6b8h

Mosaic model of yeast mitochondrial ATP synthase monomer

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase subunit 9, mitochondrial

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	ATP synthase protein 8 × 2 （P00856） ATP synthase subunit a × 2 （P00854） ATP synthase subunit 4, mitochondrial × 2 （P05626） ATP synthase subunit d, mitochondrial × 2 （P30902） ATP synthase subunit e, mitochondrial × 2 ATP synthase subunit f, mitochondrial × 2 （Q06405） AATP synthase subunit g × 2 ATP synthase subunit J, mitochondrial × 2 （P81450） ATP synthase subunit K, mitochondrial × 2 （P81451） ATP synthase subunit alpha, mitochondrial × 6 （P07251） ATP synthase subunit beta, mitochondrial × 6 （P00830） ATP synthase subunit gamma, mitochondrial × 2 （P38077） ATP synthase subunit delta, mitochondrial × 2 （Q12165） ATP synthase catalytic sector F1 epsilon subunit × 2 （E9P9X4） ATP synthase subunit 5, mitochondrial × 2 （P09457） ATP synthase subunit h × 2 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 10 MAGNESIUM ION × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP9_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 0； PDBConstruct 1–76； UniProt 1–76 Author chain 1； PDBConstruct 1–76； UniProt 1–76 Author chain 2； PDBConstruct 1–76； UniProt 1–76 Author chain 3； PDBConstruct 1–76； UniProt 1–76 Author chain 4； PDBConstruct 1–76； UniProt 1–76 Author chain 5； PDBConstruct 1–76； UniProt 1–76 Author chain 6； PDBConstruct 1–76； UniProt 1–76 Author chain 7； PDBConstruct 1–76； UniProt 1–76 Author chain 8； PDBConstruct 1–76； UniProt 1–76 Author chain 9； PDBConstruct 1–76； UniProt 1–76 Author chain J； PDBConstruct 1–76； UniProt 1–76 Author chain L； PDBConstruct 1–76； UniProt 1–76 Author chain M； PDBConstruct 1–76； UniProt 1–76 Author chain N； PDBConstruct 1–76； UniProt 1–76 Author chain P； PDBConstruct 1–76； UniProt 1–76 Author chain Q； PDBConstruct 1–76； UniProt 1–76 Author chain R； PDBConstruct 1–76； UniProt 1–76 Author chain S； PDBConstruct 1–76； UniProt 1–76 Author chain T； PDBConstruct 1–76； UniProt 1–76 Author chain U； PDBConstruct 1–76； UniProt 1–76

ATP synthase protein 8

OrganismNot specified

UniProt P00856

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	ATP synthase subunit 9, mitochondrial × 20 （P61829） ATP synthase subunit a × 2 （P00854） ATP synthase subunit 4, mitochondrial × 2 （P05626） ATP synthase subunit d, mitochondrial × 2 （P30902） ATP synthase subunit e, mitochondrial × 2 ATP synthase subunit f, mitochondrial × 2 （Q06405） AATP synthase subunit g × 2 ATP synthase subunit J, mitochondrial × 2 （P81450） ATP synthase subunit K, mitochondrial × 2 （P81451） ATP synthase subunit alpha, mitochondrial × 6 （P07251） ATP synthase subunit beta, mitochondrial × 6 （P00830） ATP synthase subunit gamma, mitochondrial × 2 （P38077） ATP synthase subunit delta, mitochondrial × 2 （Q12165） ATP synthase catalytic sector F1 epsilon subunit × 2 （E9P9X4） ATP synthase subunit 5, mitochondrial × 2 （P09457） ATP synthase subunit h × 2 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 10 MAGNESIUM ION × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP8_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–48； UniProt 1–48 Author chain V； PDBConstruct 1–48； UniProt 1–48

ATP synthase subunit a

OrganismNot specified

UniProt P00854

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	ATP synthase subunit 9, mitochondrial × 20 （P61829） ATP synthase protein 8 × 2 （P00856） ATP synthase subunit 4, mitochondrial × 2 （P05626） ATP synthase subunit d, mitochondrial × 2 （P30902） ATP synthase subunit e, mitochondrial × 2 ATP synthase subunit f, mitochondrial × 2 （Q06405） AATP synthase subunit g × 2 ATP synthase subunit J, mitochondrial × 2 （P81450） ATP synthase subunit K, mitochondrial × 2 （P81451） ATP synthase subunit alpha, mitochondrial × 6 （P07251） ATP synthase subunit beta, mitochondrial × 6 （P00830） ATP synthase subunit gamma, mitochondrial × 2 （P38077） ATP synthase subunit delta, mitochondrial × 2 （Q12165） ATP synthase catalytic sector F1 epsilon subunit × 2 （E9P9X4） ATP synthase subunit 5, mitochondrial × 2 （P09457） ATP synthase subunit h × 2 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 10 MAGNESIUM ION × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP6_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain a； PDBConstruct 1–249； UniProt 11–259 Author chain p； PDBConstruct 1–249； UniProt 11–259

ATP synthase subunit 4, mitochondrial

OrganismNot specified

UniProt P05626

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	ATP synthase subunit 9, mitochondrial × 20 （P61829） ATP synthase protein 8 × 2 （P00856） ATP synthase subunit a × 2 （P00854） ATP synthase subunit d, mitochondrial × 2 （P30902） ATP synthase subunit e, mitochondrial × 2 ATP synthase subunit f, mitochondrial × 2 （Q06405） AATP synthase subunit g × 2 ATP synthase subunit J, mitochondrial × 2 （P81450） ATP synthase subunit K, mitochondrial × 2 （P81451） ATP synthase subunit alpha, mitochondrial × 6 （P07251） ATP synthase subunit beta, mitochondrial × 6 （P00830） ATP synthase subunit gamma, mitochondrial × 2 （P38077） ATP synthase subunit delta, mitochondrial × 2 （Q12165） ATP synthase catalytic sector F1 epsilon subunit × 2 （E9P9X4） ATP synthase subunit 5, mitochondrial × 2 （P09457） ATP synthase subunit h × 2 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 10 MAGNESIUM ION × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPF_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain b； PDBConstruct 1–209； UniProt 36–244 Author chain q； PDBConstruct 1–209； UniProt 36–244

ATP synthase subunit d, mitochondrial

OrganismNot specified

UniProt P30902

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	ATP synthase subunit 9, mitochondrial × 20 （P61829） ATP synthase protein 8 × 2 （P00856） ATP synthase subunit a × 2 （P00854） ATP synthase subunit 4, mitochondrial × 2 （P05626） ATP synthase subunit e, mitochondrial × 2 ATP synthase subunit f, mitochondrial × 2 （Q06405） AATP synthase subunit g × 2 ATP synthase subunit J, mitochondrial × 2 （P81450） ATP synthase subunit K, mitochondrial × 2 （P81451） ATP synthase subunit alpha, mitochondrial × 6 （P07251） ATP synthase subunit beta, mitochondrial × 6 （P00830） ATP synthase subunit gamma, mitochondrial × 2 （P38077） ATP synthase subunit delta, mitochondrial × 2 （Q12165） ATP synthase catalytic sector F1 epsilon subunit × 2 （E9P9X4） ATP synthase subunit 5, mitochondrial × 2 （P09457） ATP synthase subunit h × 2 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 10 MAGNESIUM ION × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP7_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain d； PDBConstruct 1–173； UniProt 2–174 Author chain r； PDBConstruct 1–173； UniProt 2–174

ATP synthase subunit f, mitochondrial

OrganismNot specified

UniProt Q06405

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	ATP synthase subunit 9, mitochondrial × 20 （P61829） ATP synthase protein 8 × 2 （P00856） ATP synthase subunit a × 2 （P00854） ATP synthase subunit 4, mitochondrial × 2 （P05626） ATP synthase subunit d, mitochondrial × 2 （P30902） ATP synthase subunit e, mitochondrial × 2 AATP synthase subunit g × 2 ATP synthase subunit J, mitochondrial × 2 （P81450） ATP synthase subunit K, mitochondrial × 2 （P81451） ATP synthase subunit alpha, mitochondrial × 6 （P07251） ATP synthase subunit beta, mitochondrial × 6 （P00830） ATP synthase subunit gamma, mitochondrial × 2 （P38077） ATP synthase subunit delta, mitochondrial × 2 （Q12165） ATP synthase catalytic sector F1 epsilon subunit × 2 （E9P9X4） ATP synthase subunit 5, mitochondrial × 2 （P09457） ATP synthase subunit h × 2 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 10 MAGNESIUM ION × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPK_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain f； PDBConstruct 1–95； UniProt 7–101 Author chain t； PDBConstruct 1–95； UniProt 7–101

ATP synthase subunit J, mitochondrial

OrganismNot specified

UniProt P81450

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	ATP synthase subunit 9, mitochondrial × 20 （P61829） ATP synthase protein 8 × 2 （P00856） ATP synthase subunit a × 2 （P00854） ATP synthase subunit 4, mitochondrial × 2 （P05626） ATP synthase subunit d, mitochondrial × 2 （P30902） ATP synthase subunit e, mitochondrial × 2 ATP synthase subunit f, mitochondrial × 2 （Q06405） AATP synthase subunit g × 2 ATP synthase subunit K, mitochondrial × 2 （P81451） ATP synthase subunit alpha, mitochondrial × 6 （P07251） ATP synthase subunit beta, mitochondrial × 6 （P00830） ATP synthase subunit gamma, mitochondrial × 2 （P38077） ATP synthase subunit delta, mitochondrial × 2 （Q12165） ATP synthase catalytic sector F1 epsilon subunit × 2 （E9P9X4） ATP synthase subunit 5, mitochondrial × 2 （P09457） ATP synthase subunit h × 2 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 10 MAGNESIUM ION × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP18_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain i； PDBConstruct 1–59； UniProt 1–59 Author chain w； PDBConstruct 1–59； UniProt 1–59

ATP synthase subunit K, mitochondrial

OrganismNot specified

UniProt P81451

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	ATP synthase subunit 9, mitochondrial × 20 （P61829） ATP synthase protein 8 × 2 （P00856） ATP synthase subunit a × 2 （P00854） ATP synthase subunit 4, mitochondrial × 2 （P05626） ATP synthase subunit d, mitochondrial × 2 （P30902） ATP synthase subunit e, mitochondrial × 2 ATP synthase subunit f, mitochondrial × 2 （Q06405） AATP synthase subunit g × 2 ATP synthase subunit J, mitochondrial × 2 （P81450） ATP synthase subunit alpha, mitochondrial × 6 （P07251） ATP synthase subunit beta, mitochondrial × 6 （P00830） ATP synthase subunit gamma, mitochondrial × 2 （P38077） ATP synthase subunit delta, mitochondrial × 2 （Q12165） ATP synthase catalytic sector F1 epsilon subunit × 2 （E9P9X4） ATP synthase subunit 5, mitochondrial × 2 （P09457） ATP synthase subunit h × 2 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 10 MAGNESIUM ION × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP19_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain k； PDBConstruct 1–68； UniProt 1–68 Author chain x； PDBConstruct 1–68； UniProt 1–68

ATP synthase subunit alpha, mitochondrial

OrganismNot specified

UniProt P07251

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	ATP synthase subunit 9, mitochondrial × 20 （P61829） ATP synthase protein 8 × 2 （P00856） ATP synthase subunit a × 2 （P00854） ATP synthase subunit 4, mitochondrial × 2 （P05626） ATP synthase subunit d, mitochondrial × 2 （P30902） ATP synthase subunit e, mitochondrial × 2 ATP synthase subunit f, mitochondrial × 2 （Q06405） AATP synthase subunit g × 2 ATP synthase subunit J, mitochondrial × 2 （P81450） ATP synthase subunit K, mitochondrial × 2 （P81451） ATP synthase subunit beta, mitochondrial × 6 （P00830） ATP synthase subunit gamma, mitochondrial × 2 （P38077） ATP synthase subunit delta, mitochondrial × 2 （Q12165） ATP synthase catalytic sector F1 epsilon subunit × 2 （E9P9X4） ATP synthase subunit 5, mitochondrial × 2 （P09457） ATP synthase subunit h × 2 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 10 MAGNESIUM ION × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPA_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain B； PDBConstruct 1–510； UniProt 36–545 Author chain C； PDBConstruct 1–510； UniProt 36–545 Author chain K； PDBConstruct 1–510； UniProt 36–545 Author chain W； PDBConstruct 1–510； UniProt 36–545 Author chain X； PDBConstruct 1–510； UniProt 36–545 Author chain n； PDBConstruct 1–510； UniProt 36–545

ATP synthase subunit beta, mitochondrial

OrganismNot specified

UniProt P00830

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	ATP synthase subunit 9, mitochondrial × 20 （P61829） ATP synthase protein 8 × 2 （P00856） ATP synthase subunit a × 2 （P00854） ATP synthase subunit 4, mitochondrial × 2 （P05626） ATP synthase subunit d, mitochondrial × 2 （P30902） ATP synthase subunit e, mitochondrial × 2 ATP synthase subunit f, mitochondrial × 2 （Q06405） AATP synthase subunit g × 2 ATP synthase subunit J, mitochondrial × 2 （P81450） ATP synthase subunit K, mitochondrial × 2 （P81451） ATP synthase subunit alpha, mitochondrial × 6 （P07251） ATP synthase subunit gamma, mitochondrial × 2 （P38077） ATP synthase subunit delta, mitochondrial × 2 （Q12165） ATP synthase catalytic sector F1 epsilon subunit × 2 （E9P9X4） ATP synthase subunit 5, mitochondrial × 2 （P09457） ATP synthase subunit h × 2 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 10 MAGNESIUM ION × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPB_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain D； PDBConstruct 1–478； UniProt 34–511 Author chain E； PDBConstruct 1–478； UniProt 34–511 Author chain F； PDBConstruct 1–478； UniProt 34–511 Author chain Y； PDBConstruct 1–478； UniProt 34–511 Author chain Z； PDBConstruct 1–478； UniProt 34–511 Author chain c； PDBConstruct 1–478； UniProt 34–511

ATP synthase subunit gamma, mitochondrial

OrganismNot specified

UniProt P38077

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	ATP synthase subunit 9, mitochondrial × 20 （P61829） ATP synthase protein 8 × 2 （P00856） ATP synthase subunit a × 2 （P00854） ATP synthase subunit 4, mitochondrial × 2 （P05626） ATP synthase subunit d, mitochondrial × 2 （P30902） ATP synthase subunit e, mitochondrial × 2 ATP synthase subunit f, mitochondrial × 2 （Q06405） AATP synthase subunit g × 2 ATP synthase subunit J, mitochondrial × 2 （P81450） ATP synthase subunit K, mitochondrial × 2 （P81451） ATP synthase subunit alpha, mitochondrial × 6 （P07251） ATP synthase subunit beta, mitochondrial × 6 （P00830） ATP synthase subunit delta, mitochondrial × 2 （Q12165） ATP synthase catalytic sector F1 epsilon subunit × 2 （E9P9X4） ATP synthase subunit 5, mitochondrial × 2 （P09457） ATP synthase subunit h × 2 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 10 MAGNESIUM ION × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPG_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain G； PDBConstruct 1–278； UniProt 34–311 Author chain j； PDBConstruct 1–278； UniProt 34–311

ATP synthase subunit delta, mitochondrial

OrganismNot specified

UniProt Q12165

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	ATP synthase subunit 9, mitochondrial × 20 （P61829） ATP synthase protein 8 × 2 （P00856） ATP synthase subunit a × 2 （P00854） ATP synthase subunit 4, mitochondrial × 2 （P05626） ATP synthase subunit d, mitochondrial × 2 （P30902） ATP synthase subunit e, mitochondrial × 2 ATP synthase subunit f, mitochondrial × 2 （Q06405） AATP synthase subunit g × 2 ATP synthase subunit J, mitochondrial × 2 （P81450） ATP synthase subunit K, mitochondrial × 2 （P81451） ATP synthase subunit alpha, mitochondrial × 6 （P07251） ATP synthase subunit beta, mitochondrial × 6 （P00830） ATP synthase subunit gamma, mitochondrial × 2 （P38077） ATP synthase catalytic sector F1 epsilon subunit × 2 （E9P9X4） ATP synthase subunit 5, mitochondrial × 2 （P09457） ATP synthase subunit h × 2 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 10 MAGNESIUM ION × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPD_YEAST
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain H； PDBConstruct 1–138； UniProt 23–160 Author chain l； PDBConstruct 1–138； UniProt 23–160

ATP synthase catalytic sector F1 epsilon subunit

OrganismNot specified

UniProt E9P9X4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	ATP synthase subunit 9, mitochondrial × 20 （P61829） ATP synthase protein 8 × 2 （P00856） ATP synthase subunit a × 2 （P00854） ATP synthase subunit 4, mitochondrial × 2 （P05626） ATP synthase subunit d, mitochondrial × 2 （P30902） ATP synthase subunit e, mitochondrial × 2 ATP synthase subunit f, mitochondrial × 2 （Q06405） AATP synthase subunit g × 2 ATP synthase subunit J, mitochondrial × 2 （P81450） ATP synthase subunit K, mitochondrial × 2 （P81451） ATP synthase subunit alpha, mitochondrial × 6 （P07251） ATP synthase subunit beta, mitochondrial × 6 （P00830） ATP synthase subunit gamma, mitochondrial × 2 （P38077） ATP synthase subunit delta, mitochondrial × 2 （Q12165） ATP synthase subunit 5, mitochondrial × 2 （P09457） ATP synthase subunit h × 2 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 10 MAGNESIUM ION × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E9P9X4_YEASX
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain I； PDBConstruct 1–61； UniProt 2–62 Author chain m； PDBConstruct 1–61； UniProt 2–62

ATP synthase subunit 5, mitochondrial

OrganismNot specified

UniProt P09457

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 60	ATP synthase subunit 9, mitochondrial × 20 （P61829） ATP synthase protein 8 × 2 （P00856） ATP synthase subunit a × 2 （P00854） ATP synthase subunit 4, mitochondrial × 2 （P05626） ATP synthase subunit d, mitochondrial × 2 （P30902） ATP synthase subunit e, mitochondrial × 2 ATP synthase subunit f, mitochondrial × 2 （Q06405） AATP synthase subunit g × 2 ATP synthase subunit J, mitochondrial × 2 （P81450） ATP synthase subunit K, mitochondrial × 2 （P81451） ATP synthase subunit alpha, mitochondrial × 6 （P07251） ATP synthase subunit beta, mitochondrial × 6 （P00830） ATP synthase subunit gamma, mitochondrial × 2 （P38077） ATP synthase subunit delta, mitochondrial × 2 （Q12165） ATP synthase catalytic sector F1 epsilon subunit × 2 （E9P9X4） ATP synthase subunit h × 2 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 10 MAGNESIUM ION × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPO_YEAST
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain O； PDBConstruct 1–195； UniProt 18–212 Author chain o； PDBConstruct 1–195； UniProt 18–212

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6b8h
Deposition date deposition_date	2017-10-07
Structure title title	Mosaic model of yeast mitochondrial ATP synthase monomer
Keywords keywords	Complex, Proton transporter, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6b8h__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6b8h__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6b8h__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	126.60 Å
Total Rg	126.50 Å
Atom count	75614
Residues	10470
Excluded volume	1352000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6b8h__assembly_1__model_1`	60-meric （60）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (19)

Entity 1 Entity 1 polymer

Description description	ATP synthase subunit 9, mitochondrial
Molecular weight formula_weight	7762.4 kDa
Source method src_method	nat
Copy count entity_count	20

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,2,3,4,5,6,7,8,9,0,L,M,N,P,Q,R,S,T,U,J
Atom count atom_count	75614

MQLVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEATGLFCLMVSFLLLFGV

Entity 2 Entity 2 polymer

Description description	ATP synthase protein 8
Molecular weight formula_weight	5825.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,V

MPQLVPFYFMNQLTYGFLLMITLLILFSQFFLPMILRLYVSRLFISKL

Entity 3 Entity 3 polymer

Description description	ATP synthase subunit a
Molecular weight formula_weight	27900.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,p

SPLDQFEIRTLFGLQSSFIDLSCLNLTTFSLYTIIVLLVITSLYTLTNNNNKIIGSRWLISQEAIYDTIMNMTKGQIGGKNWGLYFPMIFTLFMFIFIANLISMIPYSFALSAHLVFIISLSIVIWLGNTILGLYKHGWVFFSLFVPAGTPLPLVPLLVIIETLSYFARAISLGLRLGSNILAGHLLMVILAGLTFNFMLINLFTLVFGFVPLAMILAIMMLEFAIGIIQGYVWAILTASYLKDAVYLH

Entity 4 Entity 4 polymer

Description description	ATP synthase subunit 4, mitochondrial
Molecular weight formula_weight	23194.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b,q

MSSTPEKQTDPKAKANSIINAIPGNNILTKTGVLGTSAAAVIYAISNELYVINDESILLLTFLGFTGLVAKYLAPAYKDFADARMKKVSDVLNASRNKHVEAVKDRIDSVSQLQNVAETTKVLFDVSKETVELESEAFELKQKVELAHEAKAVLDSWVRYEASLRQLEQRQLAKSVISRVQSELGNPKFQEKVLQQSISEIEQLLSKLK

Entity 5 Entity 5 polymer

Description description	ATP synthase subunit d, mitochondrial
Molecular weight formula_weight	19709.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d,r

SLAKSAANKLDWAKVISSLRITGSTATQLSSFKKRNDEARRQLLELQSQPTEVDFSHYRSVLKNTSVIDKIESYVKQYKPVKIDASKQLQVIESFEKHAMTNAKETESLVSKELKDLQSTLDNIQSARPFDELTVDDLTKIKPEIDAKVEEMVKKGKWDVPGYKDRFGNLNVM

Entity 6 Entity 6 polymer

Description description	ATP synthase subunit e, mitochondrial
Molecular weight formula_weight	4188.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e,s

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 7 Entity 7 polymer

Description description	ATP synthase subunit f, mitochondrial
Molecular weight formula_weight	10584.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f,t

VSTLIPPKVVSSKNIGSAPNAKRIANVVHFYKSLPQGPAPAIKANTRLARYKAKYFDGDNASGKPLWHFALGIIAFGYSMEYYFHLRHHKGAEEH

Entity 8 Entity 8 polymer

Description description	AATP synthase subunit g
Molecular weight formula_weight	9039.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,u

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 9 Entity 9 polymer

Description description	ATP synthase subunit J, mitochondrial
Molecular weight formula_weight	6696.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i,w

MLKRFPTPILKVYWPFFVAGAAVYYGMSKAADLSSNTKEFINDPRNPRFAKGGKFVEVD

Entity 10 Entity 10 polymer

Description description	ATP synthase subunit K, mitochondrial
Molecular weight formula_weight	7546.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k,x

MGAAYHFMGKAIPPHQLAIGTLGLLGLLVVPNPFKSAKPKTVDIKTDNKDEEKFIENYLKKHSEKQDA

Entity 11 Entity 11 polymer

Description description	ATP synthase subunit alpha, mitochondrial
Molecular weight formula_weight	55007.4 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,B,C,n,W,X

ASTKAQPTEVSSILEERIKGVSDEANLNETGRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMALNLEPGQVGIVLFGSDRLVKEGELVKRTGNIVDVPVGPGLLGRVVDALGNPIDGKGPIDAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYSIIVAATASEAAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSEKEGSGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLVRGERLTQLLKQNQYSPLATEEQVPLIYAGVNGHLDGIELSRIGEFESSFLSYLKSNHNELLTEIREKGELSKELLASLKSATESFVATF

Entity 12 Entity 12 polymer

Description description	ATP synthase subunit beta, mitochondrial
Molecular weight formula_weight	51181.1 kDa
EC 编号 ec_number	3.6.3.14
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F,Y,Z,c

ASAAQSTPITGKVTAVIGAIVDVHFEQSELPAILNALEIKTPQGKLVLEVAQHLGENTVRTIAMDGTEGLVRGEKVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAEQSTSAEILETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGESKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVASKVQETLQTYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIPGKLVRLKDTVASFKAVLEGKYDNIPEHAFYMVGGIEDVVAKAEKLAAEAN

Entity 13 Entity 13 polymer

Description description	ATP synthase subunit gamma, mitochondrial
Molecular weight formula_weight	30657.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,j

ATLKEVEMRLKSIKNIEKITKTMKIVASTRLSKAEKAKISAKKMDEAEQLFYKNAETKNLDVEATETGAPKELIVAITSDKGLCGSIHSQLAKAVRRHLNDQPNADIVTIGDKIKMQLLRTHPNNIKLSINGIGKDAPTFQESALIADKLLSVMKAGTYPKISIFYNDPVSSLSFEPSEKPIFNAKTIEQSPSFGKFEIDTDANVPRDLFEYTLANQMLTAMAQGYAAEISARRNAMDNASKNAGDMINRYSILYNRTRQAVITNELVDIITGASSLG

Entity 14 Entity 14 polymer

Description description	ATP synthase subunit delta, mitochondrial
Molecular weight formula_weight	14565.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,l

AEAAAASSGLKLQFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTVEQLLPGVVEVMEGSNSKKFFISGGFATVQPDSQLCVTAIEAFPLESFSQENIKNLLAEAKKNVSSSDAREAAEAAIQVEVLENLQSVLK

Entity 15 Entity 15 polymer

Description description	ATP synthase catalytic sector F1 epsilon subunit
Molecular weight formula_weight	6642.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,m

SAWRKAGMSYAAYLNVAAQAIRSSLKTELQTASVTNRSQTDAFYTQYKNGTAASEPTPMTK

Entity 16 Entity 16 polymer

Description description	ATP synthase subunit 5, mitochondrial
Molecular weight formula_weight	20901.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,o

ASKAAAPPPVRLFGVEGTYATALYQAAAKNSSIDAAFQSLQKVESTVKKNPKLGHLLLNPALSLKDRNSVIDAIVETHKNLDGYVVNLLKVLSENNRLGCFEKIASDFGVLNDAHNGLLKGTVTSAEPLDPKSFKRIEKALSASKLVGQGKSLKLENVVKPEIKGGLIVELGDKTVDLSISTKIQKLNKVLEDSI

Entity 17 Entity 17 polymer

Description description	ATP synthase subunit h
Molecular weight formula_weight	1805.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h,v

XXXXXXXXXXXXXXXXXXXXX

Entity 18 Entity 18 non-polymer

Description description	PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER
Molecular weight formula_weight	506.2 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 19 Entity 19 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	10

▼

6. Fold Classification (SCOP + CATH) 64 domains

CATH v4.4 (64 domains)

Domain ID domain_id	6b8h000
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6b8h100
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6b8h200
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6b8h300
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6b8h400
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6b8h500
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6b8h600
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6b8h700
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6b8h800
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6b8h900
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6b8hB01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	6b8hB02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	6b8hB03
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	150 — Lysin
Homologous superfamily homologous superfamily	20 — ATP synthase alpha/beta chain, C-terminal domain

Domain ID domain_id	6b8hC01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	6b8hC02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	6b8hC03
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	150 — Lysin
Homologous superfamily homologous superfamily	20 — ATP synthase alpha/beta chain, C-terminal domain

Domain ID domain_id	6b8hD01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6b8hD02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	6b8hD03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1140 — Bovine Mitochondrial F1-ATPase, ATP Synthase Beta Chain; Chain D, domain3
Homologous superfamily homologous superfamily	10 — Bovine Mitochondrial F1-atpase; Atp Synthase Beta Chain; Chain D, domain 3

Domain ID domain_id	6b8hE01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6b8hE02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	6b8hE03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1140 — Bovine Mitochondrial F1-ATPase, ATP Synthase Beta Chain; Chain D, domain3
Homologous superfamily homologous superfamily	10 — Bovine Mitochondrial F1-atpase; Atp Synthase Beta Chain; Chain D, domain 3

Domain ID domain_id	6b8hF01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6b8hF02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	6b8hF03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1140 — Bovine Mitochondrial F1-ATPase, ATP Synthase Beta Chain; Chain D, domain3
Homologous superfamily homologous superfamily	10 — Bovine Mitochondrial F1-atpase; Atp Synthase Beta Chain; Chain D, domain 3

Domain ID domain_id	6b8hG01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	80 — ATP synthase, gamma subunit, helix hairpin domain

Domain ID domain_id	6b8hG02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1380 — Pyruvate Kinase; Chain: A, domain 1
Homologous superfamily homologous superfamily	10 — ATP synthase, F1 complex, gamma subunit

Domain ID domain_id	6b8hI00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1620 — Atp Synthase Epsilon Chain; Chain: I;
Homologous superfamily homologous superfamily	20 — ATP synthase, F1 complex, epsilon subunit superfamily, mitochondrial

Domain ID domain_id	6b8hJ00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6b8hK01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	6b8hK02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	6b8hK03
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	150 — Lysin
Homologous superfamily homologous superfamily	20 — ATP synthase alpha/beta chain, C-terminal domain

Domain ID domain_id	6b8hL00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6b8hM00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6b8hN00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6b8hO01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	520 — Peroxidase; domain 1
Homologous superfamily homologous superfamily	20 — N-terminal domain of the delta subunit of the F1F0-ATP synthase

Domain ID domain_id	6b8hP00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6b8hQ00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6b8hR00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6b8hS00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6b8hT00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6b8hU00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6b8hW01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	6b8hW02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	6b8hW03
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	150 — Lysin
Homologous superfamily homologous superfamily	20 — ATP synthase alpha/beta chain, C-terminal domain

Domain ID domain_id	6b8hX01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	6b8hX02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	6b8hX03
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	150 — Lysin
Homologous superfamily homologous superfamily	20 — ATP synthase alpha/beta chain, C-terminal domain

Domain ID domain_id	6b8hY01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6b8hY02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	6b8hY03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1140 — Bovine Mitochondrial F1-ATPase, ATP Synthase Beta Chain; Chain D, domain3
Homologous superfamily homologous superfamily	10 — Bovine Mitochondrial F1-atpase; Atp Synthase Beta Chain; Chain D, domain 3

Domain ID domain_id	6b8hZ01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6b8hZ02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	6b8hZ03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1140 — Bovine Mitochondrial F1-ATPase, ATP Synthase Beta Chain; Chain D, domain3
Homologous superfamily homologous superfamily	10 — Bovine Mitochondrial F1-atpase; Atp Synthase Beta Chain; Chain D, domain 3

Domain ID domain_id	6b8hc01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6b8hc02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	6b8hc03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1140 — Bovine Mitochondrial F1-ATPase, ATP Synthase Beta Chain; Chain D, domain3
Homologous superfamily homologous superfamily	10 — Bovine Mitochondrial F1-atpase; Atp Synthase Beta Chain; Chain D, domain 3

Domain ID domain_id	6b8hj01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	80 — ATP synthase, gamma subunit, helix hairpin domain

Domain ID domain_id	6b8hj02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1380 — Pyruvate Kinase; Chain: A, domain 1
Homologous superfamily homologous superfamily	10 — ATP synthase, F1 complex, gamma subunit

Domain ID domain_id	6b8hm00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1620 — Atp Synthase Epsilon Chain; Chain: I;
Homologous superfamily homologous superfamily	20 — ATP synthase, F1 complex, epsilon subunit superfamily, mitochondrial

Domain ID domain_id	6b8hn01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	6b8hn02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	6b8hn03
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	150 — Lysin
Homologous superfamily homologous superfamily	20 — ATP synthase alpha/beta chain, C-terminal domain

Domain ID domain_id	6b8ho01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	520 — Peroxidase; domain 1
Homologous superfamily homologous superfamily	20 — N-terminal domain of the delta subunit of the F1F0-ATP synthase

▶

Resolution resolution	3.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	238848

Mosaic model of yeast mitochondrial ATP synthase monomer

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase subunit 9, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase protein 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit a

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit 4, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit d, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit f, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit J, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit K, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit alpha, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit beta, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer