← Back to search

9qn7

Structure of talin in complex with a peptide fragment

Method: X-RAY DIFFRACTION D_max: 120.5 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9qn7
deposition_date	2025-03-24
title	Structure of talin in complex with a peptide fragment
keywords	talin, tensin3, phase seperation, adhesion, CELL ADHESION; CELL ADHESION
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	36.27 Å
rg_electron	35.91 Å
i0	83589700.00
molecular_weight	72459.0 kDa
excluded_volume	90652 Å³
envelope_volume	128390 Å³
shell_volume	31044 Å³
envelope_diameter	127.0 Å
shell_rg	40.88 Å
envelope_rg	34.77 Å
shape_rg	35.92 Å
total_rg	36.25 Å
total_atoms	5076
n_residues	684
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	120.5 Å
rg_real	36.28 Å
rg_real_error	1.16 Å
i0_real	8.3590e+07
i0_real_error	1.2970e+06
rg_reciprocal	36.28 Å
i0_reciprocal	83590000.0000
total_estimate	0.8530
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	52.0 Å
skewness	0.193
kurtosis	-0.458
angular_range	— – 0.2200 Å⁻¹
current_alpha	0.0000
highest_alpha	4422000.0000
n_real_points	45
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.785; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.927; Smooth: 0.801

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	Talin-1
formula_weight	34726.6 kDa
src_method	man
entity_count	2

Polymer

type	polypeptide(L)
strand_id	A,B
atom_count	5102

GTFTGIDPFTGTQACITAASAVSGIIADLDTTIMFATAGTLNREGAETFADHREGILKTAKVLVEDTKVLVQNAAGSQEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKAAAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVFCSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACKEAAFHPEVAPDVRLRALHYGRECANGYLELLDHVLLTLQKPNPDLKQQLTGHSKRVAGSVTELIQAAEAMKGT

Source

organism	Mus musculus
common_name	house mouse
ncbi_taxonomy_id	10090
host_organism	Escherichia coli

Entity 2 polymer

description	Tensin-3
formula_weight	3125.5 kDa
ec_number	3.1.3.-
src_method	syn
entity_count	2

Polymer

type	polypeptide(L)
strand_id	C,D

TLDIDQSIEQLNRLILELDPTFEPIPT

Entity 3 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	21

▶

6. Citations (1)

▶

length_a	84.940 Å
length_b	84.940 Å
length_c	346.330 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	16

space_group	P 43 21 2
int_tables_number	96
crystal_system	tetragonal

resolution	2.760 Å
resolution_low	76.260 Å
r_factor	0.2589
r_work	0.2570
r_free	0.2958

fit	/app/data/saxs_computation/qn/9qn7/9qn7.fit
pddf	/app/data/pr_computation/qn/9qn7/9qn7.pr.out
profile	/app/data/saxs_computation/qn/9qn7/9qn7.dat

Structure of talin in complex with a peptide fragment

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction

5. Entities & Polymer Info (3)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Entity 3 water

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)