6gb2

Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit.

Method: ELECTRON MICROSCOPY D_max: 276.4 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mitochondrial ribosomal protein L12

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BL； UniProt 1–198 Chain CL； UniProt 1–198 Chain DL； UniProt 1–198 Chain EL； UniProt 1–198 Chain FL； UniProt 1–198 Chain GL； UniProt 1–198 Chain HL； UniProt 1–198	Not recorded	Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain BL 1–198（198 aa） Chain CL 1–198（198 aa） Chain DL 1–198（198 aa） Chain EL 1–198（198 aa） Chain FL 1–198（198 aa） Chain GL 1–198（198 aa） Chain HL 1–198（198 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain CL 1–198（198 aa） Chain DL 1–198（198 aa） Chain EL 1–198（198 aa） Chain FL 1–198（198 aa） Chain GL 1–198（198 aa） Chain HL 1–198（198 aa） Chain LL 1–198（198 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain CL 1–198（198 aa） Chain DL 1–198（198 aa） Chain EL 1–198（198 aa） Chain FL 1–198（198 aa） Chain GL 1–198（198 aa） Chain HL 1–198（198 aa） Chain LL 1–198（198 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain CL 1–198（198 aa） Chain DL 1–198（198 aa） Chain EL 1–198（198 aa） Chain FL 1–198（198 aa） Chain GL 1–198（198 aa） Chain HL 1–198（198 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain CL 1–198（198 aa） Chain DL 1–198（198 aa） Chain EL 1–198（198 aa） Chain FL 1–198（198 aa） Chain GL 1–198（198 aa） Chain HL 1–198（198 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain CL 1–198（198 aa） Chain DL 1–198（198 aa） Chain EL 1–198（198 aa） Chain FL 1–198（198 aa） Chain GL 1–198（198 aa） Chain HL 1–198（198 aa） Chain LL 1–198（198 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain CL 1–198（198 aa） Chain DL 1–198（198 aa） Chain EL 1–198（198 aa） Chain FL 1–198（198 aa） Chain GL 1–198（198 aa） Chain HL 1–198（198 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain CL 1–198（198 aa） Chain DL 1–198（198 aa） Chain EL 1–198（198 aa） Chain FL 1–198（198 aa） Chain GL 1–198（198 aa） Chain HL 1–198（198 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å

8 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A287ARV8_PIG
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain BL； PDBConstruct 1–198； UniProt 1–198 Author chain CL； PDBConstruct 1–198； UniProt 1–198 Author chain DL； PDBConstruct 1–198； UniProt 1–198 Author chain EL； PDBConstruct 1–198； UniProt 1–198 Author chain FL； PDBConstruct 1–198； UniProt 1–198 Author chain GL； PDBConstruct 1–198； UniProt 1–198 Author chain HL； PDBConstruct 1–198； UniProt 1–198

Mitochondrial ribosomal protein L27

OrganismNot specified

UniProt F1RT79

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain B0； UniProt 1–148	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4CE4 39S large subunit of the porcine mitochondrial ribosome Deposited 2013-11-08	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 38-meric	Chain 0 1–148（148 aa）	Not recorded	ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2；pH 7.9；20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2 cryo-EM vitrification conditions Cryogen ETHANE；MANUAL BLOTTING FOLLOWED BY MANUAL PLUNGING INTO LIQUID ETHANE	Resolution 4.90 Å
4V19 Structure of the large subunit of the mammalian mitoribosome, part 1 of 2 Deposited 2014-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 28 PDB declaration: 32-meric	Chain 0 1–148（148 aa）	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 169	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain B0 1–148（148 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain B0 1–148（148 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain B0 1–148（148 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain B0 1–148（148 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B0 1–148（148 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B0 1–148（148 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain B0 1–148（148 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B0 1–148（148 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain B0 1–148（148 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å

11 other PDB entries and 11 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1RT79_PIG
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B0； PDBConstruct 1–148； UniProt 1–148

Mitochondrial ribosomal protein L28

OrganismNot specified

UniProt A0A286ZTW8

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain B1； UniProt 1–256	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain B1 1–256（256 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain B1 1–256（256 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain B1 1–256（256 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B1 1–256（256 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B1 1–256（256 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain B1 1–256（256 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B1 1–256（256 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain B1 1–256（256 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BE 1–256（256 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIQ 39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BE 1–256（256 aa）	Not recorded	MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A286ZTW8_PIG
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain B1； PDBConstruct 1–256； UniProt 1–256

Mitochondrial ribosomal protein L47

OrganismNot specified

UniProt F1SGC7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain B2； UniProt 1–252	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain B2 1–252（252 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain B2 1–252（252 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain B2 1–252（252 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B2 1–252（252 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B2 1–252（252 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain B2 1–252（252 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B2 1–252（252 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain B2 1–252（252 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BF 1–250（250 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIQ 39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BF 1–250（250 aa）	Not recorded	MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1SGC7_PIG
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain B2； PDBConstruct 1–252； UniProt 1–252

;'Mitochondrial ribosomal protein L30 ;

OrganismNot specified

UniProt F1STE5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain B3； UniProt 1–161	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4CE4 39S large subunit of the porcine mitochondrial ribosome Deposited 2013-11-08	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 38-meric	Chain 3 1–161（161 aa）	Not recorded	ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2；pH 7.9；20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2 cryo-EM vitrification conditions Cryogen ETHANE；MANUAL BLOTTING FOLLOWED BY MANUAL PLUNGING INTO LIQUID ETHANE	Resolution 4.90 Å
4V19 Structure of the large subunit of the mammalian mitoribosome, part 1 of 2 Deposited 2014-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 28 PDB declaration: 32-meric	Chain 3 1–161（161 aa）	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 169	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain B3 1–161（161 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain B3 1–161（161 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain B3 1–161（161 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain B3 1–161（161 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B3 1–161（161 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B3 1–161（161 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain B3 1–161（161 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B3 1–161（161 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain B3 1–161（161 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å

11 other PDB entries and 11 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1STE5_PIG
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain B3； PDBConstruct 1–161； UniProt 1–161

;'Mitochondrial ribosomal protein L55 ;

OrganismNot specified

UniProt I3L9J0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain B4； UniProt 1–126	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain B4 1–126（126 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain B4 1–126（126 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain B4 1–126（126 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B4 1–126（126 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B4 1–126（126 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain B4 1–126（126 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B4 1–126（126 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain B4 1–126（126 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIP 28S mammalian mitochondrial small ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 33 PDB declaration: 36-meric	Chain Bd 1–126（126 aa）	Not recorded	MG MAGNESIUM ION × 127 SPM SPERMINE × 1 SPD SPERMIDINE × 1 K POTASSIUM ION × 11 ZN ZINC ION × 1 FS2 FE-S-O HYBRID CLUSTER × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

9 other PDB entries and 9 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	I3L9J0_PIG
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain B4； PDBConstruct 1–126； UniProt 1–126

Mitochondrial ribosomal protein L33

OrganismNot specified

UniProt A0A286ZU68

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain B6； UniProt 1–65	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain B6 1–65（65 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain B6 1–65（65 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain B6 1–65（65 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B6 1–65（65 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B6 1–65（65 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain B6 1–65（65 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B6 1–65（65 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain B6 1–65（65 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å

8 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A286ZU68_PIG
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain B6； PDBConstruct 1–65； UniProt 1–65

Mitochondrial ribosomal protein L34

OrganismNot specified

UniProt A0A287A119

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain B7； UniProt 1–95	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain B7 1–95（95 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain B7 1–95（95 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain B7 1–95（95 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B7 1–95（95 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B7 1–95（95 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain B7 1–95（95 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B7 1–95（95 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain B7 1–95（95 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å

8 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A287A119_PIG
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain B7； PDBConstruct 1–95； UniProt 1–95

Mitochondrial ribosomal protein L35

OrganismNot specified

UniProt F1SVC5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain B8； UniProt 1–188	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4CE4 39S large subunit of the porcine mitochondrial ribosome Deposited 2013-11-08	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 38-meric	Chain 8 1–188（188 aa）	Not recorded	ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2；pH 7.9；20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2 cryo-EM vitrification conditions Cryogen ETHANE；MANUAL BLOTTING FOLLOWED BY MANUAL PLUNGING INTO LIQUID ETHANE	Resolution 4.90 Å
4V19 Structure of the large subunit of the mammalian mitoribosome, part 1 of 2 Deposited 2014-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 28 PDB declaration: 32-meric	Chain 8 1–188（188 aa）	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 169	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain B8 1–188（188 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain B8 1–188（188 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain B8 1–188（188 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain B8 1–188（188 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B8 1–188（188 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B8 1–188（188 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain B8 1–188（188 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B8 1–188（188 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain B8 1–188（188 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å

11 other PDB entries and 11 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1SVC5_PIG
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain B8； PDBConstruct 1–188； UniProt 1–188

Ribosomal protein

OrganismNot specified

UniProt A0A287A731

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain B9； UniProt 1–100	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain B9 1–100（100 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain B9 1–100（100 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain B9 1–100（100 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B9 1–100（100 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain B9 1–100（100 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain B9 1–100（100 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain B9 1–100（100 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bl 1–100（100 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIQ 39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain Bl 1–100（100 aa）	Not recorded	MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å

9 other PDB entries and 9 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A287A731_PIG
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain B9； PDBConstruct 1–100； UniProt 1–100

Translation initiation factor IF-2, mitochondrial

Homo sapiens

UniProt P46199

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BC； UniProt 78–727	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain BC 78–727（650 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6GAZ Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 28S ribosomal subunit. Deposited 2018-04-13	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 33 PDB declaration: 36-meric	Chain BC 78–727（650 aa）	Not recorded	GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MG MAGNESIUM ION × 111 NA SODIUM ION × 1 SPM SPERMINE × 1 ZN ZINC ION × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
6RW5 Structure of human mitochondrial 28S ribosome in complex with mitochondrial IF2 and IF3 Deposited 2019-06-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 32 PDB declaration: 33-meric	Chain 7 38–727（690 aa）	Not recorded	NAD NICOTINAMIDE-ADENINE-DINUCLEOTIDE × 1 SPM SPERMINE × 1 SRY STREPTOMYCIN × 1 MG MAGNESIUM ION × 61 K POTASSIUM ION × 17 ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.14 Å
7PO2 Initiation complex of human mitochondrial ribosome small subunit with IF2, fMet-tRNAMet and mRNA Deposited 2021-09-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 32 PDB declaration: 35-meric	Chain 7 1–727（727 aa）	Not recorded	MG MAGNESIUM ION × 72 K POTASSIUM ION × 20 ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.09 Å
8QRN mt-SSU in GTPBP8 knock-out cells, state 4 Deposited 2023-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 31 PDB declaration: 34-meric	Chain 7 38–727（690 aa）	Not recorded	NAD NICOTINAMIDE-ADENINE-DINUCLEOTIDE × 1 SPM SPERMINE × 1 SRY STREPTOMYCIN × 1 MG MAGNESIUM ION × 58 K POTASSIUM ION × 18 ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.98 Å
9G5E Translation-initiation state of human mitochondrial ribosome small subunit (State F) Deposited 2024-07-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 31 PDB declaration: 32-meric	Chain 7 1–727（727 aa）	Not recorded	MG MAGNESIUM ION × 45 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 K POTASSIUM ION × 1 ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20mM HEPES-HCl, 100mM KCl, 20mM MgCl2, 0.02% DDM, 1mM PMSF, 1x protease-inhibitor mix, 0.5mM GMP-PNP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9HFN Translation-initiation state of human mitochondrial ribosome small subunit (State E) Deposited 2024-11-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 32 PDB declaration: 33-meric	Chain 7 1–727（727 aa）	Not recorded	MG MAGNESIUM ION × 45 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 K POTASSIUM ION × 1 ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 GDP GUANOSINE-5'-DIPHOSPHATE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20mM HEPES-HCl, 100mM KCl, 20mM MgCl2, 0.02% DDM, 1mM PMSF, 1x protease-inhibitor mix, 0.5mM GMP-PNP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9HFO Translation-initiation state of human mitochondrial ribosome small subunit (State G) Deposited 2024-11-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 31 PDB declaration: 34-meric	Chain 7 1–727（727 aa）	Not recorded	MG MAGNESIUM ION × 45 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 K POTASSIUM ION × 1 ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20mM HEPES-HCl, 100mM KCl, 20mM MgCl2, 0.02% DDM, 1mM PMSF, 1x protease-inhibitor mix, 0.5mM GMP-PNP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9IGT Assembly intermediate of human mitochondrial ribosome small subunit bound to METTL15, RBFA, and mtIF2 (State M2.1) Deposited 2025-02-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 33 PDB declaration: 34-meric	Chain 7 37–727（691 aa）	Not recorded	MG MAGNESIUM ION × 12 ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 2 NAD NICOTINAMIDE-ADENINE-DINUCLEOTIDE × 1 SPM SPERMINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.96 Å
9OJM Human mitochondrial 28S PIC with tRNA and mtIF2 Deposited 2025-05-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 31 PDB declaration: 34-meric	Chain 7 157–727（571 aa）	Not recorded	MG MAGNESIUM ION × 72 K POTASSIUM ION × 20 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 GDP GUANOSINE-5'-DIPHOSPHATE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	IF2M_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain BC； PDBConstruct 8–657； UniProt 78–727

Mitochondrial ribosomal protein L2

OrganismNot specified

UniProt F1RRN2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BD； UniProt 1–306	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4CE4 39S large subunit of the porcine mitochondrial ribosome Deposited 2013-11-08	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 38-meric	Chain D 1–306（306 aa）	Not recorded	ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2；pH 7.9；20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2 cryo-EM vitrification conditions Cryogen ETHANE；MANUAL BLOTTING FOLLOWED BY MANUAL PLUNGING INTO LIQUID ETHANE	Resolution 4.90 Å
4V19 Structure of the large subunit of the mammalian mitoribosome, part 1 of 2 Deposited 2014-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 28 PDB declaration: 32-meric	Chain D 1–306（306 aa）	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 169	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain BD 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain BD 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain BD 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain BD 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BD 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BD 1–306（306 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain BD 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain BD 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1RRN2_PIG
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain BD； PDBConstruct 1–306； UniProt 1–306

Mitochondrial ribosomal protein L4

OrganismNot specified

UniProt A0A287B9C4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BF； UniProt 1–294	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain BF 1–294（294 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain BF 1–294（294 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain BF 1–294（294 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BF 1–294（294 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BF 1–294（294 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain BF 1–294（294 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain BF 1–294（294 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BN 1–294（294 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIQ 39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BN 1–294（294 aa）	Not recorded	MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å

9 other PDB entries and 9 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A287B9C4_PIG
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain BF； PDBConstruct 1–294； UniProt 1–294

Mitochondrial ribosomal protein L9

OrganismNot specified

UniProt I3LR45

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BI； UniProt 1–268	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4CE4 39S large subunit of the porcine mitochondrial ribosome Deposited 2013-11-08	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 38-meric	Chain I 1–268（268 aa）	Not recorded	ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2；pH 7.9；20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2 cryo-EM vitrification conditions Cryogen ETHANE；MANUAL BLOTTING FOLLOWED BY MANUAL PLUNGING INTO LIQUID ETHANE	Resolution 4.90 Å
4V19 Structure of the large subunit of the mammalian mitoribosome, part 1 of 2 Deposited 2014-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 28 PDB declaration: 32-meric	Chain I 1–268（268 aa）	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 169	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain BI 1–268（268 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain BI 1–268（268 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain BI 1–268（268 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain BI 1–268（268 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BI 1–268（268 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BI 1–268（268 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain BI 1–268（268 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BI 1–268（268 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain BI 1–268（268 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BO 1–268（268 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIQ 39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BO 1–268（268 aa）	Not recorded	MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å

13 other PDB entries and 13 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	I3LR45_PIG
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain BI； PDBConstruct 1–268； UniProt 1–268

Mitochondrial ribosomal protein L10

OrganismNot specified

UniProt F1RWJ0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BJ； UniProt 1–262	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4V19 Structure of the large subunit of the mammalian mitoribosome, part 1 of 2 Deposited 2014-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 28 PDB declaration: 32-meric	Chain J 1–262（262 aa）	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 169	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain BJ 1–262（262 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain BJ 1–262（262 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain BJ 1–262（262 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain BJ 1–262（262 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BJ 1–262（262 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BJ 1–262（262 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain BJ 1–262（262 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain BJ 1–262（262 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BP 1–257（257 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIQ 39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BP 1–257（257 aa）	Not recorded	MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å

11 other PDB entries and 11 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1RWJ0_PIG
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain BJ； PDBConstruct 1–262； UniProt 1–262

Mitochondrial ribosomal protein L11

OrganismNot specified

UniProt F1RU54

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BK； UniProt 1–192	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4V19 Structure of the large subunit of the mammalian mitoribosome, part 1 of 2 Deposited 2014-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 28 PDB declaration: 32-meric	Chain K 1–192（192 aa）	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 169	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain BK 1–192（192 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain BK 1–192（192 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain BK 1–192（192 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain BK 1–192（192 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BK 1–192（192 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BK 1–192（192 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain BK 1–192（192 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain BK 1–192（192 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BQ 1–192（192 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIQ 39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BQ 1–192（192 aa）	Not recorded	MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å

11 other PDB entries and 11 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1RU54_PIG
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain BK； PDBConstruct 1–192； UniProt 1–192

Mitochondrial ribosomal protein L15

OrganismNot specified

UniProt F1RSH0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BP； UniProt 1–296	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4CE4 39S large subunit of the porcine mitochondrial ribosome Deposited 2013-11-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 38-meric	Chain P 22–296（275 aa）	Not recorded	ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2；pH 7.9；20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2 cryo-EM vitrification conditions Cryogen ETHANE；MANUAL BLOTTING FOLLOWED BY MANUAL PLUNGING INTO LIQUID ETHANE	Resolution 4.90 Å
4V19 Structure of the large subunit of the mammalian mitoribosome, part 1 of 2 Deposited 2014-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 28 PDB declaration: 32-meric	Chain P 1–296（296 aa）	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 169	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain BP 1–296（296 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain BP 1–296（296 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain BP 1–296（296 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain BP 1–296（296 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BP 1–296（296 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BP 1–296（296 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain BP 1–296（296 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain BP 1–296（296 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1RSH0_PIG
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain BP； PDBConstruct 1–296； UniProt 1–296

Mitochondrial ribosomal protein L16

OrganismNot specified

UniProt F1RI89

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BQ； UniProt 1–251	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4CE4 39S large subunit of the porcine mitochondrial ribosome Deposited 2013-11-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 38-meric	Chain Q 1–191（191 aa）	Not recorded	ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2；pH 7.9；20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2 cryo-EM vitrification conditions Cryogen ETHANE；MANUAL BLOTTING FOLLOWED BY MANUAL PLUNGING INTO LIQUID ETHANE	Resolution 4.90 Å
4V19 Structure of the large subunit of the mammalian mitoribosome, part 1 of 2 Deposited 2014-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 28 PDB declaration: 32-meric	Chain Q 1–251（251 aa）	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 169	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain BQ 1–251（251 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain BQ 1–251（251 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain BQ 1–251（251 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain BQ 1–251（251 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BQ 1–251（251 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BQ 1–251（251 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain BQ 1–251（251 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain BQ 1–251（251 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BU 1–251（251 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIQ 39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BU 1–251（251 aa）	Not recorded	MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å

12 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1RI89_PIG
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain BQ； PDBConstruct 1–251； UniProt 1–251

Mitochondrial ribosomal protein L17

OrganismNot specified

UniProt F1RMQ4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BR； UniProt 1–169	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4CE4 39S large subunit of the porcine mitochondrial ribosome Deposited 2013-11-08	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 38-meric	Chain R 1–169（169 aa）	Not recorded	ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2；pH 7.9；20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2 cryo-EM vitrification conditions Cryogen ETHANE；MANUAL BLOTTING FOLLOWED BY MANUAL PLUNGING INTO LIQUID ETHANE	Resolution 4.90 Å
4V19 Structure of the large subunit of the mammalian mitoribosome, part 1 of 2 Deposited 2014-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 28 PDB declaration: 32-meric	Chain R 1–169（169 aa）	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 169	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain BR 1–169（169 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain BR 1–169（169 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain BR 1–169（169 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain BR 1–169（169 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BR 1–169（169 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BR 1–169（169 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain BR 1–169（169 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BR 1–169（169 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain BR 1–169（169 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BV 1–169（169 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIQ 39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BV 1–169（169 aa）	Not recorded	MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å

13 other PDB entries and 13 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1RMQ4_PIG
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain BR； PDBConstruct 1–169； UniProt 1–169

Mitochondrial ribosomal protein L18

OrganismNot specified

UniProt A0A286ZNK1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BS； UniProt 1–180	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain BS 1–180（180 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain BS 1–180（180 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain BS 1–180（180 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BS 1–180（180 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BS 1–180（180 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain BS 1–180（180 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain BS 1–180（180 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A286ZNK1_PIG
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain BS； PDBConstruct 1–180； UniProt 1–180

Mitochondrial ribosomal protein L20

OrganismNot specified

UniProt A0A286ZU56

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BU； UniProt 1–149	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain BU 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain BU 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain BU 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BU 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BU 1–149（149 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain BU 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BU 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain BU 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BY 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIQ 39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BY 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A286ZU56_PIG
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain BU； PDBConstruct 1–149； UniProt 1–149

Mitochondrial ribosomal protein L21

OrganismNot specified

UniProt F1RY70

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BV； UniProt 1–209	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4CE4 39S large subunit of the porcine mitochondrial ribosome Deposited 2013-11-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 38-meric	Chain V 1–203（203 aa）	Not recorded	ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2；pH 7.9；20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2 cryo-EM vitrification conditions Cryogen ETHANE；MANUAL BLOTTING FOLLOWED BY MANUAL PLUNGING INTO LIQUID ETHANE	Resolution 4.90 Å
4V19 Structure of the large subunit of the mammalian mitoribosome, part 1 of 2 Deposited 2014-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 28 PDB declaration: 32-meric	Chain V 1–209（209 aa）	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 169	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain BV 1–209（209 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain BV 1–209（209 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain BV 1–209（209 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain BV 1–209（209 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BV 1–209（209 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BV 1–209（209 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain BV 1–209（209 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BV 1–209（209 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain BV 1–209（209 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BZ 1–209（209 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIQ 39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BZ 1–209（209 aa）	Not recorded	MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å

13 other PDB entries and 13 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1RY70_PIG
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain BV； PDBConstruct 1–209； UniProt 1–209

Mitochondrial ribosomal protein L22

OrganismNot specified

UniProt F1RQC9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BW； UniProt 1–210	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain BW 1–210（210 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain BW 1–210（210 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain BW 1–210（210 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BW 1–210（210 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BW 1–210（210 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain BW 1–210（210 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BW 1–210（210 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain BW 1–210（210 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å

8 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1RQC9_PIG
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain BW； PDBConstruct 1–210； UniProt 1–210

Mitochondrial ribosomal protein L23

OrganismNot specified

UniProt A0A286ZZC6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BX； UniProt 1–150	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain BX 1–150（150 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain BX 1–150（150 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain BX 1–150（150 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BX 1–150（150 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BX 1–150（150 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain BX 1–150（150 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain BX 1–150（150 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A286ZZC6_PIG
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain BX； PDBConstruct 1–150； UniProt 1–150

Mitochondrial ribosomal protein L24

OrganismNot specified

UniProt F1RHJ1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain BY； UniProt 1–216	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4CE4 39S large subunit of the porcine mitochondrial ribosome Deposited 2013-11-08	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 38-meric	Chain Y 1–216（216 aa）	Not recorded	ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2；pH 7.9；20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2 cryo-EM vitrification conditions Cryogen ETHANE；MANUAL BLOTTING FOLLOWED BY MANUAL PLUNGING INTO LIQUID ETHANE	Resolution 4.90 Å
4V19 Structure of the large subunit of the mammalian mitoribosome, part 1 of 2 Deposited 2014-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 28 PDB declaration: 32-meric	Chain Y 1–216（216 aa）	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 169	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain BY 1–216（216 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain BY 1–216（216 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain BY 1–216（216 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain BY 1–216（216 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BY 1–216（216 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BY 1–216（216 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain BY 1–216（216 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain BY 1–216（216 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain BY 1–216（216 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain BC 1–216（216 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIQ 39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain BC 1–216（216 aa）	Not recorded	MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å

13 other PDB entries and 13 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1RHJ1_PIG
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain BY； PDBConstruct 1–216； UniProt 1–216

Mitochondrial ribosomal protein L37

OrganismNot specified

UniProt A0A287BIV6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Ba； UniProt 1–423	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Ba 1–423（423 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Ba 1–423（423 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Ba 1–423（423 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Ba 1–423（423 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Ba 1–423（423 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Ba 1–423（423 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Ba 1–423（423 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Ba 1–423（423 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bm 1–423（423 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIQ 39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain Bm 1–423（423 aa）	Not recorded	MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A287BIV6_PIG
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain Ba； PDBConstruct 1–423； UniProt 1–423

Mitochondrial ribosomal protein L38

OrganismNot specified

UniProt F1RW03

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bb； UniProt 1–380	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4CE4 39S large subunit of the porcine mitochondrial ribosome Deposited 2013-11-08	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 38-meric	Chain b 1–380（380 aa）	Not recorded	ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2；pH 7.9；20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2 cryo-EM vitrification conditions Cryogen ETHANE；MANUAL BLOTTING FOLLOWED BY MANUAL PLUNGING INTO LIQUID ETHANE	Resolution 4.90 Å
4V1A Structure of the large subunit of the mammalian mitoribosome, part 2 of 2 Deposited 2014-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain b 1–380（380 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain Bb 1–380（380 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bb 1–380（380 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bb 1–380（380 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bb 1–380（380 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bb 1–380（380 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bb 1–380（380 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bb 1–380（380 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bb 1–380（380 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bb 1–380（380 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bn 1–380（380 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIQ 39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain Bn 1–380（380 aa）	Not recorded	MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å

13 other PDB entries and 13 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1RW03_PIG
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain Bb； PDBConstruct 1–380； UniProt 1–380

Mitochondrial ribosomal protein L39

OrganismNot specified

UniProt F1SHP6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bc； UniProt 1–334	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4CE4 39S large subunit of the porcine mitochondrial ribosome Deposited 2013-11-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 38-meric	Chain c 69–337（269 aa）	Not recorded	ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2；pH 7.9；20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2 cryo-EM vitrification conditions Cryogen ETHANE；MANUAL BLOTTING FOLLOWED BY MANUAL PLUNGING INTO LIQUID ETHANE	Resolution 4.90 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bc 1–334（334 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bc 1–334（334 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bc 1–334（334 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bc 1–334（334 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bc 1–334（334 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bc 1–334（334 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bc 1–334（334 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bo 1–334（334 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIQ 39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain Bo 1–334（334 aa）	Not recorded	MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1SHP6_PIG
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain Bc； PDBConstruct 1–334； UniProt 1–334

Mitochondrial ribosomal protein L40

OrganismNot specified

UniProt A0A286ZP98

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bd； UniProt 1–206	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bd 1–206（206 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bd 1–206（206 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bd 1–206（206 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bd 1–206（206 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bd 1–206（206 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bp 1–162（162 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIQ 39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain Bp 1–162（162 aa）	Not recorded	MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A286ZP98_PIG
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain Bd； PDBConstruct 1–206； UniProt 1–206

Mitochondrial ribosomal protein L41

OrganismNot specified

UniProt A0A287AWS0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Be； UniProt 1–135	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Be 1–135（135 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Be 1–135（135 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Be 1–135（135 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Be 1–135（135 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Be 1–135（135 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Be 1–135（135 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Be 1–135（135 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Be 1–135（135 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å

8 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A287AWS0_PIG
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain Be； PDBConstruct 1–135； UniProt 1–135

Mitochondrial ribosomal protein L42

OrganismNot specified

UniProt A0A287BQA1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bf； UniProt 1–142	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bf 1–142（142 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bf 1–142（142 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bf 1–142（142 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bf 1–142（142 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bf 1–142（142 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bf 1–142（142 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bf 1–142（142 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bf 1–142（142 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Br 1–142（142 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIQ 39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain Br 1–142（142 aa）	Not recorded	MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A287BQA1_PIG
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain Bf； PDBConstruct 1–142； UniProt 1–142

Mitochondrial ribosomal protein L43

OrganismNot specified

UniProt F1S8U4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bg； UniProt 1–159	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4V1A Structure of the large subunit of the mammalian mitoribosome, part 2 of 2 Deposited 2014-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain g 1–159（159 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain Bg 1–159（159 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bg 1–159（159 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bg 1–159（159 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bg 1–159（159 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bg 1–159（159 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bg 1–159（159 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bg 1–159（159 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bg 1–159（159 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bg 1–159（159 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bs 2–159（158 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIQ 39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain Bs 2–159（158 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å

12 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1S8U4_PIG
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain Bg； PDBConstruct 1–159； UniProt 1–159

Mitochondrial ribosomal protein L44

OrganismNot specified

UniProt F1SR64

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bh； UniProt 1–332	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4CE4 39S large subunit of the porcine mitochondrial ribosome Deposited 2013-11-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 36 PDB declaration: 38-meric	Chain h 67–332（266 aa）	Not recorded	ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2；pH 7.9；20 MM HEPES-KOH PH 7.9, 100 MM KCL, 1 MM DTT, 20 MM MGCL2 cryo-EM vitrification conditions Cryogen ETHANE；MANUAL BLOTTING FOLLOWED BY MANUAL PLUNGING INTO LIQUID ETHANE	Resolution 4.90 Å
4V1A Structure of the large subunit of the mammalian mitoribosome, part 2 of 2 Deposited 2014-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain h 1–332（332 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain Bh 1–332（332 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bh 1–332（332 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bh 1–332（332 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bh 1–332（332 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bh 1–332（332 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bh 1–332（332 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bh 1–332（332 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bh 1–332（332 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bh 1–332（332 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bt 1–332（332 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIQ 39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain Bt 1–332（332 aa）	Not recorded	MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å

13 other PDB entries and 13 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1SR64_PIG
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain Bh； PDBConstruct 1–332； UniProt 1–332

Mitochondrial ribosomal protein L45

OrganismNot specified

UniProt I3LGM5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bi； UniProt 1–306	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bi 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bi 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bi 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bi 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bi 1–306（306 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bi 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bi 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bi 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bu 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIQ 39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain Bu 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	I3LGM5_PIG
Isoform	—
PDB entities	41
Chains and sequence ranges	Author chain Bi； PDBConstruct 1–306； UniProt 1–306

Mitochondrial ribosomal protein L46

OrganismNot specified

UniProt F1SRT0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bj； UniProt 1–279	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4V1A Structure of the large subunit of the mammalian mitoribosome, part 2 of 2 Deposited 2014-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain j 1–279（279 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain Bj 1–279（279 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bj 1–279（279 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bj 1–279（279 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bj 1–279（279 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bj 1–279（279 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bj 1–279（279 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bj 1–279（279 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bj 1–279（279 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bj 1–279（279 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bv 1–279（279 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIQ 39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain Bv 1–279（279 aa）	Not recorded	MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å

12 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1SRT0_PIG
Isoform	—
PDB entities	42
Chains and sequence ranges	Author chain Bj； PDBConstruct 1–279； UniProt 1–279

Mitochondrial ribosomal protein L48

OrganismNot specified

UniProt F1SUS9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bk； UniProt 1–212	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bk 1–212（212 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1SUS9_PIG
Isoform	—
PDB entities	43
Chains and sequence ranges	Author chain Bk； PDBConstruct 1–212； UniProt 1–212

Mrpl34

OrganismNot specified

UniProt A0A0R4J8D6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bl； UniProt 1–166	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bl 1–166（166 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bl 1–166（166 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bl 1–166（166 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bl 1–166（166 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bl 1–166（166 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bl 1–166（166 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bl 1–166（166 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bx 1–166（166 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å

8 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A0R4J8D6_PIG
Isoform	—
PDB entities	44
Chains and sequence ranges	Author chain Bl； PDBConstruct 1–166； UniProt 1–166

Mitochondrial ribosomal protein L50

OrganismNot specified

UniProt I3L9H6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bm； UniProt 1–159	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4V1A Structure of the large subunit of the mammalian mitoribosome, part 2 of 2 Deposited 2014-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain m 1–159（159 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain Bm 1–159（159 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bm 1–159（159 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bm 1–198（198 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bm 1–198（198 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bm 1–198（198 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bm 1–198（198 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bm 1–198（198 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bm 1–198（198 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bm 1–198（198 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain By 1–198（198 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIQ 39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain By 1–198（198 aa）	Not recorded	MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å

12 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	I3L9H6_PIG
Isoform	—
PDB entities	45
Chains and sequence ranges	Author chain Bm； PDBConstruct 1–159； UniProt 1–159

Mitochondrial ribosomal protein L51

OrganismNot specified

UniProt A0A287BE26

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bn； UniProt 1–128	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bn 1–128（128 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bn 1–128（128 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bn 1–128（128 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bn 1–128（128 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bn 1–128（128 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bn 1–128（128 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bn 1–128（128 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bn 1–128（128 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å

8 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A287BE26_PIG
Isoform	—
PDB entities	46
Chains and sequence ranges	Author chain Bn； PDBConstruct 1–128； UniProt 1–128

Mitochondrial ribosomal protein L52

OrganismNot specified

UniProt F1S9B7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bo； UniProt 1–124	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4V1A Structure of the large subunit of the mammalian mitoribosome, part 2 of 2 Deposited 2014-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain o 1–124（124 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain Bo 1–124（124 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bo 1–124（124 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bo 1–124（124 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bo 1–124（124 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bo 1–124（124 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bo 1–124（124 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bo 1–124（124 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bo 1–124（124 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bo 1–124（124 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Ba 1–160（160 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIQ 39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain Ba 1–160（160 aa）	Not recorded	MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å

12 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1S9B7_PIG
Isoform	—
PDB entities	47
Chains and sequence ranges	Author chain Bo； PDBConstruct 1–124； UniProt 1–124

Uncharacterized protein

OrganismNot specified

UniProt I3LN63

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bq； UniProt 1–138	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bq 1–138（138 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bq 1–138（138 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bq 1–138（138 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bq 1–138（138 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bq 1–138（138 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bq 1–138（138 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bq 1–138（138 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bc 1–138（138 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIQ 39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain Bc 1–138（138 aa）	Not recorded	MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å

9 other PDB entries and 9 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	I3LN63_PIG
Isoform	—
PDB entities	49
Chains and sequence ranges	Author chain Bq； PDBConstruct 1–138； UniProt 1–138

Mitochondrial ribosomal protein L57

OrganismNot specified

UniProt A0A287BP93

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bt； UniProt 1–102	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bt 1–102（102 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bt 1–102（102 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bt 1–102（102 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bt 1–102（102 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bt 1–102（102 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bt 1–102（102 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bt 1–102（102 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bt 1–102（102 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Be 1–102（102 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIQ 39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain Be 1–102（102 aa）	Not recorded	MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A287BP93_PIG
Isoform	—
PDB entities	50
Chains and sequence ranges	Author chain Bt； PDBConstruct 1–102； UniProt 1–102

Mitochondrial ribosomal protein L58

OrganismNot specified

UniProt A0A286ZJR2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bu； UniProt 1–205	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bu 1–205（205 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bu 1–205（205 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bu 1–205（205 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bu 1–205（205 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bu 1–205（205 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bu 1–205（205 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bu 1–205（205 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bu 1–205（205 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bf 1–205（205 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIQ 39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain Bf 1–205（205 aa）	Not recorded	MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A286ZJR2_PIG
Isoform	—
PDB entities	51
Chains and sequence ranges	Author chain Bu； PDBConstruct 1–205； UniProt 1–205

;'Mitochondrial ribosomal protein L59 ;

OrganismNot specified

UniProt A0A286ZXA6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bv； UniProt 1–222	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） mL65, MRPS30 × 1 Mitochondrial ribosomal protein S18A × 1 （F1RRH6） unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bv 1–222（222 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bv 1–222（222 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bv 1–222（222 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bv 1–222（222 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bv 1–222（222 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bv 1–222（222 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSI 55S mammalian mitochondrial ribosome with mtRRF (pre) and tRNA(P/E) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bv 1–222（222 aa）	Not recorded	MG MAGNESIUM ION × 327 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bv 1–222（222 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bg 1–222（222 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIQ 39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain Bg 1–222（222 aa）	Not recorded	MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A286ZXA6_PIG
Isoform	—
PDB entities	52
Chains and sequence ranges	Author chain Bv； PDBConstruct 1–222； UniProt 1–222

Mitochondrial ribosomal protein S18A

OrganismNot specified

UniProt F1RRH6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Heteromer Protein × 59 RNA 3 PDB declaration: 62-meric（62） Consistent with all polymer counts	Chain Bx； UniProt 1–196	Not recorded	Mitochondrial ribosomal protein L12 × 7 （A0A287ARV8） Mitochondrial ribosomal protein L27 × 1 （F1RT79） Mitochondrial ribosomal protein L28 × 1 （A0A286ZTW8） Mitochondrial ribosomal protein L47 × 1 （F1SGC7） ;'Mitochondrial ribosomal protein L30 ; × 1 （F1STE5） ;'Mitochondrial ribosomal protein L55 ; × 1 （I3L9J0） Mitochondrial ribosomal protein L32 × 1 Mitochondrial ribosomal protein L33 × 1 （A0A286ZU68） Mitochondrial ribosomal protein L34 × 1 （A0A287A119） Mitochondrial ribosomal protein L35 × 1 （F1SVC5） Ribosomal protein × 1 （A0A287A731） 16S ribosomal RNA, mitochondrial × 1 CP tRNAPhe, mitochondrial × 1 Translation initiation factor IF-2, mitochondrial × 1 （P46199） Mitochondrial ribosomal protein L2 × 1 （F1RRN2） ICT1 × 1 Mitochondrial ribosomal protein L4 × 1 （A0A287B9C4） Mitochondrial ribosomal protein L9 × 1 （I3LR45） Mitochondrial ribosomal protein L10 × 1 （F1RWJ0） Mitochondrial ribosomal protein L11 × 1 （F1RU54） Mitochondrial ribosomal protein L13 × 1 Mitochondrial ribosomal protein L14 × 1 Mitochondrial ribosomal protein L15 × 1 （F1RSH0） Mitochondrial ribosomal protein L16 × 1 （F1RI89） Mitochondrial ribosomal protein L17 × 1 （F1RMQ4） Mitochondrial ribosomal protein L18 × 1 （A0A286ZNK1） Mitochondrial ribosomal protein L19 × 1 Mitochondrial ribosomal protein L20 × 1 （A0A286ZU56） Mitochondrial ribosomal protein L21 × 1 （F1RY70） Mitochondrial ribosomal protein L22 × 1 （F1RQC9） Mitochondrial ribosomal protein L23 × 1 （A0A286ZZC6） Mitochondrial ribosomal protein L24 × 1 （F1RHJ1） Mitochondrial ribosomal protein L37 × 1 （A0A287BIV6） Mitochondrial ribosomal protein L38 × 1 （F1RW03） Mitochondrial ribosomal protein L39 × 1 （F1SHP6） Mitochondrial ribosomal protein L40 × 1 （A0A286ZP98） Mitochondrial ribosomal protein L41 × 1 （A0A287AWS0） Mitochondrial ribosomal protein L42 × 1 （A0A287BQA1） Mitochondrial ribosomal protein L43 × 1 （F1S8U4） Mitochondrial ribosomal protein L44 × 1 （F1SR64） Mitochondrial ribosomal protein L45 × 1 （I3LGM5） Mitochondrial ribosomal protein L46 × 1 （F1SRT0） Mitochondrial ribosomal protein L48 × 1 （F1SUS9） Mrpl34 × 1 （A0A0R4J8D6） Mitochondrial ribosomal protein L50 × 1 （I3L9H6） Mitochondrial ribosomal protein L51 × 1 （A0A287BE26） Mitochondrial ribosomal protein L52 × 1 （F1S9B7） mL53, MRPL53 × 1 Uncharacterized protein × 1 （I3LN63） Mitochondrial ribosomal protein L57 × 1 （A0A287BP93） Mitochondrial ribosomal protein L58 × 1 （A0A286ZJR2） ;'Mitochondrial ribosomal protein L59 ; × 1 （A0A286ZXA6） mL65, MRPS30 × 1 unassigned secondary structure elements × 1 P-site fMet-tRNAMet, mitochondrial × 1 MG MAGNESIUM ION × 216 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6GB2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4V1A Structure of the large subunit of the mammalian mitoribosome, part 2 of 2 Deposited 2014-09-25	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain x 1–196（196 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.40 Å
5AJ4 Structure of the 55S mammalian mitoribosome. Deposited 2015-02-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 83 PDB declaration: 89-meric	Chain Bx 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 351 ZN ZINC ION × 6 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT；pH 7.4；20 MM HEPES-KOH, 50 MM KCL, 40 MM MGCL2, 1 MM DTT cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；MIXTURE OF LIQUID ETHANE AND PROPANE	Resolution 3.80 Å
6GAW Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the complete 55S ribosome. Deposited 2018-04-13	Different oligomeric state Different ligand/ion	Assembly 1 Protein–RNA Heteromer；Protein × 90 PDB declaration: 95-meric	Chain Bx 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 NA SODIUM ION × 1 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6YDP 55S mammalian mitochondrial ribosome with mtEFG1 and P site fMet-tRNAMet (POST) Deposited 2020-03-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 94-meric	Chain Bx 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 326 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.00 Å
6YDW 55S mammalian mitochondrial ribosome with mtEFG1 and two tRNAMet (TI-POST) Deposited 2020-03-21	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 89 PDB declaration: 95-meric	Chain Bx 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 325 ZN ZINC ION × 6 SPM SPERMINE × 3 FME N-FORMYLMETHIONINE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
7NQH 55S mammalian mitochondrial ribosome with mtRF1a and P-site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bx 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 323 ZN ZINC ION × 6 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 5GP GUANOSINE-5'-MONOPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å
7NQL 55S mammalian mitochondrial ribosome with ICT1 and P site tRNAMet Deposited 2021-03-01	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 93-meric	Chain Bx 1–196（196 aa）	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 335 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.40 Å
7NSH 39S mammalian mitochondrial large ribosomal subunit with mtRRF (post) and mtEFG2 Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein–RNA Heteromer；Protein × 59 PDB declaration: 61-meric	Chain Bx 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 221 ZN ZINC ION × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 2 SPM SPERMINE × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.20 Å
7NSJ 55S mammalian mitochondrial ribosome with tRNA(P/P) and tRNA(E*) Deposited 2021-03-07	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 87 PDB declaration: 93-meric	Chain Bx 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 324 ZN ZINC ION × 6 SPM SPERMINE × 3 5GP GUANOSINE-5'-MONOPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.90 Å
8OIN 55S mammalian mitochondrial ribosome with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 88 PDB declaration: 94-meric	Chain Bh 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 332 K POTASSIUM ION × 41 PHE PHENYLALANINE × 1 ZN ZINC ION × 3 FES FE2/S2 (INORGANIC) CLUSTER × 3 SPM SPERMINE × 1 SPD SPERMIDINE × 1 FME N-FORMYLMETHIONINE × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.60 Å
8OIQ 39S mammalian mitochondrial large ribosomal subunit with mtRF1 and P-site tRNA Deposited 2023-03-23	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 58 PDB declaration: 62-meric	Chain Bh 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 205 K POTASSIUM ION × 30 PHE PHENYLALANINE × 1 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 FME N-FORMYLMETHIONINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES-KOH pH=7.5, 100mM KCl, 20mM MgCl2, ~1% sucrose (from mtRF1 storage buffer) cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.50 Å

11 other PDB entries and 11 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F1RRH6_PIG
Isoform	—
PDB entities	54
Chains and sequence ranges	Author chain Bx； PDBConstruct 1–196； UniProt 1–196

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6gb2
Deposition date deposition_date	2018-04-13
Structure title title	Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM. This file contains the 39S ribosomal subunit.
Keywords keywords	translation initiation, initiation factor IF2, mitochondria, membrane targeting, RIBOSOME; RIBOSOME
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	75.74 Å
Radius of gyration Rg (electron density) rg_electron	79.77 Å
Forward intensity I(0) i0	56104700000.00
Molecular weight molecular_weight	1613000.0 kDa
Excluded volume excluded_volume	1850600 Å³
Envelope volume envelope_volume	3086000 Å³
Hydration-shell volume shell_volume	298600 Å³
Envelope diameter envelope_diameter	302.2 Å
Shell Rg shell_rg	90.03 Å
Envelope Rg envelope_rg	80.83 Å
Shape Rg shape_rg	79.98 Å
Total Rg total_rg	79.27 Å
Total atoms total_atoms	111107
Residues n_residues	10997
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	276.4 Å
Rg (real space) rg_real	78.70 Å
Rg uncertainty (real space) rg_real_error	1.43 Å
I(0) (real space) i0_real	5.6100e+10
I(0) uncertainty (real space) i0_real_error	1.1710e+09
Rg (reciprocal space) rg_reciprocal	76.02 Å
I(0) (reciprocal space) i0_reciprocal	56140000000.0000
Solution quality estimate total_estimate	0.8764
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	92.1 Å
Skewness Skewness skewness	0.584
Kurtosis Kurtosis kurtosis	0.327
Angular range angular_range	— – 0.1050 Å⁻¹
Current regularization parameter α current_alpha	0.9525
Highest regularization parameter α highest_alpha	6484000000.0000
Real-space data points n_real_points	22
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.674; Stabil: 0.902; Sysdev: 1.000; Positv: 1.000; Valcen: 0.952; Smooth: 0.783

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (64)

Entity 1 Entity 1 polymer

Description description	Mitochondrial ribosomal protein L12
Molecular weight formula_weight	21269.0 kDa
Source method src_method	nat
Copy count entity_count	7

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	CL,DL,EL,FL,GL,HL,BL
Atom count atom_count	111109

MLPAAASSLWGPCFGLRAAALRVARHQGPRLCGVRLMRCSSHRKGEALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGFMPMGAVAPGAPPAAAAPEAAEEDLPKRKEQTHFTVRLTEAKPVDKVKLIKEIKSHIQGINLVQAKKLVESLPQEIKANVPKAEAEKIKAALEAVGGTVVLE

Entity 2 Entity 2 polymer

Description description	Mitochondrial ribosomal protein L27
Molecular weight formula_weight	15943.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B0

MALAVLALRTRAAVTALLSPPQAAALAVRYASKKTGGSSKNLGGKSPGKRFGIKKMEGHYVHAGNILATQRHFRWHPGAHVGLGKNKCLYALEEGVVRYTKEVYVPNPSNSEAVDLVTRLPQGAVLYKTFVHVVPAKPEGTFKLVAML

Entity 3 Entity 3 polymer

Description description	Mitochondrial ribosomal protein L28
Molecular weight formula_weight	30149.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B1

MPLHKVPVGLWKQLRLWEGIYSRLPRHYLRSLEEARTPTPVHYRPHGAKFKINPKNWQRERVEDVPIPVHYPPESQLGLWGGEGWVLGHRYVNNDKLSKRVRKVWKPQLFQRELYSEILDKRFTVTVTMRTLDLIDQACGFDFYILKTPKEDLCSKFGMDLKRGMLLRLARQDPQLHPDDPARRAAIYDRYKAFVIPEAEAEWVGLTLDEAVEKQRLLEEKDPIPLFKIFVEELLGQLQQQALSEPAVVQTRASRK

Entity 4 Entity 4 polymer

Description description	Mitochondrial ribosomal protein L47
Molecular weight formula_weight	30085.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B2

MAAAGLAVFCRRVSAALKACRLLIRPQAPPSTSCRFSPSLLPKNTPNVTSFHQFRIFHTTFSRRGLEEFFDDPKNWGEEKVKSGASWTCQQLRNKSNEDLHKLWYVLLKERNMLLTLEQEAKRQRLPMPSPERLEKVVDSMDALDKVVQEREDALRLLQTGQEKARPGAWRRDIFGRIIWHKFKQWPIPWYLNKKYNRKRFFAMPYVERFVRMRIEKQARIKARKRSLERKKEKFLQEKFPHLSETQKSSHV

Entity 5 Entity 5 polymer

Description description	;'Mitochondrial ribosomal protein L30 ;
Molecular weight formula_weight	18585.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B3

MAGILRSVVQRPPGRLQTVTKGMESLICTDWIRHKFTRSRIPDKVFQPSPEDHEKYGGDPQYPHKLHIVTRIKSTKRRPYWEKDIIKMLGLEKAHTPQVHKNIPSVNAKLKVVKHLIRIKPLKLPQGLPTEEDMANTCLKSNGELVVRWLLNPANQEARKS

Entity 6 Entity 6 polymer

Description description	;'Mitochondrial ribosomal protein L55 ;
Molecular weight formula_weight	15156.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B4

MAAKGSLLRLLWQRVVTGAAPESCRHLYTSSWRADCNRALLTRLHRQTYARLYPVLLVKQDGSTIHIRYREPRRMLTMPVDLDSLSPEERRARFRKREAKFKEKKEEPELSDDFDVEQYKRFWTKK

Entity 7 Entity 7 polymer

Description description	Mitochondrial ribosomal protein L32
Molecular weight formula_weight	21537.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B5

MASAMLVLVVPPWPAARGLLRNWWEQLQRKLQHNRLGLPLHPWGPALAVQGPAICTEPANDTNGSKAISSLLDSVFWMAAPKNRRSIEVNRCRRRNPQKLIKVKNNIDVCPECGHLKQKHILCGYCYEKVRKETAEIRRQMGKQEGGPFRAPTTETVVLYSGETPSEQDQGKRIIERERKRPSWFTQN

Entity 8 Entity 8 polymer

Description description	Mitochondrial ribosomal protein L33
Molecular weight formula_weight	7508.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B6

MFLSAVTFAKSKSKTILVKMMSQAGTGFSFNTKRSRLREKLTLLHYDPVVKKKVLFVEQKKIRSL

Entity 9 Entity 9 polymer

Description description	Mitochondrial ribosomal protein L34
Molecular weight formula_weight	10871.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B7

MAFLARSVGRLLDPVSRSAALVGGRWLQPQAWLGFPDTWGLPAMQQTRGKARGNEYQPSNIKRKHKHGWVRRLRTPTGVQVILRRMHKGRKSLSH

Entity 10 Entity 10 polymer

Description description	Mitochondrial ribosomal protein L35
Molecular weight formula_weight	21548.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B8

MAASAFAGAVRAATGILRPLHILASSAYQNCAKNACLSSVLSSRHFSHIQTSALLSAPRLITSVRNLMCGPTAPVLNRVAPLLPHVLKPPVRTVTYFSSRKGKRKTVKAVIYRFLRLHSGLWLRRKAGYKKKLWKKTAARKRRLREFVFCNKTQSKLLDKMTTSFWKRRNWYADDPYQKYQDRTNLKV

Entity 11 Entity 11 polymer

Description description	Ribosomal protein
Molecular weight formula_weight	10841.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B9

MATAFLRTVLSAVGPLLHLGGRPLSTFAAGPPRAALAVGAQPSPAAALLSARPLLGPQPALGFKTKGVLKKRCRDCYLVKRRGRWFIYCKTNPKHKQRQM

Entity 12 Entity 12 polymer

Description description	16S ribosomal RNA, mitochondrial
Molecular weight formula_weight	504852.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	BA

ACCAAAGCUAGCUCAACAUACUAAACAAAUACAAAAAUACACCAAAAUAAAAUAAAACAUUCACCUAACAUUAAAGUAUAGGAGAUAGAAAUUUUUAUCCUGACGCUAUAGAGAUAGUACCGUAAGGGAAAGAUGAAAGAAUAAAAUAAAAGUAAAAAAAAGCAAAGAUUACCCCUUCUACCUUUUGCAUAAUGGUUUAACCAGAAAAAAUCUAACAAAGAGAACUUUAGCUAGAUACCCCGAAACCAGACGAGCUACCCAUGAGCAGUUUAAAAGAACCAACUCAUCUAUGUGGCAAAAUAGUGAGAAGACUUGUAGGUAGAGGUGAAAAGCCUAACGAGCCUGGUGAUAGCUGGUUGUCCGAGAAAGAAUUUUAGUUCAACCUUAAAAAUACCCCAAAAACCCUAAAUUCCAAUGUAUUUUUAAGAGAUAGUCUAAAAAGGUACAGCUUUUUAGAAACGGAUACAACCUUGACUAGAGAGUAAAAUCUUAAUACUACCAUAGUAGGCCUAAAAGCAGCCAUCAAUUGAGAAAGCGUUAAAGCUCAACAAAUUCACCAACAUAAUCCCAAAAACUAAUAACAAACUCCUAGCCCAAUACCGGACUAAUCUAUUGAAACAUAGAAGCAAUAAUGUUAAUAUGAGUAACAAGAAGCCUUUCUCCUCGCACACGCUUACAUCAGUAACUAAUAAUAUACUGAUAAUUAACAACCAAUAAACCAAAACAACACUAAAACGUUUAUUAAUUACAUUGUUAACCCAACACAGGAGUGCACCAAGGAAAGAUUAAAAGAAGUAAAAGGAACUCGGCAAACACAAACCCCGCCUGUUUACCAAAAACAUCACCUCUAGCAUUACUAGUAUUAGAGGCAAUGCCUGCCCAGUGACACCAGUUUAACGGCCGCGGUAUUCUGACCGUGCAAAGGUAGCAUAAUCACUUGUUCUCCAAAUAAGGACUUGUAUGAAUGGCCACACGAGGGUUUUACUGUCUCUUACUUCCAAUCAGUGAAAUUAACCUUCCCGUGAAGAGGCGGGAAUAAAAAAAUAAGACGAGAAGACCCUAUGGAGCUUUAAUUAACUAUUCCAAAAGUUAAACAACUCAACCACAAAGGGAUAAAACAUAACUUAACAUGGACUAGCAAUUUCGGUUGGGGUGACCUCGGAGUACAAAAAACCCUCCGAGUGAUUUUAAUCUAGACAAACCAGUCAAAAUAACCAUAACAUCACUUAUUGAUCCAAAAUUUUGAUCAACGGAACAAGUUACCCUAGGGAUAACAGCGCAAUCCUGUUCUAGAGUUCCUAUCGACAAUAGGGUUUACGACCUCGAUGUUGGAUCAGGACACCCAAAUGGUGCAACCGCUAUUAAAGGUUCGUUUGUUCAACGAUUAAAGUCCUACGUGAUCUGAGUUCAGACCGGAGCAAUCCAGGUCGGUUUCUAUCUAUUAUAAAUUUCUCCCAGUACGAAAGGACAAGAGAAAUGGGACCAACCUCACAAACGCGUCUCAGAGAUAAUUAAUGAUUUAAUCUUAACCUAAUUAACUCAUAAUAAAUCCAGCCCUAGAACAGGGCACA

Entity 13 Entity 13 polymer

Description description	CP tRNAPhe, mitochondrial
Molecular weight formula_weight	23402.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	BB

GUUAAUGUAGCUUAAAUUAUCAAAGCAAGGCACUGAAAAUGCCUAGAUGAGCCUCACAGCUCCAUAAACACCA

Entity 14 Entity 14 polymer

Description description	Translation initiation factor IF-2, mitochondrial
Molecular weight formula_weight	72811.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BC

SGGSGSGWKSQLSSTKSKKVVEVWIGMTIEELARAMEKNTDYVYEALLNTDIDIDSLEADSHLDEVWIKEVITKAGMKLKWSKLKQDKVRKNKDAVRRPQADPALLTPRSPVVTIMGHVDHGKTTLLDKFRKTQVAAVETGGITQHIGAFLVSLPSGEKITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDGVMKQTVESIQHAKDAQVPIILAVNKCDKAEADPEKVKKELLAYDVVCEDYGGDVQAVPVSALTGDNLMALAEATVALAEMLELKADPNGPVEGTVIESFTDKGRGLVTTAIIQRGTLRKGSVLVAGKCWAKVRLMFDENGKTIDEAYPSMPVGITGWRDLPSAGEEILEVESEPRAREVVDWRKYEQEQEKGQEDLKIIEEKRKEHKEAHQKAREKYGHLLWKKRSILRFLERKEQIPLKPKEKRERDSNVLSVIIKGDVDGSVEAILNIIDTYDASHECELELVHFGVGDVSANDVNLAETFDGVIYGFNVNAGNVIQQSAAKKGVKIKLHKIIYRLVEDLQEELSSRLPCAVEEHPVGEASILATFSVTEGKKKVPVAGCRVQKGQLEKQKKFKLTRNGHVIWKGSLTSLKHHKDDISIVKTGMDCGLSLDEDNMEFQVGDRIVCYEEKQIQAKTSWDPGF

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 15 Entity 15 polymer

Description description	Mitochondrial ribosomal protein L2
Molecular weight formula_weight	33270.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BD

MALRVLTRALSSLSLTPRIAVAPGLNLLPAVQVTNNVLLTLPSGLMSLPCRPILTSVALSATSVSWKSRTKYTVMPVKMRKSGGRNHTGQIQVHGIGGGHKQRYRMIDFLRFRPEHESKPGPFEEKVIAVRYDPCRSADIALVAGGNRKRWIIATENMKAGDTVLNSDHIGRMAVAAREGDAHPLGALPVGTLINNVESEPGRGAQYIRAAGTCGVLLRKVNGTAIIQLPSKRQMQVLETCIATVGRVSNVDHNKRVIGKAGRNRWLGKRPNSGLWQRKGGWAGRKIRPLPPMKSYVKLPSAAAQS

Entity 16 Entity 16 polymer

Description description	ICT1
Molecular weight formula_weight	38427.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BE

MPGWGLLGRAGARVLGCGADGLGASRGLGNRTDICLLVRSLHGKSVTWWDEHLSEENVPFVKQLVSDENKAQLASKLCPLKDEPWPIHPWEPGSSRVGLIALKLGMMPLWTKDGQKHVVTLLQVQDCHVLKYTPKENHNGRMAALTVGGKTVSHFHKSASILEFYQELGLPPKQKVKIFNVTENAVIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMRRWGFKGQPATHGQTKTHRRPGAISTGDVARVWPGTKMPGQLGNIDRTAFGLKVWRINTKHNIIYVNGSVPGHKNCLVKIKDSKLPAYKDFCKNLPFPTYFPDGDEEALPEDLYDENVCQPGAPSITFT

Entity 17 Entity 17 polymer

Description description	Mitochondrial ribosomal protein L4
Molecular weight formula_weight	33251.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BF

MLQLVRAGARTWFRPSGCRGLNTLAEEAVQQAEKPESVASLGLQPPVLRKCELPVPAHRRPVQAWIESLRGYEQERVGLTELHPDVFSTAPRLDILHQVAIWQKNFKRISYAKTKTRAEVRGGGRKPWVQKGSGRARHGSIRSPIWRGGGVAHGPRGPTSYYYMLPMKVRVQGLKVALTVKLAQDDLHIVDSLELPTADPQYLIELARYRRWGDSVLLVDLEHEDMPQNVVAATSGLKTFNLVPAVGLNVHSMLKHQTLVLTLPTVAFLEEKLLWHNSRYTPLYPFRLPYCDFP

Entity 18 Entity 18 polymer

Description description	Mitochondrial ribosomal protein L9
Molecular weight formula_weight	30373.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BI

MAAAACTAAGGGLLRAGLERLLRGGVRALLRPRLEGVTPRSERAFSLSLSRSTVIVERWWKVPLAGEGRKPRLHRRHRVYKLVEDTKHRPKDNLELVLTQSVEELGVRGDLVSVKKSVGRNRLLPQGLAVYASPENKKLFEEEKLLRQEGKLEKLQTKAGEATVKFLRRCHLEVGMKNNVKWELNPEIVARHFLRNLGVVVAPHALKLPEEPITQRGEYWCEVTVNGLDTVRVPMSVVNFERPKTKRYKYWLAQQAAKGDVPTSSQMI

Entity 19 Entity 19 polymer

Description description	Mitochondrial ribosomal protein L10
Molecular weight formula_weight	29449.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BJ

MAAVVAGMLRGGLLPQAGRLPTFQTVRYGSKAVTRHRRVMHFERQKLMAVTEYIPPKPTINPRCLPPPPTPPQEETGLVRLLRREIAAVFRDNRMIAVCQHVALSAEDKLLLRHQLRKHKILMKIFPNQVLKPFLEESKYQNLLPLFVGHNLLLVSEEPKVKEMVRILKGIPFLPLLGGCIDDTILSRQGFINYSKLPSLALVQGELVGGLTFLTAQTYSMLQHQPRQLTALLDQYVKQQQEGHPAVPASGQPEPPDPVPDP

Entity 20 Entity 20 polymer

Description description	Mitochondrial ribosomal protein L11
Molecular weight formula_weight	20809.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BK

MSKLSRATRALKKPEASGMIRAIVRAGQARPGPPLGPILGQRGVSINQFCKEFNEKTKDIKEGIPLPTKIFVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARHTGKEVAGLVTLKHVYEIARVKAQDDAFALQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAAFQKERALFLAAQREADLAAQAEAAKK

Entity 21 Entity 21 polymer

Description description	Mitochondrial ribosomal protein L13
Molecular weight formula_weight	20633.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BN

MSSFSKAPQQWATFARVWYLLDGKMQPPGKLAAMASVKLQGLHKPVYHQLSDCGDHVVIMNTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHQKDPVAIVKLAIYGMLPKNLHRRTMMQRLHLFPDEDIPEDILKNLVEELPQPRKVPRRLDEYTQEEIEAFPRVWSPPEDYRL

Entity 22 Entity 22 polymer

Description description	Mitochondrial ribosomal protein L14
Molecular weight formula_weight	15955.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BO

MAFCTGLRGPFAQVSRALSQRCFSTTGSLSAIQKMTRVRVVDNSALGTTPYHRPPRCIHVYNKTGVGKVGDRILLAIRGQKKKALIVGHRMPGPRMTPRFDSNNVVLLEDNGNPVGTRIKTPIPSSLRQREGEFSKVLAIAQNFV

Entity 23 Entity 23 polymer

Description description	Mitochondrial ribosomal protein L15
Molecular weight formula_weight	33481.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BP

MGGPVQGGGPRALDLLRALPRVSLANLKPNPGSRKPERRPRGRRRGRKCGRGHKGERQRGTRPRLGFEGGQTPFYLRIPKYGFNEGHSFRHQYQPLSLNRLQYLIDLGRVDPTQPIDLTQLVNGRGVTIQPSKRDYGVQLVEEGADTFKAKVNIEVQMASELAIAAIEKNGGVVTTAFYDPRSLEILCKPVPFFLRGQPIPKRMLPPEALVPYYTDAKNRGYLADPARFPEARLELARKYGYVLPDITKDELFKMLSTRKDPRQIFFGLAPGWVVNMADKKILKPTDENLLKYYSS

Entity 24 Entity 24 polymer

Description description	Mitochondrial ribosomal protein L16
Molecular weight formula_weight	28680.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BQ

MWRLLARACAPLLRAPLSDSWAAPSATAGFKTLLPVPTFEDVAIPEKPKLRFVERVPLVPKVRRERKNLSDIRGPSTEATEFTEGRFAILALGGGYLHWGHFEMMRLTINRSMDPKNMFALWRVPAPFKPITRKGMGQRMGGGKGAIDHYVTPVKAGRLIVEMGGRCEFKEVQGFLDLVAHKLPFPAKAVSRETLEKMRKDQEERERNNQNPWTFERIATANMLGIRKVLSPYDLTHKGRYWGKFYTPERV

Entity 25 Entity 25 polymer

Description description	Mitochondrial ribosomal protein L17
Molecular weight formula_weight	19268.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BR

MRLSVAAAISHGRVFRRLGLGPESRIHLLQNLLTGLVRHERIEASWARVDELRGYAEKLIDYGKLGDTNERAMRMADFWLTEKDLIPKLFQVLAPRFQGQNGGYTRMLQIPNRNEQDRAKMAVIEYKGNCLPPLPLPRRDSNLTLLNQLLQGLRQDQEASSHTAQTPAV

Entity 26 Entity 26 polymer

Description description	Mitochondrial ribosomal protein L18
Molecular weight formula_weight	20582.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BS

MALRSRFWALLSICRNPGCRAAALSTSCKPATNPETDPVENEAVAPEFTNRNPRNLELLAVARKERGWGTVWPSREFWHRLRVIRTQHHIEALVEHRNGQVVVSASTREWAIKKHLYSTRNVVACESVGRVLAERCLEAGINFMVYHPTPWEAASDSIKRLQHAMTEGGVVLREPRRIYE

Entity 27 Entity 27 polymer

Description description	Mitochondrial ribosomal protein L19
Molecular weight formula_weight	33441.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BT

MAASITRGSWAAVGLGQSFPPTRALLPAPASVICRTLAGSGRQQVTGSSEPGAFQPPPKPVIVDKRRPQRPETRFLSPEFIPPRGRTNPLKFQIERKDMLERRKILHIPEFYVGSILRVTTADPYASAKTSQFLGICIQRSGSGLGATFILRNTIEGQGVEICFELYNPRIQEIQVVKLEKRLDNSLLYLRDALPEYSTFDVNMKPITQEFNQEVPVNQLKVKMKPKPWSKRWERPKFNIKGIRFDLCLTEEQMREAQKWSQPWLEFDMMREYDTSKIEAAIWDEIEASKNS

Entity 28 Entity 28 polymer

Description description	Mitochondrial ribosomal protein L20
Molecular weight formula_weight	17554.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BU

MVFLTVPLWLRSRVTDRYWRVQEVLKHARHFRGRKNRCYRLAVRAVTRAFVKCTRARRLKKRSLRTLWINRITAASQEHGLKYPAFIINLIKCQVELNRKVLADLAIYEPKTFKSLAALAKRRREEGFAAALGDGKEPDGIFSRVVQHR

Entity 29 Entity 29 polymer

Description description	Mitochondrial ribosomal protein L21
Molecular weight formula_weight	23154.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BV

MAAAVAASVLQGTFGRLVSAYSRSVLRTSRPGTAPPWSAPRRLSSQHTSSLRGCVPKTSLGSPPWPDIVLPDPVEETRHHAEVVGQVNELIAAGRYGRLFAVVHFAGHQWKVTAEDLILIENELDVACGERIRLEKVLLVGADNFTLLGKPLLGKELVRVEATVIEKTESWPKINMKFQKRKNYQRKRITVNPQTVLRINSIEIAPCLC

Entity 30 Entity 30 polymer

Description description	Mitochondrial ribosomal protein L22
Molecular weight formula_weight	24313.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BW

MAAAVLERLGGLWMQNLRGKLALRLLSSHSILPQSHIHTSASVEISRKWEKKNKIVYPPQLPGEPRRPAEIYHCRRQIKYSKDKMWYLAKLIRGMSIDQALAQLEFSDKKGAQIIKEVLLEAQDMAVRDHNVEFRSNLYVAESTSGRGQYLKRIRYHGRGRFGIMEKVFCHYFVKLVEGPPPPREAPKTAVAHAREYIQELRNRTITHAL

Entity 31 Entity 31 polymer

Description description	Mitochondrial ribosomal protein L23
Molecular weight formula_weight	17643.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BX

MARNVLYPLYQLGNPQLRVFRTNFFIQLVRPGTAQPEDTVQFRIPMEMTRVDLRNYLERIYNVPVAAVRTRVQYGSNRRRDHRNIRIKKPDYKVAYVQLALGQTFTFPDLFPERKGASVDVDVRDQVLEDQRQKHSPDPRRGGVPGWFGL

Entity 32 Entity 32 polymer

Description description	Mitochondrial ribosomal protein L24
Molecular weight formula_weight	24893.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BY

MRLSALLALASKVTLPPNYRYGMSRPGSLSDKRKNPPGTRRRRVPVEPISDEDWHLFCGDKVEILEGKDAGKQGKVVQVIRQRNWVVVEGLNTHYRYVGKTVDYRGTMIPSEAPLLHNQVKLVDPTDRKPTDVEWRFTEAGERVRVSTRSGRIIPKPEFPRADGIVPETWIDGPKDTSVEDALEKTYVPRLKTLEEEVMEAMGIQETRRHKKVYWY

Entity 33 Entity 33 polymer

Description description	Mitochondrial ribosomal protein L37
Molecular weight formula_weight	47918.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ba

MALASGPARRALARLGRLGLGGCGAPRRGAYEWGVRSTRKPEPPPLDRVYEIPGLEPITYAGKMHFMPGLARPVFPPWDPGWTHPKFRRLPPLHEHPLYKDQACYVFHQRCRLLEGVKQALWLTKTQLIEGLPEKVLRLADDPRNHIENQDERVLNAISHARLWHSTEDIPKRETYCPVIVDSLIQLCKSQILKHPSLARRICAQNNTLSATWNRESILLQVHGSSGARLNAKDPLPPVASQEEVEATKNHVLETFYPISPTMGLQECNVYDVNDDTGFQEGYPYPCPHTLYFLESANLRPRRFQPDQLRAKMILFAFGSALAQARLLYGNDSKVLEQPVVVQSVGTDGRLFQFLVLQLNTTDLASDEGVKNLAWVDSDQLLYQHFWCLPVIKKKVVVEPVGPIGFQPETFRKFLALYLHGAV

Entity 34 Entity 34 polymer

Description description	Mitochondrial ribosomal protein L38
Molecular weight formula_weight	44656.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bb

MAAPWWRAALCASRRWRGFSTSAALSRRAAPLGPMPNEDIDVSDLERLKKYRSFDRYRRRAEQEARKPHWWRTYREHFGEESGPKDRVDIGLPPPKVSRTQQLLERKQALRELRANVEEERAARLQTARIPLEAVRAEWERTCGPYHKQRLAEYCGLYRDLFHGATFVPRVPLHVAYAVGEDDLMPVYHGNEVTPTEAAQAPEVTYEADEGSLWTLLLTNLDGHLLEPDAEYVHWLVTNIPGNRVTEGQETCPYLPPFPARGSGFHRFAFLLFKQDKRIDFSGDTRPSPCYQLAQRTFHTFDFYKKHQDAMTPAGLAFFQCRWDDSVTRVFHQLLDMREPVFEFVRPPPYHPKQKRFPHRQPLRYLDRYRDSHEPTYGIY

Entity 35 Entity 35 polymer

Description description	Mitochondrial ribosomal protein L39
Molecular weight formula_weight	38523.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bc

MAMGAWGLRLWRAVPRGEAGWRLIATSPASQLSPTELIEMQNDLFNKEKNRQLSLTPRTEKIEVKHVGKTDPGTVFVMNKNISTPYSCAMHLSEWYCRKSILALVDGQPWDMYKPLTKSCEIKFLTFKDDDPGEVNKAYWRSCAMMMGCVIERAFKDEYVVSLVRAPEVPVIAGAFCYDVVLDKRLDEWMPTKENLHSFTKDARALIYKDLPFETLEVEAKVALEIFQHNKYKLDFIEEKASQNPERIVKLHRFGDFIDVSEGPLIPRTSICFQYEVSAVHNLQTQSSLVRRFQGLSLPVHLRAHFTIWNKLLERSRKMVTEDKTKPTEESAST

Entity 36 Entity 36 polymer

Description description	Mitochondrial ribosomal protein L40
Molecular weight formula_weight	24075.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bd

MAAAALGAASRTLRPASRLVGAWPTQTRDAHERGSLFSFWGLVPMRAEPLRKKKKVDPKKDQAAKDRLKKRIRRLEKASQELIPIEDFITPVKFLNKERQRPPVELPFEESERRALLLKRWSLYKQREHEMERSAIRSLLEAQEEALQELRLSSPELHAEATKRDPSLFPFERQGPDYTPPISDYQPPEGRYQDITKVYTQVEFKK

Entity 37 Entity 37 polymer

Description description	Mitochondrial ribosomal protein L41
Molecular weight formula_weight	15073.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Be

MGLLSGAARALVRGADRMSKWTSKRGPRTFCKGRGAKGTGFHGRDGKFVQIKEMIPELVVPELAGFKLKPYVNYRAPEGTDTPLTAKQLFLETAAPAIEKDFKAGTFDPEHLEKYGFEPTQEGKLFQLYPKNFPR

Entity 38 Entity 38 polymer

Description description	Mitochondrial ribosomal protein L42
Molecular weight formula_weight	16680.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bf

MALAAVKWVISSRTILKHLFPIQNSASYCVCHKSTYSSLPDDYNCKVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNIEETHDLVLKTRLEEKGEHLEQGPMIEQLSKMFFTTKHRWYPRGQYHRRRRKPNPPKDR

Entity 39 Entity 39 polymer

Description description	Mitochondrial ribosomal protein L43
Molecular weight formula_weight	17728.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bg

MTARGTASRFLTSVLHNGLGRYVQQLQRLSFSLSRDAPSSRGAREFVEREVTDFARRNPGVVIYVNPRPCCVPRVVAEYLNGAVREESIHCKSVEEIAALVQKLADQSGLDVIRIRKPFHTDSPSIQGQWHPFTNKPTTLGGLRPREVQDPAPAQVQAQ

Entity 40 Entity 40 polymer

Description description	Mitochondrial ribosomal protein L44
Molecular weight formula_weight	37527.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bh

MASGLVRLLQWGPRRLLAPAAPTLAPPVRGAKKGFRAAYRFQKELERWRLLRCPPPPVRRSEKPNWDYHAEIQAFGHRLQETFSLDLLKTAFVNSCYIKSEEAKRQKLGIDKEAALLNLKDNQELSEQGISFSQTCLTQFFEDAFPDLPTEGVTSLVDFLTSEEVVCHVARNLAVEQLALSAEFPVPPPVLRQTFFAVIGALLQSSGPERTALFIRDFLITQMTGKELFEMWTITNPMGLLVEELKKRKISAPESRLTRQSGSTTALPVYFVGLYCDRKLIAEGPGETVLVAEEEAARVALRKLFGFTENRRPWDYSKPKEHVRAEKTITAS

Entity 41 Entity 41 polymer

Description description	Mitochondrial ribosomal protein L45
Molecular weight formula_weight	35331.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bi

MAAPVTRGLSCLPRVLGWWSRQPVLVTQSTAVVPVRTKKRFTPPTYQPKYKSEKEFVEHARKAGLVIPHERLERPIHLACTAGIFDAYVPPEGDARISSLSKEGLAQRAERLKKNVASQLSIRKIRESDPNFKIKDFPEKAKDIFIEAHLCLNNSDHDRLHTLVTENCFPDMVWDIRYKTVRWSFVESLEPPQVVQVRCSSLMNQGNIYGQVTVRMHTRQTLAIYDRFGRLMYGQEDVPRDVLEYVVFEKHLVDPYGSWRMHGKIIPPWAPPKQPILKTVMIPGPQLKPWEEFEEPQGEVHKPQPA

Entity 42 Entity 42 polymer

Description description	Mitochondrial ribosomal protein L46
Molecular weight formula_weight	32216.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bj

MAAPVRRTMLRVVRGWRRFEGPWAHSLGSRNLALAVAPSSSSSPWRLLGALCLQRPPLVTKPLTPLQEEMADLLQQIEIERSLYSDHELRALDEAQQLAKKKSDLYEEEDEQNILLAQDLEDMWEQKFLHFKLGARLTEADKKDDRTSLHRKLDRNLILLVREKLGDQDIWMLPQSDWQPGETLRQTAERTLATLSENNMEAKFLGNAPCGHYKFKFPQAMRTETSLGAKVFFFKALLLTGDFSQAGKKGHHVWVSKEELGDYLKPKYLAQVRRFLLDL

Entity 43 Entity 43 polymer

Description description	Mitochondrial ribosomal protein L48
Molecular weight formula_weight	23749.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bk

MNGALGKALCLRNDTVLKQALSLIRVRASGESPICSAGGILLSTSRHYRSKPTHGIGRYKHLVKAQEPKKKKGKVEVRPINLGTDYEYGVLNIHLIAYDMALAESYAQYVHNLCNHLAIKVEESYAMPTKTMEVLQLQEQGSKMFLDAVLTTHERVVQISGLSATFAEIFLEIIHSNLPEGVKLSVREHTEEDFKGRFKARPELEELLAKLN

Entity 44 Entity 44 polymer

Description description	Mrpl34
Molecular weight formula_weight	18957.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bl

MAATVLCGVLRAWRTGVPLGCGLRRLSQTQGTPEYPSFVESVDEYHFVERLLPPASIPRPPKHEHYPTPSGWQPPRDPAPSLPYFVRRSRMHNIPVYRDITHGNRQMTVIRKVEGDIWALQKDVEDFLSPLLGKTPVTQVNEVTGTLRVKGYFDQQLKAWLLEKGF

Entity 45 Entity 45 polymer

Description description	Mitochondrial ribosomal protein L50
Molecular weight formula_weight	18351.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bm

MAARWVSGLARRSLTCAVSGAPRREFWSPFRKEKQPVVAETVEEVKKEPILVCPPIQSRTYIPPEDLQSRLESHVKEVFGSSVPSNWQDISLEDVHLKFSFLARLANDLRHAVPNSRLHQMCRVRDVLDFYNVPVQDRSKFDELIASNLPHNLKITWGY

Entity 46 Entity 46 polymer

Description description	Mitochondrial ribosomal protein L51
Molecular weight formula_weight	15249.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bn

MAGSLSWVTGRGLWGRLPLTCRSFSLGIPRLFHVRVTLPPRKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIKGPIWLRGWKGNELQRCIRKKRMVGNRMFIDDLHNLNKRISYLYKHFNRHGKYR

Entity 47 Entity 47 polymer

Description description	Mitochondrial ribosomal protein L52
Molecular weight formula_weight	13813.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bo

MAAWGILLSTGVRRLHCGTAAQAGSQWRLQQGFAANPSGYGPLTELPDWSYADGRPAPPMKGQLRRKAQREKFARRVVLLSQEMDAGLQAWQLRQQEKLQEEEGKQKNALKSKGALLQNPQPSQ

Entity 48 Entity 48 polymer

Description description	mL53, MRPL53
Molecular weight formula_weight	12015.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bp

MAAALARLGLRAVKQVRVQFCPFEKNVESTRTFLQAVSSEKVRCTNLNCSVIADVRHDGSEPCVDVLFGDGHRLIMRGAHLTAQEMLTAFASHIQARGAAGSGDKPSASTGR

Entity 49 Entity 49 polymer

Description description	Uncharacterized protein
Molecular weight formula_weight	15957.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bq

MAARRLFGAARSWAAWRAWELSDAAVSGRLHVRNYAKRPVIKGGKGGKGAVVGEALKDPEVCTDPFRLTTHAMGVNIYKEGQDVVLKPDSEYPEWLFEMNVGPPKKLEELDPETREYWRLLRKHNIWRHNRLSKNRKF

Entity 50 Entity 50 polymer

Description description	Mitochondrial ribosomal protein L57
Molecular weight formula_weight	12001.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bt

MFLTALLRRNRIPGRQWIGKHRRPRPVSAQAKQNMIRRLETEAENQYWLSRPFLTAEQERGHAAVRRAAAFQALKAAQAARFPAHRRLEEQLGHLLVTRKWS

Entity 51 Entity 51 polymer

Description description	Mitochondrial ribosomal protein L58
Molecular weight formula_weight	23545.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bu

MAAARCLRWGLNRAGAWLLPSPTRYPRRALHKQVEGTEFQSIYSLDKLYPESRGSDTAWRLPDDAKQANDIPVDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLASADWIAEPVRLKLAVKHKNRINRSGELILTSECSRYQFRNLADCLQKLRDMIAEASQPAKEPSREDAELRRSRIENMNRERLRKKRISSAIKTSRRVDVD

Entity 52 Entity 52 polymer

Description description	;'Mitochondrial ribosomal protein L59 ;
Molecular weight formula_weight	25815.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bv

MAAPVQQARTLLRLVTTLGQGSRGYRARPPPRRSQEPRWPDPDDPLTPRWQLSPRYAAKQFARHGAASGVAAGSLWPSQEQLRELEAEEREWYPSLAAMQESLRVQQLAEEQKRQAREQLIEECMAKMPQMIENWRQQQQERREKEQADKDRRARLQAEAQERLGYHVDPRSARFQELLQDMEKQHRKRLKEEKQRKKKEARAAAMAAAAAQDPADSETPSS

Entity 53 Entity 53 polymer

Description description	mL65, MRPS30
Molecular weight formula_weight	49100.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bw

MAAARCWRFPLRGAGLSLHTAAKAAVTAPEVTGPDVPATPVARYPPIVASLTAKSKAARQRRVEQWQATVHAAKSVDEKLRILTKMQFMKYVVYPQTFALNADNWYQSFTKTVFLSGLPPTPAKLEPEPTLDITALREAVCDCLLQEHFFLRRKKRAPVIQDREAIASPFLDQLVASLTGLLSVHNPVLAAAALDCKRPVHFFWLRGEEIIPRGHRKGRVDALRYQINDKPHNQIRISRQLPEFVPLDYSIPIEVPVMSCKPDKLPLFKRQYENTIFIGSKTADPLCYGHTQFHLLPDKLKREKLLKQNCADQIEVVFRANAIASLFAWTGAQAMYQGFWSEADVTRPFVSQGVITDGKYFSFFCYQLNTLALTAQADQNNPRKNICWGTQSKPLYETIEDNNVKGFNDDVLLQLVQFLLNRPKEDKSQLLEN

Entity 54 Entity 54 polymer

Description description	Mitochondrial ribosomal protein S18A
Molecular weight formula_weight	22273.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bx

MVGLNVLVSGCGRLLRGLLAGPAATSWARPPSRGFREVVEILDGKTTIIEGRITETPQESPNPPNPTGQCPICRWNLKHKYNYEDVLLLSQFIRPHGGMLPRRITGLCQEEHLKIEECVKMAHRAGLLPNHRPKLPEGFVPKSKPRLNRYLTRWSPRSVKPIYNKGHRWNKVRMPVGSPLLKDNVSYSGRPLLLYH

Entity 55 Entity 55 polymer

Description description	unassigned secondary structure elements
Molecular weight formula_weight	5846.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bz

AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Entity 56 Entity 56 polymer

Description description	P-site fMet-tRNAMet, mitochondrial
Molecular weight formula_weight	22664.5 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	AV

AGUAAGGUCAGCUAAAUAAGCUAUCGGGCCCAUACCCCGAAAAUGUUGGUUAUACCCUUCCCGUACUACCA

Entity 57 Entity 57 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	216

Entity 58 Entity 58 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 59 Entity 59 non-polymer

Description description	GUANOSINE-5'-MONOPHOSPHATE
Molecular weight formula_weight	363.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 60 Entity 60 non-polymer

Description description	SPERMINE
Molecular weight formula_weight	202.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 61 Entity 61 non-polymer

Description description	5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE
Molecular weight formula_weight	539.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 62 Entity 62 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 63 Entity 63 non-polymer

Description description	N-FORMYLMETHIONINE
Molecular weight formula_weight	177.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 64 Entity 64 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	2

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.20 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	75666

fit	/app/data/saxs_computation/gb/6gb2/6gb2.fit
pddf	/app/data/pr_computation/gb/6gb2/6gb2.pr.out
profile	/app/data/saxs_computation/gb/6gb2/6gb2.dat