SAXSdb — 1sj7

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Talin 1

Mus musculus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	PLATINUM (II) ION × 2 water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	PLATINUM (II) ION × 3 water × 1	Consistent with protein count
3	Protein monomer	Monomer	Protein 1	PLATINUM (II) ION × 2 water × 1	Consistent with protein count
4	Protein homooligomer	Homooligomer	Protein 2	PLATINUM (II) ION × 4 water × 2	Consistent with protein count
5	Protein homooligomer	Homooligomer	Protein 2	PLATINUM (II) ION × 5 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TLN1_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–174； UniProt 482–655 Author chain B； PDBConstruct 1–174； UniProt 482–655 Author chain C； PDBConstruct 1–174； UniProt 482–655

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1sj7
Deposition date deposition_date	2004-03-03
Structure title title	Crystal Structure of Talin Rod 482-655
Keywords keywords	STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1sj7__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1sj7__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1sj7__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.63 Å
Rg (electron density)	18.08 Å
Total Rg	18.76 Å
Atom count	1197
Residues	167
Excluded volume	21033 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1sj7__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1sj7__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`1sj7__assembly_3__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`1sj7__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`1sj7__assembly_5__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Talin 1
Molecular weight formula_weight	17957.0 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	3731

RGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFETLPPLGQDAASKAWRKNKMDESKHEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLEDEGGNGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQI

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli BL21

Entity 2 Entity 2 non-polymer

Description description	PLATINUM (II) ION
Molecular weight formula_weight	195.1 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	130

▼

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d1sj7a1
Class class	a — All alpha proteins
Fold Fold fold	a.215 — A middle domain of Talin 1
Superfamily Superfamily superfamily	a.215.1 — A middle domain of Talin 1
Family Family family	a.215.1.1 — A middle domain of Talin 1

Domain ID domain_id	d1sj7b1
Class class	a — All alpha proteins
Fold Fold fold	a.215 — A middle domain of Talin 1
Superfamily Superfamily superfamily	a.215.1 — A middle domain of Talin 1
Family Family family	a.215.1.1 — A middle domain of Talin 1

Domain ID domain_id	d1sj7c1
Class class	a — All alpha proteins
Fold Fold fold	a.215 — A middle domain of Talin 1
Superfamily Superfamily superfamily	a.215.1 — A middle domain of Talin 1
Family Family family	a.215.1.1 — A middle domain of Talin 1

CATH v4.4 (3 domains)

Domain ID domain_id	1sj7A00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1420 — A middle domain of Talin 1
Homologous superfamily homologous superfamily	10 — Talin, central domain

Domain ID domain_id	1sj7B00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1420 — A middle domain of Talin 1
Homologous superfamily homologous superfamily	10 — Talin, central domain

Domain ID domain_id	1sj7C00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1420 — A middle domain of Talin 1
Homologous superfamily homologous superfamily	10 — Talin, central domain

▶

Unit-cell length a length_a	95.662 Å
Unit-cell length b length_b	95.662 Å
Unit-cell length c length_c	115.215 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	18

Space group space_group	P 32 2 1
Space-group number int_tables_number	154
Crystal system crystal_system	—

Resolution resolution	2.500 Å
Low-resolution limit resolution_low	28.163 Å
R factor r_factor	—
R_work r_work	0.2411
R_free r_free	0.2862

Crystal Structure of Talin Rod 482-655

1. Protein Identity and Related Structures Protein Identity & Related Structures

Talin 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1sj7__assembly_1__model_1

1sj7__assembly_1__model_1 | I(q)

1sj7__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

CATH v4.4 (3 domains)

7. Citations (1)

Crystal Structure of Talin Rod 482-655

1. Protein Identity and Related Structures Protein Identity & Related Structures

Talin 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1sj7__assembly_1__model_1

1sj7__assembly_1__model_1 | I(q)

1sj7__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

CATH v4.4 (3 domains)

7. Citations (1)