6cp6

Monomer yeast ATP synthase (F1Fo) reconstituted in nanodisc.

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase subunit 9, mitochondrial

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	ATP synthase subunit 5, mitochondrial × 1 （P09457） ATP synthase subunit alpha, mitochondrial × 3 （P07251） ATP synthase subunit beta, mitochondrial × 3 （P00830） ATP synthase subunit gamma, mitochondrial × 1 （P38077） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit a × 1 （P00854） ATP synthase subunit J, mitochondrial × 1 （P81450） ADENOSINE-5'-TRIPHOSPHATE × 3 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP9_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain K； PDBConstruct 1–76； UniProt 1–76 Author chain L； PDBConstruct 1–76； UniProt 1–76 Author chain M； PDBConstruct 1–76； UniProt 1–76 Author chain N； PDBConstruct 1–76； UniProt 1–76 Author chain O； PDBConstruct 1–76； UniProt 1–76 Author chain P； PDBConstruct 1–76； UniProt 1–76 Author chain Q； PDBConstruct 1–76； UniProt 1–76 Author chain R； PDBConstruct 1–76； UniProt 1–76 Author chain S； PDBConstruct 1–76； UniProt 1–76 Author chain T； PDBConstruct 1–76； UniProt 1–76

ATP synthase subunit 5, mitochondrial

OrganismNot specified

UniProt P09457

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase subunit alpha, mitochondrial × 3 （P07251） ATP synthase subunit beta, mitochondrial × 3 （P00830） ATP synthase subunit gamma, mitochondrial × 1 （P38077） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit a × 1 （P00854） ATP synthase subunit J, mitochondrial × 1 （P81450） ADENOSINE-5'-TRIPHOSPHATE × 3 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPO_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain Y； PDBConstruct 1–195； UniProt 18–212

ATP synthase subunit alpha, mitochondrial

OrganismNot specified

UniProt P07251

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase subunit 5, mitochondrial × 1 （P09457） ATP synthase subunit beta, mitochondrial × 3 （P00830） ATP synthase subunit gamma, mitochondrial × 1 （P38077） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit a × 1 （P00854） ATP synthase subunit J, mitochondrial × 1 （P81450） ADENOSINE-5'-TRIPHOSPHATE × 3 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPA_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–510； UniProt 36–545 Author chain B； PDBConstruct 1–510； UniProt 36–545 Author chain C； PDBConstruct 1–510； UniProt 36–545

ATP synthase subunit beta, mitochondrial

OrganismNot specified

UniProt P00830

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase subunit 5, mitochondrial × 1 （P09457） ATP synthase subunit alpha, mitochondrial × 3 （P07251） ATP synthase subunit gamma, mitochondrial × 1 （P38077） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit a × 1 （P00854） ATP synthase subunit J, mitochondrial × 1 （P81450） ADENOSINE-5'-TRIPHOSPHATE × 3 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPB_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–478； UniProt 34–511 Author chain E； PDBConstruct 1–478； UniProt 34–511 Author chain F； PDBConstruct 1–478； UniProt 34–511

ATP synthase subunit gamma, mitochondrial

OrganismNot specified

UniProt P38077

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase subunit 5, mitochondrial × 1 （P09457） ATP synthase subunit alpha, mitochondrial × 3 （P07251） ATP synthase subunit beta, mitochondrial × 3 （P00830） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit a × 1 （P00854） ATP synthase subunit J, mitochondrial × 1 （P81450） ADENOSINE-5'-TRIPHOSPHATE × 3 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPG_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain G； PDBConstruct 1–278； UniProt 34–311

ATP synthase subunit delta, mitochondrial

OrganismNot specified

UniProt Q12165

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase subunit 5, mitochondrial × 1 （P09457） ATP synthase subunit alpha, mitochondrial × 3 （P07251） ATP synthase subunit beta, mitochondrial × 3 （P00830） ATP synthase subunit gamma, mitochondrial × 1 （P38077） ATP synthase subunit epsilon, mitochondrial × 1 （P21306） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit a × 1 （P00854） ATP synthase subunit J, mitochondrial × 1 （P81450） ADENOSINE-5'-TRIPHOSPHATE × 3 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPD_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain H； PDBConstruct 1–138； UniProt 23–160

ATP synthase subunit epsilon, mitochondrial

OrganismNot specified

UniProt P21306

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase subunit 5, mitochondrial × 1 （P09457） ATP synthase subunit alpha, mitochondrial × 3 （P07251） ATP synthase subunit beta, mitochondrial × 3 （P00830） ATP synthase subunit gamma, mitochondrial × 1 （P38077） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit a × 1 （P00854） ATP synthase subunit J, mitochondrial × 1 （P81450） ADENOSINE-5'-TRIPHOSPHATE × 3 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP5E_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain I； PDBConstruct 1–61； UniProt 2–62

ATP synthase subunit 4, mitochondrial

OrganismNot specified

UniProt P05626

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase subunit 5, mitochondrial × 1 （P09457） ATP synthase subunit alpha, mitochondrial × 3 （P07251） ATP synthase subunit beta, mitochondrial × 3 （P00830） ATP synthase subunit gamma, mitochondrial × 1 （P38077） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit a × 1 （P00854） ATP synthase subunit J, mitochondrial × 1 （P81450） ADENOSINE-5'-TRIPHOSPHATE × 3 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPF_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain Z； PDBConstruct 1–209； UniProt 36–244

ATP synthase subunit d, mitochondrial

OrganismNot specified

UniProt P30902

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase subunit 5, mitochondrial × 1 （P09457） ATP synthase subunit alpha, mitochondrial × 3 （P07251） ATP synthase subunit beta, mitochondrial × 3 （P00830） ATP synthase subunit gamma, mitochondrial × 1 （P38077） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit a × 1 （P00854） ATP synthase subunit J, mitochondrial × 1 （P81450） ADENOSINE-5'-TRIPHOSPHATE × 3 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP7_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain 7； PDBConstruct 1–173； UniProt 2–174

ATP synthase subunit H, mitochondrial

OrganismNot specified

UniProt Q12349

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase subunit 5, mitochondrial × 1 （P09457） ATP synthase subunit alpha, mitochondrial × 3 （P07251） ATP synthase subunit beta, mitochondrial × 3 （P00830） ATP synthase subunit gamma, mitochondrial × 1 （P38077） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit a × 1 （P00854） ATP synthase subunit J, mitochondrial × 1 （P81450） ADENOSINE-5'-TRIPHOSPHATE × 3 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP14_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain 6； PDBConstruct 1–92； UniProt 33–124

ATP synthase subunit f, mitochondrial

OrganismNot specified

UniProt Q06405

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase subunit 5, mitochondrial × 1 （P09457） ATP synthase subunit alpha, mitochondrial × 3 （P07251） ATP synthase subunit beta, mitochondrial × 3 （P00830） ATP synthase subunit gamma, mitochondrial × 1 （P38077） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit a × 1 （P00854） ATP synthase subunit J, mitochondrial × 1 （P81450） ADENOSINE-5'-TRIPHOSPHATE × 3 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPK_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain U； PDBConstruct 1–95； UniProt 7–101

ATP synthase protein 8

OrganismNot specified

UniProt P00856

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase subunit 5, mitochondrial × 1 （P09457） ATP synthase subunit alpha, mitochondrial × 3 （P07251） ATP synthase subunit beta, mitochondrial × 3 （P00830） ATP synthase subunit gamma, mitochondrial × 1 （P38077） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase subunit a × 1 （P00854） ATP synthase subunit J, mitochondrial × 1 （P81450） ADENOSINE-5'-TRIPHOSPHATE × 3 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP8_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain 8； PDBConstruct 1–48； UniProt 1–48

ATP synthase subunit a

OrganismNot specified

UniProt P00854

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase subunit 5, mitochondrial × 1 （P09457） ATP synthase subunit alpha, mitochondrial × 3 （P07251） ATP synthase subunit beta, mitochondrial × 3 （P00830） ATP synthase subunit gamma, mitochondrial × 1 （P38077） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit J, mitochondrial × 1 （P81450） ADENOSINE-5'-TRIPHOSPHATE × 3 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP6_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain X； PDBConstruct 1–249； UniProt 11–259

ATP synthase subunit J, mitochondrial

OrganismNot specified

UniProt P81450

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	ATP synthase subunit 9, mitochondrial × 10 （P61829） ATP synthase subunit 5, mitochondrial × 1 （P09457） ATP synthase subunit alpha, mitochondrial × 3 （P07251） ATP synthase subunit beta, mitochondrial × 3 （P00830） ATP synthase subunit gamma, mitochondrial × 1 （P38077） ATP synthase subunit delta, mitochondrial × 1 （Q12165） ATP synthase subunit epsilon, mitochondrial × 1 （P21306） ATP synthase subunit 4, mitochondrial × 1 （P05626） ATP synthase subunit d, mitochondrial × 1 （P30902） ATP synthase subunit H, mitochondrial × 1 （Q12349） ATP synthase subunit f, mitochondrial × 1 （Q06405） ATP synthase protein 8 × 1 （P00856） ATP synthase subunit a × 1 （P00854） ADENOSINE-5'-TRIPHOSPHATE × 3 ADENOSINE-5'-DIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP18_YEAST
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain J； PDBConstruct 1–37； UniProt 1–37

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6cp6
Deposition date deposition_date	2018-03-13
Structure title title	Monomer yeast ATP synthase (F1Fo) reconstituted in nanodisc.
Keywords keywords	ATP synthase, BIOSYNTHETIC PROTEIN; BIOSYNTHETIC PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6cp6__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6cp6__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6cp6__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	62.83 Å
Rg (electron density)	64.60 Å
Total Rg	64.62 Å
Atom count	38853
Residues	5118
Excluded volume	699480 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6cp6__assembly_1__model_1`	27-meric （27）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (16)

Entity 1 Entity 1 polymer

Description description	ATP synthase subunit 9, mitochondrial
Molecular weight formula_weight	7790.4 kDa
Source method src_method	nat
Copy count entity_count	10

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,L,M,N,O,P,Q,R,S,T
Atom count atom_count	38853

MQLVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEATGLFCLMVSFLLLFGV

Entity 2 Entity 2 polymer

Description description	ATP synthase subunit 5, mitochondrial
Molecular weight formula_weight	20901.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

ASKAAAPPPVRLFGVEGTYATALYQAAAKNSSIDAAFQSLQKVESTVKKNPKLGHLLLNPALSLKDRNSVIDAIVETHKNLDGYVVNLLKVLSENNRLGCFEKIASDFGVLNDAHNGLLKGTVTSAEPLDPKSFKRIEKALSASKLVGQGKSLKLENVVKPEIKGGLIVELGDKTVDLSISTKIQKLNKVLEDSI

Entity 3 Entity 3 polymer

Description description	ATP synthase subunit alpha, mitochondrial
Molecular weight formula_weight	55007.4 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C

ASTKAQPTEVSSILEERIKGVSDEANLNETGRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEPGQVGIVLFGSDRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSEKEGSGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNELLTEIREKGELSKELLASLKSATESFVATF

Entity 4 Entity 4 polymer

Description description	ATP synthase subunit beta, mitochondrial
Molecular weight formula_weight	51181.1 kDa
EC 编号 ec_number	7.1.2.2
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F

ASAAQSTPITGKVTAVIGAIVDVHFEQSELPAILNALEIKTPQGKLVLEVAQHLGENTVRTIAMDGTEGLVRGEKVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAEQSTSAEILETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGESKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVASKVQETLQTYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIPGKLVRLKDTVASFKAVLEGKYDNIPEHAFYMVGGIEDVVAKAEKLAAEAN

Entity 5 Entity 5 polymer

Description description	ATP synthase subunit gamma, mitochondrial
Molecular weight formula_weight	30657.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

ATLKEVEMRLKSIKNIEKITKTMKIVASTRLSKAEKAKISAKKMDEAEQLFYKNAETKNLDVEATETGAPKELIVAITSDKGLCGSIHSQLAKAVRRHLNDQPNADIVTIGDKIKMQLLRTHPNNIKLSINGIGKDAPTFQESALIADKLLSVMKAGTYPKISIFYNDPVSSLSFEPSEKPIFNAKTIEQSPSFGKFEIDTDANVPRDLFEYTLANQMLTAMAQGYAAEISARRNAMDNASKNAGDMINRYSILYNRTRQAVITNELVDIITGASSLG

Entity 6 Entity 6 polymer

Description description	ATP synthase subunit delta, mitochondrial
Molecular weight formula_weight	14565.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

AEAAAASSGLKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVVEVMEGSNSKKFFISGGFATVQPDSQLCVTAIEAFPLESFSQENIKNLLAEAKKNVSSSDAREAAEAAIQVEVLENLQSVLK

Entity 7 Entity 7 polymer

Description description	ATP synthase subunit epsilon, mitochondrial
Molecular weight formula_weight	6618.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

SAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPITK

Entity 8 Entity 8 polymer

Description description	ATP synthase subunit 4, mitochondrial
Molecular weight formula_weight	23194.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MSSTPEKQTDPKAKANSIINAIPGNNILTKTGVLGTSAAAVIYAISNELYVINDESILLLTFLGFTGLVAKYLAPAYKDFADARMKKVSDVLNASRNKHVEAVKDRIDSVSQLQNVAETTKVLFDVSKETVELESEAFELKQKVELAHEAKAVLDSWVRYEASLRQLEQRQLAKSVISRVQSELGNPKFQEKVLQQSISEIEQLLSKLK

Entity 9 Entity 9 polymer

Description description	ATP synthase subunit d, mitochondrial
Molecular weight formula_weight	19709.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

SLAKSAANKLDWAKVISSLRITGSTATQLSSFKKRNDEARRQLLELQSQPTEVDFSHYRSVLKNTSVIDKIESYVKQYKPVKIDASKQLQVIESFEKHAMTNAKETESLVSKELKDLQSTLDNIQSARPFDELTVDDLTKIKPEIDAKVEEMVKKGKWDVPGYKDRFGNLNVM

Entity 10 Entity 10 polymer

Description description	ATP synthase subunit H, mitochondrial
Molecular weight formula_weight	10417.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

NVIQDLYLRELKDTKLAPSTLQDAEGNVKPWNPPQKPNLPELELQGPEALKAYTEQNVETAHVAKESEEGESEPIEEDWLVLDDAEETKESH

Entity 11 Entity 11 polymer

Description description	ATP synthase subunit f, mitochondrial
Molecular weight formula_weight	10584.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

VSTLIPPKVVSSKNIGSAPNAKRIANVVHFYKSLPQGPAPAIKANTRLARYKAKYFDGDNASGKPLWHFALGIIAFGYSMEYYFHLRHHKGAEEH

Entity 12 Entity 12 polymer

Description description	ATP synthase protein 8
Molecular weight formula_weight	5825.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

MPQLVPFYFMNQLTYGFLLMITLLILFSQFFLPMILRLYVSRLFISKL

Entity 13 Entity 13 polymer

Description description	ATP synthase subunit a
Molecular weight formula_weight	27900.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

SPLDQFEIRTLFGLQSSFIDLSCLNLTTFSLYTIIVLLVITSLYTLTNNNNKIIGSRWLISQEAIYDTIMNMTKGQIGGKNWGLYFPMIFTLFMFIFIANLISMIPYSFALSAHLVFIISLSIVIWLGNTILGLYKHGWVFFSLFVPAGTPLPLVPLLVIIETLSYFARAISLGLRLGSNILAGHLLMVILAGLTFNFMLINLFTLVFGFVPLAMILAIMMLEFAIGIIQGYVWAILTASYLKDAVYLH

Entity 14 Entity 14 polymer

Description description	ATP synthase subunit J, mitochondrial
Molecular weight formula_weight	4145.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MLKRFPTPILKVYWPFFVAGAAVYYGMSKAADLSSNT

Entity 15 Entity 15 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 16 Entity 16 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	2

▼

6. Fold Classification (SCOP + CATH) 32 domains

CATH v4.4 (32 domains)

Domain ID domain_id	6cp6A01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	6cp6A02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	6cp6A03
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	150 — Lysin
Homologous superfamily homologous superfamily	20 — ATP synthase alpha/beta chain, C-terminal domain

Domain ID domain_id	6cp6B01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	6cp6B02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	6cp6B03
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	150 — Lysin
Homologous superfamily homologous superfamily	20 — ATP synthase alpha/beta chain, C-terminal domain

Domain ID domain_id	6cp6C01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	6cp6C02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	6cp6C03
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	150 — Lysin
Homologous superfamily homologous superfamily	20 — ATP synthase alpha/beta chain, C-terminal domain

Domain ID domain_id	6cp6D01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6cp6D02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	6cp6D03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1140 — Bovine Mitochondrial F1-ATPase, ATP Synthase Beta Chain; Chain D, domain3
Homologous superfamily homologous superfamily	10 — Bovine Mitochondrial F1-atpase; Atp Synthase Beta Chain; Chain D, domain 3

Domain ID domain_id	6cp6E01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6cp6E02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	6cp6E03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1140 — Bovine Mitochondrial F1-ATPase, ATP Synthase Beta Chain; Chain D, domain3
Homologous superfamily homologous superfamily	10 — Bovine Mitochondrial F1-atpase; Atp Synthase Beta Chain; Chain D, domain 3

Domain ID domain_id	6cp6F01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6cp6F02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	6cp6F03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1140 — Bovine Mitochondrial F1-ATPase, ATP Synthase Beta Chain; Chain D, domain3
Homologous superfamily homologous superfamily	10 — Bovine Mitochondrial F1-atpase; Atp Synthase Beta Chain; Chain D, domain 3

Domain ID domain_id	6cp6G01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	80 — ATP synthase, gamma subunit, helix hairpin domain

Domain ID domain_id	6cp6G02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1380 — Pyruvate Kinase; Chain: A, domain 1
Homologous superfamily homologous superfamily	10 — ATP synthase, F1 complex, gamma subunit

Domain ID domain_id	6cp6I00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1620 — Atp Synthase Epsilon Chain; Chain: I;
Homologous superfamily homologous superfamily	20 — ATP synthase, F1 complex, epsilon subunit superfamily, mitochondrial

Domain ID domain_id	6cp6K00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6cp6L00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6cp6M00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6cp6N00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6cp6O00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6cp6P00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6cp6Q00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6cp6R00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6cp6S00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6cp6T00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6cp6Y01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	520 — Peroxidase; domain 1
Homologous superfamily homologous superfamily	20 — N-terminal domain of the delta subunit of the F1F0-ATP synthase

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	160937

Monomer yeast ATP synthase (F1Fo) reconstituted in nanodisc.

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase subunit 9, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit 5, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit alpha, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit beta, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit gamma, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit delta, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit epsilon, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit 4, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit d, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit H, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer