4f7g

Crystal structure of talin autoinhibition complex

Method: X-RAY DIFFRACTION D_max: 84.9 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Talin-1

Mus musculus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 206–405 Chain B； UniProt 1654–1847	Fragment：F2F3 subdomain, UNP residues 206-405 Fragment：RS subdomain, UNP residues 1654-1847	No other associated polymer	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；289 K；18.5% (w/v) PEG 1500, 0.1 M MES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 289K X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；289 K；18.5% (w/v) PEG 1500, 0.1 M MES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 2.05 Å R-free 0.249

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4F7G	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1SJ7 Crystal Structure of Talin Rod 482-655 Deposited 2004-03-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 482–655（174 aa） Fragment：Residues 482-655	Not recorded	PT PLATINUM (II) ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；298 K；30% PEG 2000 MME, 0.1M Ammonium Acetate, 0.2M Ammonium Sulfate, pH 4.6, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.50 Å R-free 0.286
1SJ7 Crystal Structure of Talin Rod 482-655 Deposited 2004-03-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 482–655（174 aa） Fragment：Residues 482-655	Not recorded	PT PLATINUM (II) ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；298 K；30% PEG 2000 MME, 0.1M Ammonium Acetate, 0.2M Ammonium Sulfate, pH 4.6, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.50 Å R-free 0.286
1SJ7 Crystal Structure of Talin Rod 482-655 Deposited 2004-03-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 482–655（174 aa） Fragment：Residues 482-655	Not recorded	PT PLATINUM (II) ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；298 K；30% PEG 2000 MME, 0.1M Ammonium Acetate, 0.2M Ammonium Sulfate, pH 4.6, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.50 Å R-free 0.286
1SJ7 Crystal Structure of Talin Rod 482-655 Deposited 2004-03-03	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 482–655（174 aa） Fragment：Residues 482-655	Not recorded	PT PLATINUM (II) ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；298 K；30% PEG 2000 MME, 0.1M Ammonium Acetate, 0.2M Ammonium Sulfate, pH 4.6, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.50 Å R-free 0.286
1SJ7 Crystal Structure of Talin Rod 482-655 Deposited 2004-03-03	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 482–655（174 aa） Fragment：Residues 482-655 Chain B 482–655（174 aa） Fragment：Residues 482-655	Not recorded	PT PLATINUM (II) ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；298 K；30% PEG 2000 MME, 0.1M Ammonium Acetate, 0.2M Ammonium Sulfate, pH 4.6, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.50 Å R-free 0.286
1SJ8 Solution Structure of the R1R2 Domains of Talin Deposited 2004-03-03	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 482–789（308 aa） Fragment：Residues 482-789	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；295 K；0.1M Sodium Citrate, 20% PEG 6000, 0.1M MgCl2, pH 5.6, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 2.60 Å R-free 0.297
1T01 Vinculin complexed with the VBS1 helix from talin Deposited 2004-04-07	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 605–628（24 aa） Fragment：talin (vinculin binding site 1)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；293 K；30%PEG 5000, 0.1M MES, 0.2M Ammonium Sulphate, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K, pH 6.50	Resolution 2.06 Å R-free 0.303
1U89 Solution structure of VBS2 fragment of talin Deposited 2004-08-05	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 755–889（135 aa） Fragment：vbs2 domain	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；303 K；Ionic strength (raw mmCIF value) 20mM phosphate, 50mM NaCl；Pressure ambient NMR sample composition 1.5mM talin 755-889 U-15N, 13C; 20mM phosphate buffer, 20mM NaCl, 0.02% NaN3 \| 90% H2O/10% D2O NMR sample composition 1.5mM talin 755-889 U-15N, 13C; 20mM phosphate buffer, 20mM NaCl, 0.02% NaN3 \| 100% D2O NMR sample composition 1.5mM talin 755-889 U-15N; 20mM phosphate buffer, 20mM NaCl, 0.02% NaN3 \| 90% H2O/10% D2O NMR sample composition 1.5mM talin 755-889; 20mM phosphate buffer, 20mM NaCl, 0.02% NaN3 \| 100% D2O	Resolution not provided
1Y19 Structural basis for phosphatidylinositol phosphate kinase type I-gamma binding to talin at focal adhesions Deposited 2004-11-17	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 209–410（202 aa） Fragment：F2 AND F3 SUBDOMAINS OF THE FERM DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.2；277 K；0.1 M Na/K phosphte buffer, 35% MPD, pH 6.2, VAPOR DIFFUSION, temperature 277K	Resolution 2.60 Å R-free 0.286
1Y19 Structural basis for phosphatidylinositol phosphate kinase type I-gamma binding to talin at focal adhesions Deposited 2004-11-17	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 209–410（202 aa） Fragment：F2 AND F3 SUBDOMAINS OF THE FERM DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.2；277 K；0.1 M Na/K phosphte buffer, 35% MPD, pH 6.2, VAPOR DIFFUSION, temperature 277K	Resolution 2.60 Å R-free 0.286
1Y19 Structural basis for phosphatidylinositol phosphate kinase type I-gamma binding to talin at focal adhesions Deposited 2004-11-17	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 209–410（202 aa） Fragment：F2 AND F3 SUBDOMAINS OF THE FERM DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.2；277 K；0.1 M Na/K phosphte buffer, 35% MPD, pH 6.2, VAPOR DIFFUSION, temperature 277K	Resolution 2.60 Å R-free 0.286
1Y19 Structural basis for phosphatidylinositol phosphate kinase type I-gamma binding to talin at focal adhesions Deposited 2004-11-17	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 209–410（202 aa） Fragment：F2 AND F3 SUBDOMAINS OF THE FERM DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.2；277 K；0.1 M Na/K phosphte buffer, 35% MPD, pH 6.2, VAPOR DIFFUSION, temperature 277K	Resolution 2.60 Å R-free 0.286
1Y19 Structural basis for phosphatidylinositol phosphate kinase type I-gamma binding to talin at focal adhesions Deposited 2004-11-17	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain J 209–410（202 aa） Fragment：F2 AND F3 SUBDOMAINS OF THE FERM DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.2；277 K；0.1 M Na/K phosphte buffer, 35% MPD, pH 6.2, VAPOR DIFFUSION, temperature 277K	Resolution 2.60 Å R-free 0.286
1Y19 Structural basis for phosphatidylinositol phosphate kinase type I-gamma binding to talin at focal adhesions Deposited 2004-11-17	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 209–410（202 aa） Fragment：F2 AND F3 SUBDOMAINS OF THE FERM DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.2；277 K；0.1 M Na/K phosphte buffer, 35% MPD, pH 6.2, VAPOR DIFFUSION, temperature 277K	Resolution 2.60 Å R-free 0.286
1ZW3 Vinculin Head (0-258) in Complex with the Talin Rod residues 1630-1652 Deposited 2005-06-03	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1628–1652（25 aa） Fragment：Residues 1630-1652	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.1；293 K；1.2M NaH2PO4/0.8M K2HPO4, 100mM CAPS, pH 10.5, pH 6.1, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 3.30 Å R-free 0.307
2B0H Solution structure of VBS3 fragment of talin Deposited 2005-09-14	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1843–1973（131 aa） Fragment：residues 1843-1973	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 50 mM NaCl；Pressure ambient NMR sample composition 1.5 mM talin 1843-1973 [15N,13C]; 20 mM phosphate, (pH 6.5), 50 mM NaCl, 2 mM DTT, 90% H2O, 10% D2O \| 90% H2O/10% D2O NMR sample composition 1.5 mM talin 1843-1973 [15N,13C]; 20 mM phosphate, (pH 6.5), 50 mM NaCl, 2 mM DTT, 100% D2O \| 100% D2O NMR sample composition 1.0 mM talin 1843-1973 [15N]; 20 mM phosphate, (pH 6.5), 50 mM NaCl, 2 mM DTT, 90% H2O, 10% D2O \| 90% H2O/10% D2O NMR sample composition 1.0 mM talin 1843-1973; 20 mM phosphate, (pH 6.5), 50 mM NaCl, 2 mM DTT, 90% H2O, 10% D2O \| 90% H2O/10% D2O	Resolution not provided
2G35 NMR structure of talin-PTB in complex with PIPKI Deposited 2006-02-17	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 305–404（100 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.3；298 K NMR sample composition 20mM phosphate buffer, 5mM Ca2+, PH 6.3, 10% D2O, 90% H2O \| 10% D2O, 90% H2O	Resolution not provided
2JSW Solution Structure of the R13 Domain of Talin Deposited 2007-07-17	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2300–2482（183 aa） Fragment：Talin1 residues 2300-2482	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6；318 K；Ionic strength (raw mmCIF value) 50；Pressure ambient NMR sample composition 1 mM Talin c-terminal actin binding site (ABS3), 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1 mM [U-15N] Talin c-terminal actin binding site (ABS3), 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1 mM [U-13C; U-15N] Talin c-terminal actin binding site (ABS3), 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2KBB Solution Structure of the R9 Domain of Talin Deposited 2008-11-24	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1655–1822（168 aa） Fragment：RESIDUES 1655-1822	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；308 K；Ionic strength (raw mmCIF value) 50；Pressure AMBIENT NMR sample composition 1 mM [U-100% 15N] TALIN-1, 10 % [U-100% 2H] D2O, 50 mM sodium chloride, 2 mM DTT, 50 mM sodium phosphate, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1 mM [U-100% 13C; U-100% 15N] TALIN-1, 10 % [U-100% 2H] D2O, 50 mM sodium chloride, 2 mM DTT, 50 mM sodium phosphate, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2KC2 NMR structure of the F1 domain (residues 86-202) of the talin Deposited 2008-12-13	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 86–202（117 aa） Fragment：F1 domain (residues 86-202)	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 50；Pressure ambient NMR sample composition 0.6 mM [U-100% 13C; U-100% 15N] F1-1, 10 % [U-100% 2H] D2O-2, 2 mM DTT-3, 50 mM sodium chloride-4, 20 mM sodium phosphate-5, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.6 mM [U-100% 15N] F1-6, 10 % [U-100% 2H] D2O-7, 2 mM DTT-8, 50 mM sodium chloride-9, 20 mM sodium phosphate-10, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2KGX HADDOCK structure of the talin F3 domain in complex with talin 1655-1822 Deposited 2009-03-23	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1655–1822（168 aa）	Mutation：C336S	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 50；Pressure ambient NMR sample composition 0.5 mM [U-100% 15N] 1655-1822, 2 mM F3, 50 mM sodium chloride, 20 mM sodium phosphate, 2 mM DTT, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.5 mM 1655-1822, 2 mM [U-100% 15N] F3, 50 mM sodium chloride, 20 mM sodium phosphate, 2 mM DTT, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2KVP Solution Structure of the R10 Domain of Talin Deposited 2010-03-24	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1815–1973（159 aa） Fragment：VBS3 DOMAIN (UNP RESIDUES 1815-1973)	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；303 K；Ionic strength (raw mmCIF value) 50；Pressure AMBIENT NMR sample composition 1 mM [U-100% 15N] TALIN-1, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1 mM [U-100% 13C; U-100% 15N] TALIN-1, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2L10 Solution Structure of the R6 Domain of Talin Deposited 2010-07-22	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1206–1357（152 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 50；Pressure ambient NMR sample composition 1 mM [U-100% 15N] C-1, 5 % [U-100% 2H] D2O-2, 2 mM DTT-3, 50 mM sodium chloride-4, 20 mM TRIS-5, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1 mM [U-100% 13C; U-100% 15N] C-6, 5 % [U-100% 2H] D2O-7, 2 mM DTT-8, 50 mM sodium chloride-9, 20 mM TRIS-10, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2L7A Solution Structure of the R3 Domain of Talin Deposited 2010-12-06	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 787–911（125 aa） Fragment：Vbs2b domain, residues 787-911	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 50；Pressure ambient NMR sample composition 1 mM [U-100% 15N] Vbs2b-1; 10 % [U-100% 2H] D2O-2; 50 mM sodium chloride-3; 2 mM DTT-4, 20 mM TRIS-5; 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1 mM [U-100% 13C; U-100% 15N] Vbs2b-6; 10 % [U-100% 2H] D2O-7; 50 mM sodium chloride-8; 2 mM DTT-9; 20 mM TRIS-10, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1 mM [U-100% 15N] Vbs2b-11, 100 % [U-100% 2H] D2O-12; 50 mM sodium chloride-13; 2 mM DTT-14; 20 mM TRIS-15; 100% D2O \| 100% D2O	Resolution not provided
2L7N Solution Structure of the R5 Domain of Talin Deposited 2010-12-14	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1046–1207（162 aa） Fragment：sequence database residues 1046-1207	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 50；Pressure ambient NMR sample composition 1 mM [U-100% 15N] DomB, 10 % [U-100% 2H] D2O, 90 % H2O, 2 mM DTT, 50 mM sodium chloride, 20 mM sodium phosphate, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1 mM [U-100% 13C; U-100% 15N] DomB, 10 % [U-100% 2H] D2O, 90 % H2O, 2 mM DTT, 50 mM sodium chloride, 20 mM sodium phosphate, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2LQG Solution Structure of the R4 domain of talin Deposited 2012-03-06	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 913–1044（132 aa） Fragment：UNP residues 913-1044	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 50；Pressure ambient NMR sample composition 0.8 mM [U-100% 15N] Domain A, 10 % [U-100% 2H] D2O, 50 mM sodium chloride, 20 mM sodium phosphate, 2 mM DTT, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.8 mM [U-100% 13C; U-100% 15N] Domain A, 10 % [U-100% 2H] D2O, 50 mM sodium chloride, 20 mM sodium phosphate, 2 mM DTT, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2QDQ Crystal structure of the talin dimerisation domain Deposited 2007-06-21	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2494–2541（48 aa） Fragment：Reidues 2494-2541, dimerization domain Chain B 2494–2541（48 aa） Fragment：Reidues 2494-2541, dimerization domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.2；292 K；100 mM Citrate buffer (pH 4.2), 11% (w/v) PEG 3000, 200 mM Sodium Chloride, VAPOR DIFFUSION, SITTING DROP, temperature 292K	Resolution 2.20 Å R-free 0.315
2X0C Crystal Structure of the R7R8 domains of Talin Deposited 2009-12-08	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1359–1659（301 aa） Fragment：RESIDUES 1359-1659	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；18% PEG 8K, 100MM TRIS, 180MM SODIUM PHOSPHATE DIBASIC, PH 8.5	Resolution 2.00 Å R-free 0.264
3DYJ Crystal Structure of the R11R12 Domains of Talin Deposited 2008-07-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1974–2293（320 aa） Fragment：TALIN ROD (UNP RESIDUES:1974-2293)	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；10% PEG 8000, 1% PEG 3350, 100MM HEPES (PH 7.5), 10MM SODIUM THIOCYANATE, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 273K, pH 7.50, temperature 293K	Resolution 1.85 Å R-free 0.260
3DYJ Crystal Structure of the R11R12 Domains of Talin Deposited 2008-07-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1974–2293（320 aa） Fragment：TALIN ROD (UNP RESIDUES:1974-2293)	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；10% PEG 8000, 1% PEG 3350, 100MM HEPES (PH 7.5), 10MM SODIUM THIOCYANATE, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 273K, pH 7.50, temperature 293K	Resolution 1.85 Å R-free 0.260
3IVF Crystal structure of the talin head FERM domain Deposited 2009-09-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–400（400 aa） Fragment：N-terminal FERM domain, UNP residues 1-400	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.4；277 K；21% PEG4000, 0.1M Tris, 0.2M ammonium sulphate, pH7.4, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 1.94 Å R-free 0.257
3S90 Human vinculin head domain Vh1 (residues 1-252) in complex with murine talin (VBS33; residues 1512-1546) Deposited 2011-05-31	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1512–1546（35 aa） Fragment：unp residues 1512-1546	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.3；277 K；0.1 M citrate 5.3, 15% (w/v) PEG 10K, 1.5% (v/v) dioxane, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.97 Å R-free 0.210
3S90 Human vinculin head domain Vh1 (residues 1-252) in complex with murine talin (VBS33; residues 1512-1546) Deposited 2011-05-31	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1512–1546（35 aa） Fragment：unp residues 1512-1546	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.3；277 K；0.1 M citrate 5.3, 15% (w/v) PEG 10K, 1.5% (v/v) dioxane, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.97 Å R-free 0.210
4W8P Crystal structure of RIAM TBS1 in complex with talin R7R8 domains Deposited 2014-08-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1357–1657（301 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；100 mM NaCl, 20% (w/v) polyethylene glycol 3350 and 20% (v/v) ethylene glycol	Resolution 1.50 Å R-free 0.242
4W8P Crystal structure of RIAM TBS1 in complex with talin R7R8 domains Deposited 2014-08-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1357–1657（301 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；100 mM NaCl, 20% (w/v) polyethylene glycol 3350 and 20% (v/v) ethylene glycol	Resolution 1.50 Å R-free 0.242
5FZT The crystal structure of R7R8 in complex with a DLC1 fragment. Deposited 2016-03-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1359–1659（301 aa） Fragment：R7R8, UNP RESIDUES 1359-1659	Not recorded	MLI MALONATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.4；15% ETHANOL, 0.1 M TRIS PH 7.4 AT 4OC	Resolution 2.10 Å R-free 0.231
5IC0 Structural analysis of a talin triple domain module Deposited 2016-02-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1357–1822（466 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M MES pH6.5, 21% (w/v) PEG 3350, 2% (w/v) benzamidine hydrochloride	Resolution 1.97 Å R-free 0.230
5IC1 Structural analysis of a talin triple domain module, E1794Y, E1797Y, Q1801Y mutant Deposited 2016-02-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1357–1822（466 aa）	Mutation：E1794Y, E1797Y, Q1801Y	EDO 1,2-ETHANEDIOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.2 M potassium phosphate, 20% (w/v) PEG 3350	Resolution 2.20 Å R-free 0.249
5NL1 Shigella IpaA-VBS3/TBS in complex with the Talin VBS1 domain 488-512 Deposited 2017-04-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 480–635（156 aa） Fragment：UNP residues 480-635 Chain B 480–635（156 aa） Fragment：UNP residues 480-635	Not recorded	EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；292 K；0.2 M ammonium sulfate 0.1 M sodium acetate pH 4.6 30 % PEG 4000	Resolution 2.50 Å R-free 0.228
5NL1 Shigella IpaA-VBS3/TBS in complex with the Talin VBS1 domain 488-512 Deposited 2017-04-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 480–635（156 aa） Fragment：UNP residues 480-635 Chain E 480–635（156 aa） Fragment：UNP residues 480-635	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；292 K；0.2 M ammonium sulfate 0.1 M sodium acetate pH 4.6 30 % PEG 4000	Resolution 2.50 Å R-free 0.228
5NL1 Shigella IpaA-VBS3/TBS in complex with the Talin VBS1 domain 488-512 Deposited 2017-04-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 480–635（156 aa） Fragment：UNP residues 480-635 Chain F 480–635（156 aa） Fragment：UNP residues 480-635	Not recorded	CL CHLORIDE ION × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；292 K；0.2 M ammonium sulfate 0.1 M sodium acetate pH 4.6 30 % PEG 4000	Resolution 2.50 Å R-free 0.228
6BA6 Solution structure of Rap1b/talin complex Deposited 2017-10-12	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–86（86 aa） Fragment：F0 domain	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.6；301 K；Ionic strength (raw mmCIF value) 50mM NaCl, 5mM MgCl2；Pressure 101325 NMR measurement conditions pH 6.6；301 K；Ionic strength (raw mmCIF value) 50mM NaCl, 5mM MgCl2；Pressure 101325 NMR sample composition 0.6 mM [U-13C; U-15N] Rap1b, 0.9 mM talin-F0, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 0.5 mM [U-13C; U-15N] talin-F0, 0.7 mM Rap1b, 95% H20, 5% D2O \| 95% H20, 5% D2O NMR sample composition 0.5 mM [U-15N; U-2H] talin-F0, 0.7 mM Rap1b, 95% H20, 5% D2O \| 95% H20, 5% D2O NMR sample composition 0.5 mM [U-13C; U-15N] talin-F0, 0.7 mM Rap1b, 0.2% H20, 99.8% D20 \| 0.2% H20, 99.8% D20 NMR sample composition 0.6 mM [U-13C; U-15N] Rap1b, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
6MFS Mouse talin1 residues 1-138 fused to residues 169-400 in complex with phosphatidylinositol 4,5-bisphosphate (PIP2) Deposited 2018-09-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–138（138 aa） Fragment：FERM domain Chain A 169–400（232 aa） Fragment：FERM domain	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 1 PO4 PHOSPHATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；18-25% PEG 3350, 200 mM Ammonium citrate pH 7.0	Resolution 2.85 Å R-free 0.290
6TWN Crystal structure of Talin1 R7R8 in complex with CDK1 (206-223) Deposited 2020-01-13	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1359–1659（301 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；277 K；0.1M Na citrate pH 5.6, 20% Isopropanol and 20% PEG4K	Resolution 2.28 Å R-free 0.262
6TWN Crystal structure of Talin1 R7R8 in complex with CDK1 (206-223) Deposited 2020-01-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1359–1659（301 aa）	Not recorded	GOL GLYCEROL × 2 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；277 K；0.1M Na citrate pH 5.6, 20% Isopropanol and 20% PEG4K	Resolution 2.28 Å R-free 0.262
6VGU Crystal structure of FERM-folded talin head domain bound to the NPLY motif of beta3-integrin Deposited 2020-01-09	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–430（430 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.2 M sodium chloride 0.1 M MES pH6.5 10 % w/v PEG 4000	Resolution 2.78 Å R-free 0.263
7V1A Stapled TBS peptide from RIAM bound to talin R7R8 domains Deposited 2022-05-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1357–1657（301 aa） Fragment：R7R8 domain	Not recorded	EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；293 K；100 mM NaCl, 20% (w/v) polyethylene glycol 3350 and 20% (v/v) ethylene glycol.	Resolution 1.84 Å R-free 0.254
7ZW4 Crystal structure of Talin R7R8 domains with Caskin-2 LD-peptide Deposited 2022-05-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1358–1659（302 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；0.1 M bis-Tris propane pH 7.0, 0.1 M NaBr and 24% PEG3350	Resolution 2.72 Å R-free 0.269
8AS9 Crystal structure of the talin-KANK1 complex Deposited 2022-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1359–1659（301 aa）	Not recorded	SO4 SULFATE ION × 12 GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；277.15 K；1M Ammonium sulfate, 0.1M CHES 9.5, 0.2M Sodium chloride, 6 % (v/v) Glycerol	Resolution 3.40 Å R-free 0.285
8FSE Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain Deposited 2023-01-09	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–430（430 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；300 K；PEG4000 16%, NaCl 0.1M, DTT 2mM	Resolution 1.90 Å R-free 0.220
8FSE Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain Deposited 2023-01-09	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–430（430 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；300 K；PEG4000 16%, NaCl 0.1M, DTT 2mM	Resolution 1.90 Å R-free 0.220
8FSO Crystal structure of integrin beta-6 tail bound to the FERM-folded talin head domain Deposited 2023-01-10	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–430（430 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；300 K；PEG3350 20%, NaCl 0.1M, DTT 2mM	Resolution 2.33 Å R-free 0.252
8FTB Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain with a K306Q mutation Deposited 2023-01-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–430（430 aa）	Mutation：K306Q	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；300 K；PEG4000 15%, NaCl 0.1M, DTT 2mM	Resolution 1.97 Å R-free 0.211
8IVZ Crystal structure of talin R7 in complex with KANK1 KN motif Deposited 2023-03-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1357–1653（297 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；289 K；25% w/v pentaerythritol ethoxylate, 50 mM Magnesium chloride, 10 mM Tris pH8.5	Resolution 2.80 Å R-free 0.264
8IVZ Crystal structure of talin R7 in complex with KANK1 KN motif Deposited 2023-03-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1357–1653（297 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；289 K；25% w/v pentaerythritol ethoxylate, 50 mM Magnesium chloride, 10 mM Tris pH8.5	Resolution 2.80 Å R-free 0.264
8T0A Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain with a Y270E mutation Deposited 2023-05-31	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–430（430 aa）	Mutation：Y270E	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；300 K；PEG4000 15%, NaCl 0.1M, DTT 2mM	Resolution 2.14 Å R-free 0.230
8T0D Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain with E269A/Y270A/K306Q triple mutation Deposited 2023-05-31	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–430（430 aa）	Mutation：E269A,Y270A,K306Q	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；PEG4000 15%, NaCl 0.1M, DTT 2mM	Resolution 2.77 Å R-free 0.243
8VDO Cryogenic electron microscopy model of full-length talin lacking F2, R12 and FABD. Deposited 2023-12-16	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–2541（2541 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
8VDP Cryogenic electron microscopy model of full-length talin without FABD Deposited 2023-12-17	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–2541（2541 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8VDQ Cryogenic electron microscopy model of full-length talin Deposited 2023-12-17	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–2541（2541 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.50 Å
8VDR Cryogenic electron microscopy model of full-length talin without R12 and FABD Deposited 2023-12-17	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–2541（2541 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
9AZ6 F-actin-Talin(R13-DD) complex Deposited 2024-03-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 13 PDB declaration: tridecameric	Chain F 2301–2541（241 aa） Fragment：C-terminal fragment (Domains R13-DD) Chain G 2301–2541（241 aa） Fragment：C-terminal fragment (Domains R13-DD) Chain H 2301–2541（241 aa） Fragment：C-terminal fragment (Domains R13-DD) Chain I 2301–2541（241 aa） Fragment：C-terminal fragment (Domains R13-DD) Chain J 2301–2541（241 aa） Fragment：C-terminal fragment (Domains R13-DD) Chain K 2301–2541（241 aa） Fragment：C-terminal fragment (Domains R13-DD) Chain L 2301–2541（241 aa） Fragment：C-terminal fragment (Domains R13-DD) Chain M 2301–2541（241 aa） Fragment：C-terminal fragment (Domains R13-DD)	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 5 MG MAGNESIUM ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；3.0 ul sample, blotted for 5 s from both sides with filter paper Whatman No.1	Resolution 2.98 Å
9C1T Crystal structure of integrin beta-3 tail bound to the FERM-folded talin head domain with a D397R mutation Deposited 2024-05-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–430（430 aa）	Mutation：D397R	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；0.2 M sodium chloride, 0.1 M MES pH6.5, 10 % w/v PEG 4000	Resolution 2.30 Å R-free 0.267
9DZ5 Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain with a D397R mutation Deposited 2024-10-15	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–430（430 aa）	Mutation：D397R	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；300 K；PEG4000 16%, NaCl 0.1M, DTT 2mM	Resolution 1.74 Å R-free 0.224
9QN7 Structure of talin in complex with a peptide fragment Deposited 2025-03-24	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1974–2293（320 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.4；294.15 K；0.9M sodium potassium tartrate tetrathydrate, 20% w/v glycerol, 0.05M HEPES pH 7.4	Resolution 2.76 Å R-free 0.296
9QN7 Structure of talin in complex with a peptide fragment Deposited 2025-03-24	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1974–2293（320 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.4；294.15 K；0.9M sodium potassium tartrate tetrathydrate, 20% w/v glycerol, 0.05M HEPES pH 7.4	Resolution 2.76 Å R-free 0.296
9QT7 Crystal structure of affitin C10 fused to a coiled-coil domain in complex with a quinoline oligoamide foldamer Deposited 2025-04-08	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 2498–2529（32 aa） Chain B 2498–2529（32 aa） Chain C 2498–2529（32 aa） Chain D 2498–2529（32 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；20% PEG 400 0.1M Sodium cacodylate pH 6.5	Resolution 2.80 Å R-free 0.296
9QT7 Crystal structure of affitin C10 fused to a coiled-coil domain in complex with a quinoline oligoamide foldamer Deposited 2025-04-08	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2498–2529（32 aa） Chain D 2498–2529（32 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；20% PEG 400 0.1M Sodium cacodylate pH 6.5	Resolution 2.80 Å R-free 0.296
9QT7 Crystal structure of affitin C10 fused to a coiled-coil domain in complex with a quinoline oligoamide foldamer Deposited 2025-04-08	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 2498–2529（32 aa） Chain C 2498–2529（32 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；20% PEG 400 0.1M Sodium cacodylate pH 6.5	Resolution 2.80 Å R-free 0.296
9SR0 Mouse vinculin head domain 1 (VD1) (residues 2-258) with A50I mutation in complex with mouse talin 1 helix 50 (H50, residues 2072-2103) Deposited 2025-09-23	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 2072–2103（32 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；292.15 K；100 mM Bis-tris pH 6.0, 15% PEG 3350	Resolution 1.49 Å R-free 0.235

50 other PDB entries and 70 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TLN1_MOUSE
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 23–222； UniProt 206–405 Author chain B； PDBConstruct 23–216； UniProt 1654–1847

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4f7g
Deposition date deposition_date	2012-05-16
Structure title title	Crystal structure of talin autoinhibition complex
Keywords keywords	alpha-helix bundle, integrin activation, CELL ADHESION; CELL ADHESION
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	26.71 Å
Radius of gyration Rg (electron density) rg_electron	26.12 Å
Forward intensity I(0) i0	26748500.00
Molecular weight molecular_weight	39821.0 kDa
Excluded volume excluded_volume	49951 Å³
Envelope volume envelope_volume	63429 Å³
Hydration-shell volume shell_volume	21779 Å³
Envelope diameter envelope_diameter	87.4 Å
Shell Rg shell_rg	31.46 Å
Envelope Rg envelope_rg	25.97 Å
Shape Rg shape_rg	26.13 Å
Total Rg total_rg	26.74 Å
Total atoms total_atoms	2797
Residues n_residues	362
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	84.9 Å
Rg (real space) rg_real	26.85 Å
Rg uncertainty (real space) rg_real_error	0.64 Å
I(0) (real space) i0_real	2.6750e+07
I(0) uncertainty (real space) i0_real_error	4.1800e+05
Rg (reciprocal space) rg_reciprocal	26.81 Å
I(0) (reciprocal space) i0_reciprocal	26750000.0000
Solution quality estimate total_estimate	0.8802
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	23.0 Å
Skewness Skewness skewness	0.371
Kurtosis Kurtosis kurtosis	-0.626
Angular range angular_range	— – 0.2950 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	5118000.0000
Real-space data points n_real_points	60
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.915; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.785; Smooth: 0.909

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Talin-1
Molecular weight formula_weight	25613.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	2906

MHHHHHHSSGVDLGTENLYFQSSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKS

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Talin-1
Molecular weight formula_weight	22859.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MHHHHHHSSGVDLGTENLYFQSKAPGQLECETAIAALNSCLRDLDQASLAAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLASAARAEASQLGHKVSQMAQYFEPLTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGDPE

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	109

▼

7. Fold Classification (SCOP + CATH) 5 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d4f7ga1
Class class	a — All alpha proteins
Fold Fold fold	a.11 — Acyl-CoA binding protein-like
Superfamily Superfamily superfamily	a.11.2 — Second domain of FERM
Family Family family	a.11.2.1 — Second domain of FERM

Domain ID domain_id	d4f7ga2
Class class	b — All beta proteins
Fold Fold fold	b.55 — PH domain-like barrel
Superfamily Superfamily superfamily	b.55.1 — PH domain-like
Family Family family	b.55.1.5 — Third domain of FERM

CATH v4.4 (3 domains)

Domain ID domain_id	4f7gA01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	80 — Acyl-CoA Binding Protein
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	4f7gA02
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	29 — PH-domain like
Homologous superfamily homologous superfamily	30 — Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)

Domain ID domain_id	4f7gB00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1420 — A middle domain of Talin 1
Homologous superfamily homologous superfamily	10 — Talin, central domain

▶

8. Citations (1)

▶

Unit-cell length a length_a	36.665 Å
Unit-cell length b length_b	86.876 Å
Unit-cell length c length_c	113.629 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.050 Å
Low-resolution limit resolution_low	69.020 Å
R factor r_factor	0.2124
R_work r_work	0.2104
R_free r_free	0.2490

fit	/app/data/saxs_computation/f7/4f7g/4f7g.fit
pddf	/app/data/pr_computation/f7/4f7g/4f7g.pr.out
profile	/app/data/saxs_computation/f7/4f7g/4f7g.dat

Crystal structure of talin autoinhibition complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Talin-1

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 water

7. Fold Classification (SCOP + CATH) 5 domains

SCOP 2.08 (2 domains)

CATH v4.4 (3 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)