← Back to search

9sr0

;Mouse vinculin head domain 1 (VD1) (residues 2-258) with A50I mutation in complex with mouse talin 1 helix 50 (H50, residues 2072-2103) ;

Method: X-RAY DIFFRACTION D_max: 98.5 Å Quality: REASONABLE

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9sr0
deposition_date	2025-09-23
last_revision	2026-05-20
title	;Mouse vinculin head domain 1 (VD1) (residues 2-258) with A50I mutation in complex with mouse talin 1 helix 50 (H50, residues 2072-2103) ;
keywords	vinculin, talin, vinculin binding site, focal adhesions, A50I, CELL ADHESION; CELL ADHESION
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	26.07 Å
rg_electron	26.16 Å
i0	15780800.00
molecular_weight	30565.0 kDa
excluded_volume	38579 Å³
envelope_volume	47764 Å³
shell_volume	17849 Å³
envelope_diameter	101.3 Å
shell_rg	28.85 Å
envelope_rg	26.42 Å
shape_rg	26.17 Å
total_rg	26.45 Å
total_atoms	2139
n_residues	277
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	98.5 Å
rg_real	26.54 Å
rg_real_error	1.18 Å
i0_real	1.5780e+07
i0_real_error	2.4150e+05
rg_reciprocal	26.40 Å
i0_reciprocal	15780000.0000
total_estimate	0.7370
solution_quality	REASONABLE a REASONABLE solution
n_peaks	2
r_peak_primary	21.0 Å
skewness	0.724
kurtosis	0.052
angular_range	— – 0.3050 Å⁻¹
current_alpha	0.0000
highest_alpha	4277000.0000
n_real_points	62
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.455; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.228; Smooth: 0.984

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	Vinculin
formula_weight	29049.5 kDa
mutation	A50I
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	2484

GGSPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAIVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW

Source

organism	Mus musculus
common_name	house mouse
ncbi_taxonomy_id	10090
host_organism	Escherichia coli

Entity 2 polymer

description	Talin-1
formula_weight	3314.8 kDa
src_method	syn
entity_count	1

Polymer

type	polypeptide(L)
strand_id	B

CEDPETQVVLINAVKDVAKALGDLISATKAAAG

Entity 3 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	230

▶

6. Citations (1)

▶

length_a	43.700 Å
length_b	75.800 Å
length_c	82.580 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	4

space_group	P 21 21 21
int_tables_number	19
crystal_system	orthorhombic

resolution	1.490 Å
resolution_low	27.920 Å
r_factor	0.1917
r_work	0.1895
r_free	0.2350

fit	/app/data/saxs_computation/sr/9sr0/9sr0.fit
pddf	/app/data/pr_computation/sr/9sr0/9sr0.pr.out
profile	/app/data/saxs_computation/sr/9sr0/9sr0.dat

;Mouse vinculin head domain 1 (VD1) (residues 2-258) with A50I mutation in complex with mouse talin 1 helix 50 (H50, residues 2072-2103) ;

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction

5. Entities & Polymer Info (3)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Entity 3 water

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)