKPLAEQTEEEKYERDFKKTQLIKAAPATKTSSVFEDPVISKFTNMMMKGGNKVLARSLMTQTLEAVKRKQFAKYHAASAEEQATIERNPYTIFHQALKNCEPVIGLVPILKGGHFYQVPVPLADRRRRFLAMKWMIAECREKKHRRVLMPEKLSQELLEAFHNQGPVIKRKHDMHKMAEANRALAHYRWW

Entity 62 Entity 62 polymer

Description description	P-site Met-tRNA(fMet)
Molecular weight formula_weight	22664.5 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	AG

AGUAAGGUCAGCUAAAUAAGCUAUCGGGCCCAUACCCCGAAAAUGUUGGUUAUACCCUUCCCGUACUACCA

Entity 63 Entity 63 polymer

Description description	Mitochondrial ribosomal protein S10
Molecular weight formula_weight	23105.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AH

MAARTAFGALARRLWQGSRNFSVSSSRSSTAKNGGFLLTTMKWVQFSNLHVDVPKDMTKPEITISDEPDTLYKRLSVLVKGHDKAVLDSYEYFAVLAAKELGISIKVHEPPRKIERFTLLKSVHIFKKHRVQYEMRTLYRCLELEHLTGSTADVYLEYIQRNLPEGVAMEVTKTKLEQLPEHIRKPIWETMPEEKEESKS

Entity 64 Entity 64 polymer

Description description	mRNA
Molecular weight formula_weight	2902.8 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	AI

AAUGAGACA

Entity 65 Entity 65 polymer

Description description	Mitochondrial ribosomal protein S12
Molecular weight formula_weight	15257.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AJ

MSWSGLLRGLGTSLNCGLALVPRPWATRPMATLNQMHRLGPPKHPPGKMGPTAGRPQLKGVVLRTFIRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHSLQEHHVVLVQGGRTQDLPGVKLTVVRGKYDCGHVQKKK

Entity 66 Entity 66 polymer

Description description	Mitochondrial ribosomal protein S14
Molecular weight formula_weight	15120.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AK

MAASMLGFLLRTVRQMVPSSASGQVRSYYVDWKMLRDVKRRKMAYEYADERLRINSLRKNTILPKDLQEVADEEIASLPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGVQRAMW

Entity 67 Entity 67 polymer

Description description	28S ribosomal protein S15, mitochondrial
Molecular weight formula_weight	29596.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AL

MLRAAWRALSSIRTQAVTQAPVLGLPGGGCARFPSVQRALPSRPAGLILRAARGYAAQKPGEEQGLTGEDRLISHCLCLNIQPNQDDPPPSMLLLDYQNVPGIHKVDDVVKRLLSLEMANQKEKLKIKKMQLMNKVLENPEDTSSLEARIVALTVKIRNYEEHMQKHRKDKAHKRFLLMSIDQRKKMLKNLRETNYAVFEKICKELGIEYTFPPPYHRKAHRRWVTKKALCTQVFREVQKLKKQKRALRAAAVAAHKQG

Entity 68 Entity 68 polymer

Description description	28S ribosomal protein S16, mitochondrial
Molecular weight formula_weight	15182.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AM

MVQLTTVLCRAYRGGHLTIRLALGGCTNRPFYRIVAAHSKCPRDGRFVEQLGSYDPLPNSHGEKLVALNFDRIRHWIGCGAHLSKPVEKLLGLSGFYPLHPMMITNAERLRRKRAREVLLASQKTDTEATETKAS

Entity 69 Entity 69 polymer

Description description	28S ribosomal protein S17, mitochondrial
Molecular weight formula_weight	14452.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AN

MSIARSSVHAKWVVGKVIGTAMQKTAKVRVTRLVLDPYLLKYFNKRKTYFAHDALQQCTVGDIVLLKALPVPRTKHVKHELAEIIFKVGQVIDPVTGKPCAGTTYLESPISPESTRLTKNLEALQLSSTQ

Entity 70 Entity 70 polymer

Description description	28S ribosomal protein S18b, mitochondrial
Molecular weight formula_weight	29220.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AO

MAASILNVLLRRLPGVSPFRGAYGVQVLLQTLCTKAPPEDDSLPQVPISPYKDEPWKYLDSEEYQNRYGSRPVWADYRRNHKGGIPPQRTRKMCIRGNKVAGNPCPICRDQKLHVDFRNVKLLEQFVCAHTGIIFHAPYTGVCMKQHKKLTQAIQKARDHGLLRYHIPQVEPRDLDFSTTHGAVSSTPPAPTLVSGDPWYPWYSWKQPPERELSRLRRLYQGRLREESGPPPELMPEVPLTAPAEASSTEPGAPQSAL

Entity 71 Entity 71 polymer

Description description	Mitochondrial ribosomal protein S18C
Molecular weight formula_weight	16211.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AP

MAAVVSLCSRLGRRKSTDFVNAAVCLTDPGTHAVLWRSCSQYKQVASNEDLPVPMENPYKEPLKKCILCEKHVDYKNVQLLSQFISPFTGCIYGRHITGLCGKKQKEITKAIKRAQILGFMPVTYKDPAYLKDPKVCNIKYRE

Entity 72 Entity 72 polymer

Description description	28S ribosomal protein S21, mitochondrial
Molecular weight formula_weight	10724.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AQ

MANHLKFIARTVMVQEGNVEGAYRTLNRILTMDGLIEDIKRRRYYEKPCRRRQRESYETCRRIYNMEMARKINFLMRKNRADPWQGC

Entity 73 Entity 73 polymer

Description description	Mitochondrial ribosomal protein S22
Molecular weight formula_weight	43234.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AR

MPHEPRETRNLSLPLPALVARIIMATLKASALLRSLQTNSCGTGRVCFPVRARPRPRALLQPLPGASGTGTLCRGLGSESESGNSEIRKPTFMDEEVQNILIKMTGLDLQKIFKPALQELKPPTYKLMTQAQLEEATKQAVEAAKVRLKMPPVLEERAPINDVLAEDKILEGTETAKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQVYFPREGRRILTPVIFKEENLQTMYSQDQHVDVLNLCVAQFEPDSAEYIKIHHHTYEDIDKCGKYDLLRSTRHFGGMAWYFVNKKKIDGLLIDQIQRDLVSDATSLVHLYHILHPDGQSAQEAKKQGAEGLHLIKVFAKTEAQKGAYIELTLQAYQEAFITHSAAS

Entity 74 Entity 74 polymer

Description description	mS23
Molecular weight formula_weight	21666.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AS

MAGSRLETVGSIFSRTRDLIRAGVLKEKPLWLDIYNAFPPLREPVFRRPRLRYGKAKAAVQDIFYHEDRIRAKFYSAYGSGPKAFDLFNPNFKSTCQRFVEKYIELQRLGETDEEKLFVEAGKALLAEGVTLRRVGEARTQQEGSPISRKSEPTGIKPQTAVEENQPWKEVPQDQPLEAPEKESKGLPPP

Entity 75 Entity 75 polymer

Description description	Mitochondrial ribosomal protein S25
Molecular weight formula_weight	19954.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AT

MPMKGRFPIRRTLQYLGQGDVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQITMFKNMTPSPFLRFYLDSGEQVLVDVESKSNKEIVEHIRKILGKNEETLEKEEQEKKQLSHPAHFGPRKYCLRECMCEVEGQVPCPGLVPLPKEMTGKYKAALKATAQD

Entity 76 Entity 76 polymer

Description description	Mitochondrial ribosomal protein S26
Molecular weight formula_weight	23637.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AU

MLRVLGGLGARPAGRLPAPLLLPTRGRKTRHDPPAKSKAGRVATPPAVDPTEFFVLTERYRQYRQTVRALRLEFMSEVRKKLHEARAGVQAERKAQEDAAEHRELMAWNQAENQRLHELRLARLRQEALEQERRQAEEAVLQAREAQAWAQLKEQEVLQLQEEAKTFITRENLEARVEEALDSPKSYNWAITREGLVVRPQQKGS

Entity 77 Entity 77 polymer

Description description	Mitochondrial ribosomal protein S27
Molecular weight formula_weight	45761.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AV

VVKSCRRCLLSAAYVDSHKWEARDKEDCHLADLASLMDKTYERKLPVSSLTISRFVDNIASREDIDHAEYYLYKFRHSPNCWYLRDWTIHTWIRQCLKYGAQDKALYTLKNKVQYGIFPDNYTFNLLMDYFIKKENYKDALSVVFEIMMQEAFEVPSTQLLSLYVLYHCLAEKTDLSWEEERNFGASLLLPGLKQKNSVGLSSQLYGYALLGKVELQQGLRAVYCNMPLLWQPGYLHRALQVMEKVASSPEDGQLCGEALDVLDRVLKAVTAPAQGTSEEQPQEGEESQRSEELVEQLDVEETEQSKLPQYLERFEALRSKLQALGKVESESLLTLSTQLAKAQLPTCEAEDIAVYEQRLQQWHGERVRLIQREQEQRERARQDYEARRAAKASA

Entity 78 Entity 78 polymer

Description description	Mitoribosomal protein ms28, mrps28
Molecular weight formula_weight	21014.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AW

MAALCRTRAVTAKSHFLRVFFFSRPCRGTGTESGSGSESSESTEPKQRPGGFASALERHSELQQKAEFGRMRGSPKNVESFASMLRHSPLTQMGPAKNKLVIGQIFHIVEDDLYIDFGGKFHCVCKRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTILEADAVLLGLQESKDSKSKEERHEK

Entity 79 Entity 79 polymer

Description description	Small ribosomal subunit protein mS29
Molecular weight formula_weight	46966.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AX

MAQLLANLTSIQVMLKGVTRLISRVHKLDPGHVLYMGTQAPQSLAAHLDNQVPVKSPRAISRTSEDDPAKHREQHEGQHYNISLQELKTVFPHGLPPRFAMQVKTFNEACLMVRKPALELLHYLKNTNFAHPAVRYVLYGEKGTGKTLSLCHILHFCAKQNWLILHIPDAHIWVKNCRDLLQSNYNKQRFDQPLEASTWLKNFKTANEHFLSQIKVQEKYVWNKRESTEKGRPLGEVVEQGIMRVRNATDAVGIVLKELKRQSSLGIFHLLVAVDGVNALWGRTTLKREDKSPIAPEELALIHNLRKMVKNDWQGGAIVLTVSQTGSLFKPRNAYLPQELLGKEGFDALDPFIPILVSNYNPKEFESCIQYYLENNWLQHEKAHTEEGKKELLFLSNRNPGQLERLCAYL

Entity 80 Entity 80 polymer

Description description	28S ribosomal protein S31, mitochondrial
Molecular weight formula_weight	43516.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AY

MLPRVSAVIPLRPLSRLPLCSGGPEASAAAILLLDSLRGTVRTENNIQRYFGTNNLVYSKKDEQSGPTCEISKETESKGSVKENSKKDLLNIIKGMKVELSTVNVQTTKPSNKRQLKNLETAIGRIKKAPEDTPQKRSESLSSELVAAVSAVADSLPFDRRMTKSELLRQLQKHEEDSRDKKKKLIFSNIISDMKVARSATARVSTRPVHQIQFDEGTDDFADQEKTLNLKKRKNIFKGRRLNIFEPQAVTEEAPETEAVPSLWDIEFAKQLAAVTERPFQNGFEEMIQWTKEGKLWEFPINNEAGFDDDGSEFHEHIFLDKYLQDFPKQGPIRHFMELVTCGLSKNPYLSVKQKVEHIEWFRNYFNEKRVILKESGIQLN

Entity 81 Entity 81 polymer

Description description	Mitochondrial ribosomal protein S33
Molecular weight formula_weight	16971.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AZ

MRDGFRAPAEVSSLVESPRIGRINFINQLGGLTGTLAPAAQEMSSLSEYAVRMSRLSARLFGEVARPTDSKSMKVVKLFSEQPLAKRKETYDWYPNHNTYFALMGTLRFLGLYRDEHQDFRDEQLRLKKLRGKGKPRKGEGKRAMKKK

Entity 82 Entity 82 polymer

Description description	Peptide chain release factor 1, mitochondrial
Molecular weight formula_weight	55569.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Aa

MNRHLCVWLFRHPSLNGYLQCHIQLHSHQFRQIHLDTRLQVFRQNRNCILHLLSKNWSRRYCHQDTKMLWKHKALQKYMENLSKEYQTLEQCLQHIPVNEENRRSLNRRHAELAPLAAIYQEIQETEQAIEELESMCKSLNKQDEKQLQELALEERQTIDQKINMLYNELFQSLVPKEKYDKNDVILEVTAGRTTGGDICQQFTREIFDMYQNYSCYKHWQFELLNYTPADYGGLHHAAARISGDGVYKHLKYEGGIHRVQRIPEVGLSSRMQRIHTGTMSVIVLPQPDEVDVKLDPKDLRIDTFRAKGAGGQHVNKTDSAVRLVHIPTGLVVECQQERSQIKNKEIAFRVLRARLYQQIIEKDKRQQQSARKLQVGTRAQSERIRTYNFTQDRVSDHRIAYEVRDIKEFLCGGKGLDQLIQRLLQSADEEAIAELLDEHLKSAKGGSGGSGDYKDHDGDYKDHDIDYKDDDDK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 83 Entity 83 polymer

Description description	Mitochondrial ribosomal protein S2
Molecular weight formula_weight	31731.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ab

MASGPLLPRLLGAGAPRRPLRLHLVPTATPGPAGPTGRTLGSNAAPAAREPELGNDLRDRILSEPLKHADFFNLKELFSVRSLFDARVHLGHKAGCRHRFMEPYLFGSRLGQDIIDLEQTAAHLQLALNFTAHVAYREGIILFVSRHRQFAHLIETTARDCGEYAHTRYFKGGLLTNAPLLLGPGVRLPDLIIFLHTLNNVFEPHVAVRDAAKMNIPTVGIVDTNCNPALITYPVPGNDDSPPAVRLFCRLFQVAISRAKEKRRQVEALYRLQGPAGAERGPAAPPPPE

Entity 84 Entity 84 polymer

Description description	Coiled-coil-helix-coiled-coil-helix domain containing 1
Molecular weight formula_weight	13603.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ac

MATPSLRGRLARLGNPRRPILKPNKPLILANHVGERRREKGEATCITEMSVMMACWKQNEFRDEACRKEIQDFFDCASRAEAARKMRSIQENLGELGSLPPKKLNKLLHRFPNKPHVS

Entity 85 Entity 85 polymer

Description description	28S ribosomal protein S5, mitochondrial isoform X2
Molecular weight formula_weight	48213.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ad

MAAAVRAAGFFPGLFGASAGNLWSRQLYLNTFPAASILTSKTFPSNGPLSPPGTRDNHHFTSLACALQTQCSISSPSNWMGQQYRSYSFFTKLTADELWKGALAESGAGARKGRGKRTKKKRRKDLNRGQIIGEGRHGFLWPGLNIPLMRNGAVQTIAQRSKEDQEKVEADMVQQREEWDRRRKMKVKRERGWSGNTWGGVSLGPPDPGPNGETYDDFDTRILEVRNVFNMTAKEGRKRSVRVLVAVGNGKGAAGFAIGKATERADAFRKAKNRAVHYLHYIERYEDHTIYHDISLKFKRTHIKMKKQPRGYGLHCHRAIMTICRLIGIKDLYAKVSGSVNMLNLTRGLFLGLSRQETHQQLADKKSLHVVEFREECGPLPIVVASPQGALRKDPEPEDEVPDITLDWEDVKAAQGMKRSVWSGLKRAAT

Entity 86 Entity 86 polymer

Description description	mS39
Molecular weight formula_weight	78518.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ae

MAAVASARWLGVRSGLCLPLTGRRVGPCGRTPRSRFYSGSAAHPEVEGANVTGIEEVVIPKKKTWDKVAILQALASTVHRDSTAAPYVFQDDPYLIPTSSVESHSFLLAKKSGENAAKFIINSYPKYFQKDIAEPHIPCLMPEYFEPQIEDVSEAALQERIKLRKVKASVDMFDQLLQAGTTVSLETTNSLLDLLCYYGNQEPSANYNFQQREQSEELEEATEADNEKSKTKAGHHLGVTWRTKNNAERIFALMPEKNAHSYCTMIRGMVKHQAPTQALNLYTVLLNNRLRADVYTFNSLIEATALVVNEKFEEKWNNILDLLKQMVTQNVKPNLQTFNTILKCLRRFYAFGKLPALQTLREMKAIGIEPSLATYHYVIQLFYQHESPSKGSSLIIYDIMNEVMGKRFSPRDPDDDMFFQSAMRVCSSLRDLELAYQVHGLLNTGDNWKLIGSDHRRNFYYSKFFNLLCFMEQIDVTLKWYKDLIPSVFFPHSQTMIDLLQALDVANRLDMVPQIWKDSKEYGHTFRNELKEEILMLMARDQHPPELQVAFADCAADIKSTYESQDARQTAPEWPASSLNYVAVLFLRAGRTQEAWKMLGLFRKHNKIPRAELLNEFLDSAKASSSPAQAIELVKLASAFSLPVCEGLTRRVMAEFTLTQEQREALGELTALTSDSSSDSDSDSDSDISEGK

Entity 87 Entity 87 polymer

Description description	uS9m
Molecular weight formula_weight	45604.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ag

MAAPCVFCGAAVSYRLFLGCRVSFARGQVLWKAAAPELQAGARCQILRLRHTAVVTTKKNVAASRRETYTVDFIKKQIEEFNIGKRHLANMMGEDPETFTQEDIDRAIAYLFPSGLFEKRARPIMKHPEEIFPKQRAIQWGEDGRPFHFLFYTGKQSYYSLMHDTYGKLLDVEKHHNQLRAKDLLAEKTKILKDPIGSRWLIKEELEEMLVEKLSDQDYAQFIRLLERLSALPCGATEEDFVNRFRRSIPIQSKKQLIEPLQYDEQGMAFSRGEGKRKTAKAEVVVYGQGSGRIDVNGVDYLLYFPVTQDREQLMFPLHFLDRLGKHDMTCAVSGGGRSAQAGAVRLAMARALCSFVTEDEVEWMRQAGLLTADPRVRERKKPGQEGARRKFTWKKR

Entity 88 Entity 88 polymer

Description description	Mitochondrial ribosomal protein S11
Molecular weight formula_weight	20856.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ai

MQVVRNAGSRLLQSWAWPPKTRIVAGLPASTIHRSAPHLQDAAAKLDIEDKEEARTPSHSSFSIYPPIPGQENSLRWAGKKFEEIPIAHIKASYNNTQIQVVSAAHQPLAHASCGTEGFRNAKKGTGIAAQTAGIAAAAKATGKGVTHVRVVVKGLGPGRLSAIKGLTMGGLEVISITDNTPIPHXGCRPRKARRL

Entity 89 Entity 89 polymer

Description description	Mitochondrial ribosomal protein S34
Molecular weight formula_weight	55714.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Aj

MRERRLLGRVTQDTHTGRARIWLHSAPPEAPGRALGLHTVLTAQGVQGLHQDVGSSIFQDGWDGERRVSCHSFFSPRRDTTGVRRADPQPRQHVDKTLIGSGSQSAGPSVSSSSPTGKPAPVPGRLTAFREALPCRSQADYHLSGLRGTSEESIPPPAAHWARPHLGPRAPPGAARPARVAAAAVPWPPPCAPPPGPGRSRRPRAGGTLGVRVRDLPGRGPPRSPAPAPARAPGPPSSSVGHGPPGLFCASGRARTPLRETPAASGIGRARRRAAASSGQSTEAPAAMARKKVRPRLIAELARRVRALREQRERPRDSQRYALDYETMMRPHSGNRLPMRAWADVRHESRLLQLLNRLPLFGLGRLVTRKSWLWQHDEPCYWRLTRVRPDYAAENLDHGKAWGILTFKGKTESEAREIEQVMYHDWRLVPKHEEEAFTAFTLVPEDTPLSVPYPPLLRAMILAQRQKYGDTSTEEPMLNLERARIDPWDYPAKLEAKTKTKGAAV

Entity 90 Entity 90 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	332

Entity 91 Entity 91 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	41

Entity 92 Entity 92 non-polymer

Description description	PHENYLALANINE
Molecular weight formula_weight	165.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 93 Entity 93 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 94 Entity 94 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 95 Entity 95 non-polymer

Description description	SPERMINE
Molecular weight formula_weight	202.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 96 Entity 96 non-polymer

Description description	SPERMIDINE
Molecular weight formula_weight	145.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 97 Entity 97 non-polymer

Description description	N-FORMYLMETHIONINE
Molecular weight formula_weight	177.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 98 Entity 98 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 99 Entity 99 non-polymer

Description description	GUANOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	443.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 100 Entity 100 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	3

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	50622

55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mitochondrial ribosomal protein L12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein uL22m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

39S ribosomal protein L23, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

uL24m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

39S ribosomal protein L27, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial ribosomal protein L28

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial ribosomal protein L47

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein uL30m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial ribosomal protein L32

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein bL33m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer