6kad

Cryo-EM structure of the C2S2M2L2-type PSII-LHCII supercomplex from Chlamydomonas reihardtii

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	Chlorophyll a-b binding protein, chloroplastic × 8 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 4 （Q93WE0） Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Ycf12 × 2 Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） CHLOROPHYLL B × 122 CHLOROPHYLL A × 254 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 42 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 20 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 32 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 2 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q93VE0_CHLRE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 0； PDBConstruct 1–256； UniProt 1–256 Author chain 1； PDBConstruct 1–256； UniProt 1–256 Author chain 6； PDBConstruct 1–256； UniProt 1–256 Author chain 7； PDBConstruct 1–256； UniProt 1–256 Author chain Y； PDBConstruct 1–256； UniProt 1–256 Author chain y； PDBConstruct 1–256； UniProt 1–256

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q93WL4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	Chlorophyll a-b binding protein, chloroplastic × 6 （Q93VE0） Chlorophyll a-b binding protein, chloroplastic × 4 （Q93WE0） Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Ycf12 × 2 Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） CHLOROPHYLL B × 122 CHLOROPHYLL A × 254 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 42 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 20 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 32 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 2 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q93WL4_CHLRE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 2； PDBConstruct 1–257； UniProt 1–257 Author chain 3； PDBConstruct 1–257； UniProt 1–257 Author chain 5； PDBConstruct 1–257； UniProt 1–257 Author chain 8； PDBConstruct 1–257； UniProt 1–257 Author chain 9； PDBConstruct 1–257； UniProt 1–257 Author chain N； PDBConstruct 1–257； UniProt 1–257 Author chain n； PDBConstruct 1–257； UniProt 1–257 Author chain p； PDBConstruct 1–257； UniProt 1–257

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q93WE0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	Chlorophyll a-b binding protein, chloroplastic × 6 （Q93VE0） Chlorophyll a-b binding protein, chloroplastic × 8 （Q93WL4） Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Ycf12 × 2 Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） CHLOROPHYLL B × 122 CHLOROPHYLL A × 254 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 42 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 20 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 32 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 2 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q93WE0_CHLRE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 4； PDBConstruct 1–249； UniProt 1–249 Author chain G； PDBConstruct 1–249； UniProt 1–249 Author chain g； PDBConstruct 1–249； UniProt 1–249 Author chain q； PDBConstruct 1–249； UniProt 1–249

Photosystem II protein D1

OrganismNot specified

UniProt P07753

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	Chlorophyll a-b binding protein, chloroplastic × 6 （Q93VE0） Chlorophyll a-b binding protein, chloroplastic × 8 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 4 （Q93WE0） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Ycf12 × 2 Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） CHLOROPHYLL B × 122 CHLOROPHYLL A × 254 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 42 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 20 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 32 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 2 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBA_CHLRE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain A； PDBConstruct 1–352； UniProt 1–352 Author chain a； PDBConstruct 1–352； UniProt 1–352

Photosystem II CP47 reaction center protein

OrganismNot specified

UniProt P37255

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	Chlorophyll a-b binding protein, chloroplastic × 6 （Q93VE0） Chlorophyll a-b binding protein, chloroplastic × 8 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 4 （Q93WE0） Photosystem II protein D1 × 2 （P07753） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Ycf12 × 2 Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） CHLOROPHYLL B × 122 CHLOROPHYLL A × 254 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 42 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 20 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 32 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 2 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBB_CHLRE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain B； PDBConstruct 1–508； UniProt 1–508 Author chain b； PDBConstruct 1–508； UniProt 1–508

Photosystem II CP43 reaction center protein

OrganismNot specified

UniProt P10898

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	Chlorophyll a-b binding protein, chloroplastic × 6 （Q93VE0） Chlorophyll a-b binding protein, chloroplastic × 8 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 4 （Q93WE0） Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Ycf12 × 2 Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） CHLOROPHYLL B × 122 CHLOROPHYLL A × 254 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 42 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 20 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 32 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 2 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBC_CHLRE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain C； PDBConstruct 1–461； UniProt 1–461 Author chain c； PDBConstruct 1–461； UniProt 1–461

Photosystem II D2 protein

OrganismNot specified

UniProt P06007

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	Chlorophyll a-b binding protein, chloroplastic × 6 （Q93VE0） Chlorophyll a-b binding protein, chloroplastic × 8 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 4 （Q93WE0） Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Ycf12 × 2 Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） CHLOROPHYLL B × 122 CHLOROPHYLL A × 254 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 42 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 20 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 32 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 2 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBD_CHLRE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain D； PDBConstruct 1–352； UniProt 1–352 Author chain d； PDBConstruct 1–352； UniProt 1–352

Cytochrome b559 subunit alpha

OrganismNot specified

UniProt P48268

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	Chlorophyll a-b binding protein, chloroplastic × 6 （Q93VE0） Chlorophyll a-b binding protein, chloroplastic × 8 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 4 （Q93WE0） Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Ycf12 × 2 Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） CHLOROPHYLL B × 122 CHLOROPHYLL A × 254 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 42 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 20 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 32 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 2 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBE_CHLRE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain E； PDBConstruct 1–82； UniProt 1–82 Author chain e； PDBConstruct 1–82； UniProt 1–82

Cytochrome b559 subunit beta

OrganismNot specified

UniProt Q08363

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	Chlorophyll a-b binding protein, chloroplastic × 6 （Q93VE0） Chlorophyll a-b binding protein, chloroplastic × 8 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 4 （Q93WE0） Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Ycf12 × 2 Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） CHLOROPHYLL B × 122 CHLOROPHYLL A × 254 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 42 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 20 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 32 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 2 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBF_CHLRE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain F； PDBConstruct 1–44； UniProt 1–44 Author chain f； PDBConstruct 1–44； UniProt 1–44

Photosystem II reaction center protein H

OrganismNot specified

UniProt P22666

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	Chlorophyll a-b binding protein, chloroplastic × 6 （Q93VE0） Chlorophyll a-b binding protein, chloroplastic × 8 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 4 （Q93WE0） Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Ycf12 × 2 Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） CHLOROPHYLL B × 122 CHLOROPHYLL A × 254 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 42 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 20 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 32 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 2 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBH_CHLRE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain H； PDBConstruct 1–88； UniProt 1–88 Author chain h； PDBConstruct 1–88； UniProt 1–88

Photosystem II reaction center protein I

OrganismNot specified

UniProt P59763

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	Chlorophyll a-b binding protein, chloroplastic × 6 （Q93VE0） Chlorophyll a-b binding protein, chloroplastic × 8 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 4 （Q93WE0） Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Ycf12 × 2 Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） CHLOROPHYLL B × 122 CHLOROPHYLL A × 254 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 42 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 20 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 32 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 2 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBI_CHLRE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain I； PDBConstruct 1–37； UniProt 1–37 Author chain i； PDBConstruct 1–37； UniProt 1–37

Photosystem II reaction center protein J

OrganismNot specified

UniProt O19930

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	Chlorophyll a-b binding protein, chloroplastic × 6 （Q93VE0） Chlorophyll a-b binding protein, chloroplastic × 8 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 4 （Q93WE0） Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Ycf12 × 2 Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） CHLOROPHYLL B × 122 CHLOROPHYLL A × 254 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 42 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 20 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 32 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 2 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBJ_CHLRE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain J； PDBConstruct 1–42； UniProt 1–42 Author chain j； PDBConstruct 1–42； UniProt 1–42

Photosystem II reaction center protein K

OrganismNot specified

UniProt P18263

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	Chlorophyll a-b binding protein, chloroplastic × 6 （Q93VE0） Chlorophyll a-b binding protein, chloroplastic × 8 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 4 （Q93WE0） Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Ycf12 × 2 Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） CHLOROPHYLL B × 122 CHLOROPHYLL A × 254 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 42 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 20 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 32 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 2 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBK_CHLRE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain K； PDBConstruct 1–46； UniProt 1–46 Author chain k； PDBConstruct 1–46； UniProt 1–46

Photosystem II reaction center protein L

OrganismNot specified

UniProt P32974

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	Chlorophyll a-b binding protein, chloroplastic × 6 （Q93VE0） Chlorophyll a-b binding protein, chloroplastic × 8 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 4 （Q93WE0） Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Ycf12 × 2 Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） CHLOROPHYLL B × 122 CHLOROPHYLL A × 254 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 42 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 20 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 32 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 2 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBL_CHLRE
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain L； PDBConstruct 1–38； UniProt 1–38 Author chain l； PDBConstruct 1–38； UniProt 1–38

Photosystem II reaction center protein M

OrganismNot specified

UniProt P92277

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	Chlorophyll a-b binding protein, chloroplastic × 6 （Q93VE0） Chlorophyll a-b binding protein, chloroplastic × 8 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 4 （Q93WE0） Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Ycf12 × 2 Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） CHLOROPHYLL B × 122 CHLOROPHYLL A × 254 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 42 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 20 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 32 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 2 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBM_CHLRE
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain M； PDBConstruct 1–34； UniProt 1–34 Author chain m； PDBConstruct 1–34； UniProt 1–34

Oxygen-evolving enhancer protein 1, chloroplastic

OrganismNot specified

UniProt P12853

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	Chlorophyll a-b binding protein, chloroplastic × 6 （Q93VE0） Chlorophyll a-b binding protein, chloroplastic × 8 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 4 （Q93WE0） Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Ycf12 × 2 Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） CHLOROPHYLL B × 122 CHLOROPHYLL A × 254 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 42 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 20 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 32 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 2 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBO_CHLRE
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain O； PDBConstruct 1–291； UniProt 1–291 Author chain o； PDBConstruct 1–291； UniProt 1–291

Chlorophyll a-b binding protein CP29

OrganismNot specified

UniProt Q93WD2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	Chlorophyll a-b binding protein, chloroplastic × 6 （Q93VE0） Chlorophyll a-b binding protein, chloroplastic × 8 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 4 （Q93WE0） Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Ycf12 × 2 Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） CHLOROPHYLL B × 122 CHLOROPHYLL A × 254 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 42 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 20 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 32 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 2 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CB29_CHLRE
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain R； PDBConstruct 1–280； UniProt 1–280 Author chain r； PDBConstruct 1–280； UniProt 1–280

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q9FEK6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	Chlorophyll a-b binding protein, chloroplastic × 6 （Q93VE0） Chlorophyll a-b binding protein, chloroplastic × 8 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 4 （Q93WE0） Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Ycf12 × 2 Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） CHLOROPHYLL B × 122 CHLOROPHYLL A × 254 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 42 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 20 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 32 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 2 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9FEK6_CHLRE
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain S； PDBConstruct 1–289； UniProt 1–289 Author chain s； PDBConstruct 1–289； UniProt 1–289

Photosystem II reaction center protein T

OrganismNot specified

UniProt P37256

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	Chlorophyll a-b binding protein, chloroplastic × 6 （Q93VE0） Chlorophyll a-b binding protein, chloroplastic × 8 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 4 （Q93WE0） Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Photosystem II reaction center protein Ycf12 × 2 Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） CHLOROPHYLL B × 122 CHLOROPHYLL A × 254 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 42 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 20 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 32 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 2 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBT_CHLRE
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain T； PDBConstruct 1–31； UniProt 1–31 Author chain t； PDBConstruct 1–31； UniProt 1–31

Photosystem II reaction center W protein, chloroplastic

OrganismNot specified

UniProt Q9SPI9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	Chlorophyll a-b binding protein, chloroplastic × 6 （Q93VE0） Chlorophyll a-b binding protein, chloroplastic × 8 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 4 （Q93WE0） Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Ycf12 × 2 4.1 kDa photosystem II subunit × 2 （A8I846） Photosystem II reaction center protein Z × 2 （P92276） CHLOROPHYLL B × 122 CHLOROPHYLL A × 254 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 42 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 20 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 32 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 2 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBW_CHLRE
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain W； PDBConstruct 1–115； UniProt 1–115 Author chain w； PDBConstruct 1–115； UniProt 1–115

4.1 kDa photosystem II subunit

OrganismNot specified

UniProt A8I846

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	Chlorophyll a-b binding protein, chloroplastic × 6 （Q93VE0） Chlorophyll a-b binding protein, chloroplastic × 8 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 4 （Q93WE0） Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Ycf12 × 2 Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） Photosystem II reaction center protein Z × 2 （P92276） CHLOROPHYLL B × 122 CHLOROPHYLL A × 254 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 42 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 20 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 32 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 2 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8I846_CHLRE
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain X； PDBConstruct 1–101； UniProt 1–101 Author chain x； PDBConstruct 1–101； UniProt 1–101

Photosystem II reaction center protein Z

OrganismNot specified

UniProt P92276

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 58	Chlorophyll a-b binding protein, chloroplastic × 6 （Q93VE0） Chlorophyll a-b binding protein, chloroplastic × 8 （Q93WL4） Chlorophyll a-b binding protein, chloroplastic × 4 （Q93WE0） Photosystem II protein D1 × 2 （P07753） Photosystem II CP47 reaction center protein × 2 （P37255） Photosystem II CP43 reaction center protein × 2 （P10898） Photosystem II D2 protein × 2 （P06007） Cytochrome b559 subunit alpha × 2 （P48268） Cytochrome b559 subunit beta × 2 （Q08363） Photosystem II reaction center protein H × 2 （P22666） Photosystem II reaction center protein I × 2 （P59763） Photosystem II reaction center protein J × 2 （O19930） Photosystem II reaction center protein K × 2 （P18263） Photosystem II reaction center protein L × 2 （P32974） Photosystem II reaction center protein M × 2 （P92277） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P12853） Chlorophyll a-b binding protein CP29 × 2 （Q93WD2） Chlorophyll a-b binding protein, chloroplastic × 2 （Q9FEK6） Photosystem II reaction center protein T × 2 （P37256） Photosystem II reaction center protein Ycf12 × 2 Photosystem II reaction center W protein, chloroplastic × 2 （Q9SPI9） 4.1 kDa photosystem II subunit × 2 （A8I846） CHLOROPHYLL B × 122 CHLOROPHYLL A × 254 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 42 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 20 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 22 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 32 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 2 PHEOPHYTIN A × 4 BETA-CAROTENE × 20 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBZ_CHLRE
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain Z； PDBConstruct 1–62； UniProt 1–62 Author chain z； PDBConstruct 1–62； UniProt 1–62

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6kad
Deposition date deposition_date	2019-06-21
Structure title title	Cryo-EM structure of the C2S2M2L2-type PSII-LHCII supercomplex from Chlamydomonas reihardtii
Keywords keywords	PhotosystemII, supercomplex, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6kad__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6kad__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6kad__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	91.08 Å
Rg (electron density)	92.57 Å
Total Rg	91.86 Å
Atom count	105342
Residues	9734
Excluded volume	1970800 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6kad__assembly_1__model_1`	58-meric （58）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (40)

Entity 1 Entity 1 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	27591.3 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,6,Y,0,7,y
Atom count atom_count	105342

MAFALAKSSARAAVSRRSTVKVEARRTVKPASKASTPDSFWYGPERPLFLGAFTGEPPSYLTGEFPGDYGWDTAGLSADPETFKRYRELELIHARWAMLGALGCIFPELLGSYGVPFGEAVWFKAGAQIFQEGGLDYLGNPNLVHAQSILAILGTQVLLMGAIEGYRVNGGPLGEGLDKLYPGGSFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLQNLSDHLANPGTNNAFAYATKFTPQ

Entity 2 Entity 2 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	27405.0 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2,3,5,N,8,9,p,n

MAFALSFSRKALQVSAKATGKKGTGKTAAKQAPASSGIEFYGPNRAKWLGPYSENATPAYLTGEFPGDYGWDTAGLSADPETFKRYRELELIHARWAMLGALGCITPELLAKSGTQFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQNIVATLAVQVILMGLVEGYRVNGGPAGEGLDPLYPGESFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIQNLDDHLSNPTVNNAFAFATKFTPSA

Entity 3 Entity 3 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	26675.3 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4,G,q,g

MAAIMKSAVRSSVRPTVSGRSARVVPRAAIEWYGPDRPKFLGPFSEGDTPAYLTGEFPGDYGWDTAGLSADPETFKRYRELELIHARWAMLGALGCITPELLAKNGIPFGEAVWFKAGAQIFAEGGLNYLGNENLIHAQSIIATLAFQVVVMGLAEAYRANGGPLGEGLDPLHPGGAFDPLGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIQNLDDHLANPTAVNAFAYATKFTPSA

Entity 4 Entity 4 polymer

Description description	Photosystem II protein D1
Molecular weight formula_weight	39066.3 kDa
EC 编号 ec_number	1.10.3.9
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,a

MTAILERRENSSLWARFCEWITSTENRLYIGWFGVIMIPCLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVIPTSNAIGLHFYPIWEAASLDEWLYNGGPYQLIVCHFLLGVYCYMGREWELSFRLGMRPWIAVAYSAPVAAASAVFLVYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGLSTMAFNLNGFNFNQSVVDSQGRVLNTWADIINRANLGMEVMHERNAHNFPLDLASTNSSSNN

Entity 5 Entity 5 polymer

Description description	Photosystem II CP47 reaction center protein
Molecular weight formula_weight	56159.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,b

MGLPWYRVHTVVINDPGRLISVHLMHTALVSGWAGSMALFEISVFDPSDPVLNPMWRQGMFVLPFMTRLGITQSWGGWTISGETATNPGIWSYEGVAAAHIILSGALFLASVWHWTYWDLELFRDPRTGKTALDLPKIFGIHLFLSGLLCFGFGAFHVTGVFGPGIWVSDPYGLTGRVQPVAPSWGADGFDPYNPGGIASHHIAAGILGVLAGLFHLCVRPSIRLYFGLSMGSIETVLSSSIAAVFWAAFVVAGTMWYGSAATPIELFGPTRYQWDQGFFQQEIQKRVQASLAEGASLSDAWSRIPEKLAFYDYIGNNPAKGGLFRTGAMNSGDGIAVGWLGHASFKDQEGRELFVRRMPTFFETFPVLLLDKDGIVRADVPFRKAESKYSIEQVGVSVTFYGGELDGLTFTDPATVKKYARKAQLGEIFEFDRSTLQSDGVFRSSPRGWFTFGHVCFALLFFFGHIWHGARTIFRDVFAGIDDDINDQVEFGKYKKLGDTSSLREAF

Entity 6 Entity 6 polymer

Description description	Photosystem II CP43 reaction center protein
Molecular weight formula_weight	50680.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,c

METLFNGTLTVGGRDQETTGFAWWSGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVSHFVPEKPMYEQGLILLPHIATLGYGVGPGGEIIDTFPYFVSGVLHLISSAVLGFGGVYHSLIGPETLEESYPFFGYVWKDKNKMTNILGYHLIMLGLGAWLLVWKAMYFGGVYDTWAPGGGDVRVITNPTTNAAVIFGYLVKSPFGGDGWICSVDNMEDIIGGHIWIGTLEILGGIWHIYTTPWPWARRAFVWSGEAYLSYSLGAIGVMGFIACCMSWFNNTAYPSEFYGPTGPEASQSQAFTFLVRDQRLGANVASAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKLKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINAVNFVSPRSWLACSHFCLGFFFFIGHLWHAGRARAAAAGFEKGIDRFDEPVLSMRPLD

Entity 7 Entity 7 polymer

Description description	Photosystem II D2 protein
Molecular weight formula_weight	39474.0 kDa
EC 编号 ec_number	1.10.3.9
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,d

MTIAIGTYQEKRTWFDDADDWLRQDRFVFVGWSGLLLFPCAYFALGGWLTGTTFVTSWYTHGLATSYLEGCNFLTAAVSTPANSMAHSLLFVWGPEAQGDFTRWCQLGGLWAFVALHGAFGLIGFMLRQFEIARSVNLRPYNAIAFSAPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQAEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLLVPVTGLWMSAIGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHERLVFPEEVLPRGNAL

Entity 8 Entity 8 polymer

Description description	Cytochrome b559 subunit alpha
Molecular weight formula_weight	9312.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,e

MAGKPVERPFSDILTSIRYWVIHSITVPALFIAGWLFVSTGLAYDVFGTPRPNEYFTEDRQEAPLITDRFNALEQVKKLSGN

Entity 9 Entity 9 polymer

Description description	Cytochrome b559 subunit beta
Molecular weight formula_weight	4986.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,f

MTTKKSAEVLVYPIFTVRWLAIHGIAVPTIFFLGAITAMQFIQR

Entity 10 Entity 10 polymer

Description description	Photosystem II reaction center protein H
Molecular weight formula_weight	9445.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,h

MATGTSKAKPSKVNSDFQEPGLVTPLGTLLRPLNSEAGKVLPGWGTTVLMAVFILLFAAFLLIILEIYNSSLILDDVSMSWETLAKVS

Entity 11 Entity 11 polymer

Description description	Photosystem II reaction center protein I
Molecular weight formula_weight	4245.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,i

MLTLKIFVYTVVTFFVCLFIFGFLSNDPARNPGKNLD

Entity 12 Entity 12 polymer

Description description	Photosystem II reaction center protein J
Molecular weight formula_weight	4291.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,j

MSNTGTTGRIPLWLVGTVVGTLAIGLLAVFFYGSYVGLGSSL

Entity 13 Entity 13 polymer

Description description	Photosystem II reaction center protein K
Molecular weight formula_weight	5062.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,k

MTTLALVLAKLPEAYAPFAPIVDVLPVIPVFFILLAFVWQAAVSFR

Entity 14 Entity 14 polymer

Description description	Photosystem II reaction center protein L
Molecular weight formula_weight	4431.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,l

MARPNPNKQVVELNRTSLYWGLLLIFVLAVLFSSYIFN

Entity 15 Entity 15 polymer

Description description	Photosystem II reaction center protein M
Molecular weight formula_weight	3762.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,m

MEVNIYGLTATALFIIIPTSFLLILYVKTASTQD

Entity 16 Entity 16 polymer

Description description	Oxygen-evolving enhancer protein 1, chloroplastic
Molecular weight formula_weight	30557.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,o

MALRAAQSAKAGVRAARPNRATAVVCKAQKVGQAAAAAALATAMVAGSANALTFDEIQGLTYLQVKGSGIANTCPVLESGTTNLKELKAGSYKLENFCIEPTSFTVKEESQFKGGETEFVKTKLMTRLTYTLDAMSGSFKVGSDGSAELKEDDGIDYAATTVQLPGGERVAFLFTIKQFDGKGTLDGIKGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPARADAEELLKENVKITKALKGSAVFSVAKVDPVTGEIAGVFESIQPSDTDLGAKPPKDIKVTGLWYAQLK

Entity 17 Entity 17 polymer

Description description	Chlorophyll a-b binding protein CP29
Molecular weight formula_weight	29970.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R,r

MVFKFPTPPGTQKKAGTTATKPAPKATTKKVATSTGTRSGGVGYRKYQGDALWLPNTTRPEWLDGSLPGDRGFDPLGLSKPSEFVVIGVDENDQNAAKNNKGSVEAIVQATPDEVSSENRLAPYSEVFGLARFRECELIHGRWAMLACLGALVAEATTGVSWVEAGKVELDGASYAGLSLPFSITQLIWIEVILVGGAEFYRNSETNPEKRCYPGGVFDPLKLASEDEERAFRLKTAEIKHARLAMVSFFGYGVQALSTGEGALGSLAKFADGLNNGKGL

Entity 18 Entity 18 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	30742.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,s

MQIQALFKKTGASAPAKKGTASTKVVKPSKAGGKATRGWLGGQGGAADLDKWYGPDRKLFLPSGLYDRSEIPEYLNGELAGDYGYDPLGLGKDPETVAKYRENELLHARWAMLAAAGILIPEGLQANGANIKGGTWFETGAEMLNGGTLNYFAVPWGIVSNPLPLFAVIAVEVGLMGAVEFYRRNGTGPAGYSPGIGKFDSSVFDGLDPLYPGGPFDPLGLADDPEVLQELKVKEIKNGRLAMVSVLGFAVQSYVTGEGPYANWTKHVADPFGYNLLTVLGAEERTPTL

Entity 19 Entity 19 polymer

Description description	Photosystem II reaction center protein T
Molecular weight formula_weight	3639.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T,t

MEALVYTFLLVGTLGIIFFSIFFRDPPRMIK

Entity 20 Entity 20 polymer

Description description	Photosystem II reaction center protein Ycf12
Molecular weight formula_weight	3333.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V,v

MNIELALTLVSLVLVVSAGPLVVVLLSARGGNL

Entity 21 Entity 21 polymer

Description description	Photosystem II reaction center W protein, chloroplastic
Molecular weight formula_weight	12155.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W,w

MQALSARAPRVAAKPVSRSGARSAVTVVCKATTVRSEVAKKVAMLSTLPATLAAHPAFALVDERMNGDGTGRPFGVNDPVLGWVLLGVFGTMWAIWFIGQKDLGDFEDADDGLKL

Entity 22 Entity 22 polymer

Description description	4.1 kDa photosystem II subunit
Molecular weight formula_weight	9894.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X,x

MAAVCVSSKAVAVRPATRVASRPAARMVVRASAKPAQISEKAIAAGVSAAAAASLALAPIAEAAVTPSLKNFLGSLIAGATVLGGIALAITAVSKFDKTIR

Entity 23 Entity 23 polymer

Description description	Photosystem II reaction center protein Z
Molecular weight formula_weight	6565.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z,z

MTSILQVALLALIFVSFALVVGVPVVFATPNGWTDNKGAVFSGLSLWLLLVFVVGILNSFVV

Entity 24 Entity 24 non-polymer

Description description	CHLOROPHYLL B
Molecular weight formula_weight	907.5 kDa
Source method src_method	syn
Copy count entity_count	122

Entity 25 Entity 25 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	254

Entity 26 Entity 26 non-polymer

Description description	(3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	42

Entity 27 Entity 27 non-polymer

Description description	;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	20

Entity 28 Entity 28 non-polymer

Description description	;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	22

Entity 29 Entity 29 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	32

Entity 30 Entity 30 non-polymer

Description description	CA-MN4-O5 CLUSTER
Molecular weight formula_weight	339.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 31 Entity 31 non-polymer

Description description	FE (II) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 32 Entity 32 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 33 Entity 33 non-polymer

Description description	PHEOPHYTIN A
Molecular weight formula_weight	871.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 34 Entity 34 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	20

Entity 35 Entity 35 non-polymer

Description description	1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
Molecular weight formula_weight	795.1 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 36 Entity 36 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	14

Entity 37 Entity 37 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 38 Entity 38 non-polymer

Description description	BICARBONATE ION
Molecular weight formula_weight	61.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 39 Entity 39 non-polymer

Description description	;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ;
Molecular weight formula_weight	749.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 40 Entity 40 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	118423

Cryo-EM structure of the C2S2M2L2-type PSII-LHCII supercomplex from Chlamydomonas reihardtii

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chlorophyll a-b binding protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chlorophyll a-b binding protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chlorophyll a-b binding protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II protein D1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II CP47 reaction center protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II CP43 reaction center protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II D2 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b559 subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b559 subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein H

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer