SAXSdb — 5nl1

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Talin-1

Mus musculus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Invasin IpaA × 2 （P18010） 1,2-ETHANEDIOL × 1 water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Invasin IpaA × 2 （P18010） SULFATE ION × 1 water × 4	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 4	Invasin IpaA × 2 （P18010） CHLORIDE ION × 1 SULFATE ION × 2 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TLN1_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–156； UniProt 480–635 Author chain B； PDBConstruct 1–156； UniProt 480–635 Author chain C； PDBConstruct 1–156； UniProt 480–635 Author chain D； PDBConstruct 1–156； UniProt 480–635 Author chain E； PDBConstruct 1–156； UniProt 480–635 Author chain F； PDBConstruct 1–156； UniProt 480–635

Invasin IpaA

Shigella flexneri

UniProt P18010

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Talin-1 × 2 （P26039） 1,2-ETHANEDIOL × 1 water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Talin-1 × 2 （P26039） SULFATE ION × 1 water × 4	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 4	Talin-1 × 2 （P26039） CHLORIDE ION × 1 SULFATE ION × 2 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IPAA_SHIFL
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain G； PDBConstruct 22–46； UniProt 488–512 Author chain H； PDBConstruct 22–46； UniProt 488–512 Author chain I； PDBConstruct 22–46； UniProt 488–512 Author chain J； PDBConstruct 22–46； UniProt 488–512 Author chain K； PDBConstruct 22–46； UniProt 488–512 Author chain L； PDBConstruct 22–46； UniProt 488–512

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5nl1
Deposition date deposition_date	2017-04-03
Structure title title	Shigella IpaA-VBS3/TBS in complex with the Talin VBS1 domain 488-512
Keywords keywords	STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5nl1__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5nl1__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5nl1__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	21.95 Å
Rg (electron density)	21.02 Å
Total Rg	21.78 Å
Atom count	2378
Residues	329
Excluded volume	42106 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5nl1__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5nl1__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`5nl1__assembly_3__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Talin-1
Molecular weight formula_weight	16220.1 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F
Atom count atom_count	7396

MHRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFETLPPLGQDAASKAWRKNKMDESKHEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLEDEGGNGRPLLQAAKGLAGAVSELLRSAQPASAEPRQ

Source Source

Source organism organism	Mus musculus
Common name common_name	Mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Invasin IpaA
Molecular weight formula_weight	5028.7 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H,I,J,K,L

MGSSHHHHHHSSGLVPRGSHMTRETIFEASKKVTNSLSNLISLIGT

Source Source

Source organism organism	Shigella flexneri
NCBI taxonomy ID ncbi_taxonomy_id	623
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	140

▼

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	5nl1A00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1420 — A middle domain of Talin 1
Homologous superfamily homologous superfamily	10 — Talin, central domain

Domain ID domain_id	5nl1B00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1420 — A middle domain of Talin 1
Homologous superfamily homologous superfamily	10 — Talin, central domain

Domain ID domain_id	5nl1C00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1420 — A middle domain of Talin 1
Homologous superfamily homologous superfamily	10 — Talin, central domain

Domain ID domain_id	5nl1D00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1420 — A middle domain of Talin 1
Homologous superfamily homologous superfamily	10 — Talin, central domain

Domain ID domain_id	5nl1E00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1420 — A middle domain of Talin 1
Homologous superfamily homologous superfamily	10 — Talin, central domain

Domain ID domain_id	5nl1F00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1420 — A middle domain of Talin 1
Homologous superfamily homologous superfamily	10 — Talin, central domain

▶

Unit-cell length a length_a	66.260 Å
Unit-cell length b length_b	96.360 Å
Unit-cell length c length_c	175.690 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.500 Å
Low-resolution limit resolution_low	36.330 Å
R factor r_factor	0.1970
R_work r_work	0.1960
R_free r_free	0.2280

Shigella IpaA-VBS3/TBS in complex with the Talin VBS1 domain 488-512

1. Protein Identity and Related Structures Protein Identity & Related Structures

Talin-1

State in the Current Structure

Other States of the Same Protein in the Database

Invasin IpaA

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5nl1__assembly_1__model_1

5nl1__assembly_1__model_1 | I(q)

5nl1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)

Shigella IpaA-VBS3/TBS in complex with the Talin VBS1 domain 488-512

1. Protein Identity and Related Structures Protein Identity & Related Structures

Talin-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Invasin IpaA

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5nl1__assembly_1__model_1

5nl1__assembly_1__model_1 | I(q)

5nl1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)