6cp7

Monomer yeast ATP synthase Fo reconstituted in nanodisc generated from masked refinement.

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase subunit 9, mitochondrial

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	ATP synthase protein 8 × 1 （P00856） ATP synthase subunit a × 1 （P00854） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase subunit J, mitochondrial × 1 （P81450）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP9_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain K； PDBConstruct 1–76； UniProt 1–76 Author chain L； PDBConstruct 1–76； UniProt 1–76 Author chain M； PDBConstruct 1–76； UniProt 1–76 Author chain N； PDBConstruct 1–76； UniProt 1–76 Author chain O； PDBConstruct 1–76； UniProt 1–76 Author chain P； PDBConstruct 1–76； UniProt 1–76 Author chain Q； PDBConstruct 1–76； UniProt 1–76 Author chain R； PDBConstruct 1–76； UniProt 1–76 Author chain S； PDBConstruct 1–76； UniProt 1–76 Author chain T； PDBConstruct 1–76； UniProt 1–76

ATP synthase protein 8

OrganismNot specified

UniProt P00856

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase subunit a × 1 （P00854） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase subunit J, mitochondrial × 1 （P81450）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP8_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 8； PDBConstruct 1–48； UniProt 1–48

ATP synthase subunit a

OrganismNot specified

UniProt P00854

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase subunit J, mitochondrial × 1 （P81450）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP6_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain X； PDBConstruct 1–249； UniProt 11–259

ATP synthase subunit 4, mitochondrial

OrganismNot specified

UniProt P05626

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit a × 1 （P00854） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase subunit J, mitochondrial × 1 （P81450）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPF_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain Z； PDBConstruct 1–209； UniProt 36–244

ATP synthase subunit d, mitochondrial

OrganismNot specified

UniProt P30902

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit a × 1 （P00854） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase subunit J, mitochondrial × 1 （P81450）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP7_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 7； PDBConstruct 1–173； UniProt 2–174

ATP synthase subunit f, mitochondrial

OrganismNot specified

UniProt Q06405

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit a × 1 （P00854） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit J, mitochondrial × 1 （P81450）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPK_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain U； PDBConstruct 1–95； UniProt 7–101

ATP synthase subunit J, mitochondrial

OrganismNot specified

UniProt P81450

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit a × 1 （P00854） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit f, mitochondrial × 1 （Q06405）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP18_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain J； PDBConstruct 1–37； UniProt 1–37

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6cp7
Deposition date deposition_date	2018-03-13
Structure title title	Monomer yeast ATP synthase Fo reconstituted in nanodisc generated from masked refinement.
Keywords keywords	ATP synthase, BIOSYNTHETIC PROTEIN; BIOSYNTHETIC PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6cp7__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6cp7__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6cp7__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	34.00 Å
Rg (electron density)	33.30 Å
Total Rg	33.88 Å
Atom count	9164
Residues	1224
Excluded volume	169520 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6cp7__assembly_1__model_1`	hexadecameric （16）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	ATP synthase subunit 9, mitochondrial
Molecular weight formula_weight	7790.4 kDa
Source method src_method	nat
Copy count entity_count	10

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,L,M,N,O,P,Q,R,S,T
Atom count atom_count	9164

MQLVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEATGLFCLMVSFLLLFGV

Entity 2 Entity 2 polymer

Description description	ATP synthase protein 8
Molecular weight formula_weight	5825.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

MPQLVPFYFMNQLTYGFLLMITLLILFSQFFLPMILRLYVSRLFISKL

Entity 3 Entity 3 polymer

Description description	ATP synthase subunit a
Molecular weight formula_weight	27900.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

SPLDQFEIRTLFGLQSSFIDLSCLNLTTFSLYTIIVLLVITSLYTLTNNNNKIIGSRWLISQEAIYDTIMNMTKGQIGGKNWGLYFPMIFTLFMFIFIANLISMIPYSFALSAHLVFIISLSIVIWLGNTILGLYKHGWVFFSLFVPAGTPLPLVPLLVIIETLSYFARAISLGLRLGSNILAGHLLMVILAGLTFNFMLINLFTLVFGFVPLAMILAIMMLEFAIGIIQGYVWAILTASYLKDAVYLH

Entity 4 Entity 4 polymer

Description description	ATP synthase subunit 4, mitochondrial
Molecular weight formula_weight	23194.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MSSTPEKQTDPKAKANSIINAIPGNNILTKTGVLGTSAAAVIYAISNELYVINDESILLLTFLGFTGLVAKYLAPAYKDFADARMKKVSDVLNASRNKHVEAVKDRIDSVSQLQNVAETTKVLFDVSKETVELESEAFELKQKVELAHEAKAVLDSWVRYEASLRQLEQRQLAKSVISRVQSELGNPKFQEKVLQQSISEIEQLLSKLK

Entity 5 Entity 5 polymer

Description description	ATP synthase subunit d, mitochondrial
Molecular weight formula_weight	19709.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

SLAKSAANKLDWAKVISSLRITGSTATQLSSFKKRNDEARRQLLELQSQPTEVDFSHYRSVLKNTSVIDKIESYVKQYKPVKIDASKQLQVIESFEKHAMTNAKETESLVSKELKDLQSTLDNIQSARPFDELTVDDLTKIKPEIDAKVEEMVKKGKWDVPGYKDRFGNLNVM

Entity 6 Entity 6 polymer

Description description	ATP synthase subunit f, mitochondrial
Molecular weight formula_weight	10584.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

VSTLIPPKVVSSKNIGSAPNAKRIANVVHFYKSLPQGPAPAIKANTRLARYKAKYFDGDNASGKPLWHFALGIIAFGYSMEYYFHLRHHKGAEEH

Entity 7 Entity 7 polymer

Description description	ATP synthase subunit J, mitochondrial
Molecular weight formula_weight	4145.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MLKRFPTPILKVYWPFFVAGAAVYYGMSKAADLSSNT

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	109206

Monomer yeast ATP synthase Fo reconstituted in nanodisc generated from masked refinement.

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase subunit 9, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase protein 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit a

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit 4, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit d, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit f, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit J, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6cp7__assembly_1__model_1

6cp7__assembly_1__model_1 | I(q)

6cp7__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer