SAXSdb — 5jv3

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chimera protein of Kinesin-like protein KIF11 and Microtubule-associated protein RP/EB family member 1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Homooligomer	Protein 2	water × 2	Consistent with protein count
2	Insufficient information	Homooligomer	Protein 2	CALCIUM ION × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	KIF11_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–28； UniProt 366–391 Author chain B； PDBConstruct 3–28； UniProt 366–391 Author chain C； PDBConstruct 3–28； UniProt 366–391 Author chain D； PDBConstruct 3–28； UniProt 366–391

Chimera protein of Kinesin-like protein KIF11 and Microtubule-associated protein RP/EB family member 1

Homo sapiens

UniProt Q15691

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Homooligomer	Protein 2	water × 2	Consistent with protein count
2	Insufficient information	Homooligomer	Protein 2	CALCIUM ION × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MARE1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 29–76； UniProt 210–257 Author chain B； PDBConstruct 29–76； UniProt 210–257 Author chain C； PDBConstruct 29–76； UniProt 210–257 Author chain D； PDBConstruct 29–76； UniProt 210–257

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5jv3
Deposition date deposition_date	2016-05-10
Structure title title	The neck-linker and alpha 7 helix of Homo sapiens Eg5 fused to EB1
Keywords keywords	kinesin, coiled-coil, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5jv3__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5jv3__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5jv3__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	20.58 Å
Rg (electron density)	20.82 Å
Total Rg	21.66 Å
Atom count	1097
Residues	131
Excluded volume	19645 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5jv3__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5jv3__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Chimera protein of Kinesin-like protein KIF11 and Microtubule-associated protein RP/EB family member 1
Molecular weight formula_weight	8955.2 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	2477

LSNQKLTKKALIKEYTEEIERLKRDLAALEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPD

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	260

▼

6. Fold Classification (SCOP + CATH) 9 domains

SCOP 2.08 (5 domains)

Domain ID domain_id	d5jv3a_
Class class	a — All alpha proteins
Fold Fold fold	a.245 — EB1 dimerisation domain-like
Superfamily Superfamily superfamily	a.245.1 — EB1 dimerisation domain-like
Family Family family	a.245.1.1 — EB1 dimerisation domain-like

Domain ID domain_id	d5jv3b_
Class class	a — All alpha proteins
Fold Fold fold	a.245 — EB1 dimerisation domain-like
Superfamily Superfamily superfamily	a.245.1 — EB1 dimerisation domain-like
Family Family family	a.245.1.1 — EB1 dimerisation domain-like

Domain ID domain_id	d5jv3c_
Class class	a — All alpha proteins
Fold Fold fold	a.245 — EB1 dimerisation domain-like
Superfamily Superfamily superfamily	a.245.1 — EB1 dimerisation domain-like
Family Family family	a.245.1.1 — EB1 dimerisation domain-like

Domain ID domain_id	d5jv3d1
Class class	a — All alpha proteins
Fold Fold fold	a.245 — EB1 dimerisation domain-like
Superfamily Superfamily superfamily	a.245.1 — EB1 dimerisation domain-like
Family Family family	a.245.1.1 — EB1 dimerisation domain-like

Domain ID domain_id	d5jv3d2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (4 domains)

Domain ID domain_id	5jv3A00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	1430 —

Domain ID domain_id	5jv3B00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	1430 —

Domain ID domain_id	5jv3C00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	1430 —

Domain ID domain_id	5jv3D00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	1430 —

▶

Unit-cell length a length_a	34.839 Å
Unit-cell length b length_b	59.502 Å
Unit-cell length c length_c	72.664 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	100.58 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.006 Å
Low-resolution limit resolution_low	30.622 Å
R factor r_factor	0.2170
R_work r_work	0.2154
R_free r_free	0.2472

The neck-linker and alpha 7 helix of Homo sapiens Eg5 fused to EB1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chimera protein of Kinesin-like protein KIF11 and Microtubule-associated protein RP/EB family member 1

State in the Current Structure

Other States of the Same Protein in the Database

Chimera protein of Kinesin-like protein KIF11 and Microtubule-associated protein RP/EB family member 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5jv3__assembly_1__model_1

5jv3__assembly_1__model_1 | I(q)

5jv3__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 9 domains

SCOP 2.08 (5 domains)

CATH v4.4 (4 domains)

7. Citations (1)

The neck-linker and alpha 7 helix of Homo sapiens Eg5 fused to EB1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chimera protein of Kinesin-like protein KIF11 and Microtubule-associated protein RP/EB family member 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chimera protein of Kinesin-like protein KIF11 and Microtubule-associated protein RP/EB family member 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5jv3__assembly_1__model_1

5jv3__assembly_1__model_1 | I(q)

5jv3__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 9 domains

SCOP 2.08 (5 domains)

CATH v4.4 (4 domains)

7. Citations (1)