6nwa

The structure of the photosystem I IsiA super-complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 51	Photosystem I P700 chlorophyll a apoprotein A2 × 3 （P29255） Photosystem I iron-sulfur center × 3 （P32422） Photosystem I reaction center subunit II × 3 （P19569） Photosystem I reaction center subunit IV × 3 （P12975） Photosystem I reaction center subunit III × 3 （P29256） Photosystem I reaction center subunit VIII × 3 （Q55330） Photosystem I reaction center subunit IX × 3 （Q55329） Photosystem I reaction center subunit XI × 3 （P37277） Photosystem I reaction center subunit XII × 3 （P72986） Iron stress-induced chlorophyll-binding protein × 18 （Q55274） Photosystem I reaction center subunit PsaK 1 × 3 （P72712） 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 9 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 15 CHLOROPHYLL A ISOMER × 3 CHLOROPHYLL A × 588 PHYLLOQUINONE × 6 IRON/SULFUR CLUSTER × 9 BETA-CAROTENE × 135 DODECYL-BETA-D-MALTOSIDE × 3 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAA_SYNY3
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–751； UniProt 1–751 Author chain H； PDBConstruct 1–751； UniProt 1–751 Author chain a； PDBConstruct 1–751； UniProt 1–751

Photosystem I P700 chlorophyll a apoprotein A2

OrganismNot specified

UniProt P29255

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 51	Photosystem I P700 chlorophyll a apoprotein A1 × 3 （P29254） Photosystem I iron-sulfur center × 3 （P32422） Photosystem I reaction center subunit II × 3 （P19569） Photosystem I reaction center subunit IV × 3 （P12975） Photosystem I reaction center subunit III × 3 （P29256） Photosystem I reaction center subunit VIII × 3 （Q55330） Photosystem I reaction center subunit IX × 3 （Q55329） Photosystem I reaction center subunit XI × 3 （P37277） Photosystem I reaction center subunit XII × 3 （P72986） Iron stress-induced chlorophyll-binding protein × 18 （Q55274） Photosystem I reaction center subunit PsaK 1 × 3 （P72712） 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 9 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 15 CHLOROPHYLL A ISOMER × 3 CHLOROPHYLL A × 588 PHYLLOQUINONE × 6 IRON/SULFUR CLUSTER × 9 BETA-CAROTENE × 135 DODECYL-BETA-D-MALTOSIDE × 3 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAB_SYNY3
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–731； UniProt 1–731 Author chain G； PDBConstruct 1–731； UniProt 1–731 Author chain b； PDBConstruct 1–731； UniProt 1–731

Photosystem I iron-sulfur center

OrganismNot specified

UniProt P32422

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 51	Photosystem I P700 chlorophyll a apoprotein A1 × 3 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 3 （P29255） Photosystem I reaction center subunit II × 3 （P19569） Photosystem I reaction center subunit IV × 3 （P12975） Photosystem I reaction center subunit III × 3 （P29256） Photosystem I reaction center subunit VIII × 3 （Q55330） Photosystem I reaction center subunit IX × 3 （Q55329） Photosystem I reaction center subunit XI × 3 （P37277） Photosystem I reaction center subunit XII × 3 （P72986） Iron stress-induced chlorophyll-binding protein × 18 （Q55274） Photosystem I reaction center subunit PsaK 1 × 3 （P72712） 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 9 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 15 CHLOROPHYLL A ISOMER × 3 CHLOROPHYLL A × 588 PHYLLOQUINONE × 6 IRON/SULFUR CLUSTER × 9 BETA-CAROTENE × 135 DODECYL-BETA-D-MALTOSIDE × 3 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAC_SYNY3
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–81； UniProt 1–81 Author chain N； PDBConstruct 1–81； UniProt 1–81 Author chain c； PDBConstruct 1–81； UniProt 1–81

Photosystem I reaction center subunit II

OrganismNot specified

UniProt P19569

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 51	Photosystem I P700 chlorophyll a apoprotein A1 × 3 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 3 （P29255） Photosystem I iron-sulfur center × 3 （P32422） Photosystem I reaction center subunit IV × 3 （P12975） Photosystem I reaction center subunit III × 3 （P29256） Photosystem I reaction center subunit VIII × 3 （Q55330） Photosystem I reaction center subunit IX × 3 （Q55329） Photosystem I reaction center subunit XI × 3 （P37277） Photosystem I reaction center subunit XII × 3 （P72986） Iron stress-induced chlorophyll-binding protein × 18 （Q55274） Photosystem I reaction center subunit PsaK 1 × 3 （P72712） 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 9 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 15 CHLOROPHYLL A ISOMER × 3 CHLOROPHYLL A × 588 PHYLLOQUINONE × 6 IRON/SULFUR CLUSTER × 9 BETA-CAROTENE × 135 DODECYL-BETA-D-MALTOSIDE × 3 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAD_SYNY3
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–141； UniProt 1–141 Author chain O； PDBConstruct 1–141； UniProt 1–141 Author chain d； PDBConstruct 1–141； UniProt 1–141

Photosystem I reaction center subunit IV

OrganismNot specified

UniProt P12975

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 51	Photosystem I P700 chlorophyll a apoprotein A1 × 3 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 3 （P29255） Photosystem I iron-sulfur center × 3 （P32422） Photosystem I reaction center subunit II × 3 （P19569） Photosystem I reaction center subunit III × 3 （P29256） Photosystem I reaction center subunit VIII × 3 （Q55330） Photosystem I reaction center subunit IX × 3 （Q55329） Photosystem I reaction center subunit XI × 3 （P37277） Photosystem I reaction center subunit XII × 3 （P72986） Iron stress-induced chlorophyll-binding protein × 18 （Q55274） Photosystem I reaction center subunit PsaK 1 × 3 （P72712） 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 9 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 15 CHLOROPHYLL A ISOMER × 3 CHLOROPHYLL A × 588 PHYLLOQUINONE × 6 IRON/SULFUR CLUSTER × 9 BETA-CAROTENE × 135 DODECYL-BETA-D-MALTOSIDE × 3 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAE_SYNY3
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–74； UniProt 1–74 Author chain P； PDBConstruct 1–74； UniProt 1–74 Author chain e； PDBConstruct 1–74； UniProt 1–74

Photosystem I reaction center subunit III

OrganismNot specified

UniProt P29256

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 51	Photosystem I P700 chlorophyll a apoprotein A1 × 3 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 3 （P29255） Photosystem I iron-sulfur center × 3 （P32422） Photosystem I reaction center subunit II × 3 （P19569） Photosystem I reaction center subunit IV × 3 （P12975） Photosystem I reaction center subunit VIII × 3 （Q55330） Photosystem I reaction center subunit IX × 3 （Q55329） Photosystem I reaction center subunit XI × 3 （P37277） Photosystem I reaction center subunit XII × 3 （P72986） Iron stress-induced chlorophyll-binding protein × 18 （Q55274） Photosystem I reaction center subunit PsaK 1 × 3 （P72712） 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 9 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 15 CHLOROPHYLL A ISOMER × 3 CHLOROPHYLL A × 588 PHYLLOQUINONE × 6 IRON/SULFUR CLUSTER × 9 BETA-CAROTENE × 135 DODECYL-BETA-D-MALTOSIDE × 3 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAF_SYNY3
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–165； UniProt 1–165 Author chain Q； PDBConstruct 1–165； UniProt 1–165 Author chain f； PDBConstruct 1–165； UniProt 1–165

Photosystem I reaction center subunit VIII

OrganismNot specified

UniProt Q55330

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 51	Photosystem I P700 chlorophyll a apoprotein A1 × 3 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 3 （P29255） Photosystem I iron-sulfur center × 3 （P32422） Photosystem I reaction center subunit II × 3 （P19569） Photosystem I reaction center subunit IV × 3 （P12975） Photosystem I reaction center subunit III × 3 （P29256） Photosystem I reaction center subunit IX × 3 （Q55329） Photosystem I reaction center subunit XI × 3 （P37277） Photosystem I reaction center subunit XII × 3 （P72986） Iron stress-induced chlorophyll-binding protein × 18 （Q55274） Photosystem I reaction center subunit PsaK 1 × 3 （P72712） 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 9 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 15 CHLOROPHYLL A ISOMER × 3 CHLOROPHYLL A × 588 PHYLLOQUINONE × 6 IRON/SULFUR CLUSTER × 9 BETA-CAROTENE × 135 DODECYL-BETA-D-MALTOSIDE × 3 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAI_SYNY3
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain I； PDBConstruct 1–40； UniProt 1–40 Author chain R； PDBConstruct 1–40； UniProt 1–40 Author chain i； PDBConstruct 1–40； UniProt 1–40

Photosystem I reaction center subunit IX

OrganismNot specified

UniProt Q55329

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 51	Photosystem I P700 chlorophyll a apoprotein A1 × 3 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 3 （P29255） Photosystem I iron-sulfur center × 3 （P32422） Photosystem I reaction center subunit II × 3 （P19569） Photosystem I reaction center subunit IV × 3 （P12975） Photosystem I reaction center subunit III × 3 （P29256） Photosystem I reaction center subunit VIII × 3 （Q55330） Photosystem I reaction center subunit XI × 3 （P37277） Photosystem I reaction center subunit XII × 3 （P72986） Iron stress-induced chlorophyll-binding protein × 18 （Q55274） Photosystem I reaction center subunit PsaK 1 × 3 （P72712） 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 9 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 15 CHLOROPHYLL A ISOMER × 3 CHLOROPHYLL A × 588 PHYLLOQUINONE × 6 IRON/SULFUR CLUSTER × 9 BETA-CAROTENE × 135 DODECYL-BETA-D-MALTOSIDE × 3 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAJ_SYNY3
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain J； PDBConstruct 1–40； UniProt 1–40 Author chain S； PDBConstruct 1–40； UniProt 1–40 Author chain j； PDBConstruct 1–40； UniProt 1–40

Photosystem I reaction center subunit XI

OrganismNot specified

UniProt P37277

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 51	Photosystem I P700 chlorophyll a apoprotein A1 × 3 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 3 （P29255） Photosystem I iron-sulfur center × 3 （P32422） Photosystem I reaction center subunit II × 3 （P19569） Photosystem I reaction center subunit IV × 3 （P12975） Photosystem I reaction center subunit III × 3 （P29256） Photosystem I reaction center subunit VIII × 3 （Q55330） Photosystem I reaction center subunit IX × 3 （Q55329） Photosystem I reaction center subunit XII × 3 （P72986） Iron stress-induced chlorophyll-binding protein × 18 （Q55274） Photosystem I reaction center subunit PsaK 1 × 3 （P72712） 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 9 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 15 CHLOROPHYLL A ISOMER × 3 CHLOROPHYLL A × 588 PHYLLOQUINONE × 6 IRON/SULFUR CLUSTER × 9 BETA-CAROTENE × 135 DODECYL-BETA-D-MALTOSIDE × 3 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAL_SYNY3
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain L； PDBConstruct 1–157； UniProt 1–157 Author chain U； PDBConstruct 1–157； UniProt 1–157 Author chain l； PDBConstruct 1–157； UniProt 1–157

Photosystem I reaction center subunit XII

OrganismNot specified

UniProt P72986

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 51	Photosystem I P700 chlorophyll a apoprotein A1 × 3 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 3 （P29255） Photosystem I iron-sulfur center × 3 （P32422） Photosystem I reaction center subunit II × 3 （P19569） Photosystem I reaction center subunit IV × 3 （P12975） Photosystem I reaction center subunit III × 3 （P29256） Photosystem I reaction center subunit VIII × 3 （Q55330） Photosystem I reaction center subunit IX × 3 （Q55329） Photosystem I reaction center subunit XI × 3 （P37277） Iron stress-induced chlorophyll-binding protein × 18 （Q55274） Photosystem I reaction center subunit PsaK 1 × 3 （P72712） 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 9 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 15 CHLOROPHYLL A ISOMER × 3 CHLOROPHYLL A × 588 PHYLLOQUINONE × 6 IRON/SULFUR CLUSTER × 9 BETA-CAROTENE × 135 DODECYL-BETA-D-MALTOSIDE × 3 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAM_SYNY3
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain M； PDBConstruct 1–31； UniProt 1–31 Author chain V； PDBConstruct 1–31； UniProt 1–31 Author chain m； PDBConstruct 1–31； UniProt 1–31

Iron stress-induced chlorophyll-binding protein

OrganismNot specified

UniProt Q55274

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 51	Photosystem I P700 chlorophyll a apoprotein A1 × 3 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 3 （P29255） Photosystem I iron-sulfur center × 3 （P32422） Photosystem I reaction center subunit II × 3 （P19569） Photosystem I reaction center subunit IV × 3 （P12975） Photosystem I reaction center subunit III × 3 （P29256） Photosystem I reaction center subunit VIII × 3 （Q55330） Photosystem I reaction center subunit IX × 3 （Q55329） Photosystem I reaction center subunit XI × 3 （P37277） Photosystem I reaction center subunit XII × 3 （P72986） Photosystem I reaction center subunit PsaK 1 × 3 （P72712） 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 9 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 15 CHLOROPHYLL A ISOMER × 3 CHLOROPHYLL A × 588 PHYLLOQUINONE × 6 IRON/SULFUR CLUSTER × 9 BETA-CAROTENE × 135 DODECYL-BETA-D-MALTOSIDE × 3 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ISIA_SYNY3
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain W； PDBConstruct 1–342； UniProt 1–342 Author chain X； PDBConstruct 1–342； UniProt 1–342 Author chain Y； PDBConstruct 1–342； UniProt 1–342 Author chain Z； PDBConstruct 1–342； UniProt 1–342 Author chain g； PDBConstruct 1–342； UniProt 1–342 Author chain h； PDBConstruct 1–342； UniProt 1–342 Author chain n； PDBConstruct 1–342； UniProt 1–342 Author chain o； PDBConstruct 1–342； UniProt 1–342 Author chain p； PDBConstruct 1–342； UniProt 1–342 Author chain q； PDBConstruct 1–342； UniProt 1–342 Author chain r； PDBConstruct 1–342； UniProt 1–342 Author chain s； PDBConstruct 1–342； UniProt 1–342 Author chain t； PDBConstruct 1–342； UniProt 1–342 Author chain u； PDBConstruct 1–342； UniProt 1–342 Author chain v； PDBConstruct 1–342； UniProt 1–342 Author chain w； PDBConstruct 1–342； UniProt 1–342 Author chain x； PDBConstruct 1–342； UniProt 1–342 Author chain y； PDBConstruct 1–342； UniProt 1–342

Photosystem I reaction center subunit PsaK 1

OrganismNot specified

UniProt P72712

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 51	Photosystem I P700 chlorophyll a apoprotein A1 × 3 （P29254） Photosystem I P700 chlorophyll a apoprotein A2 × 3 （P29255） Photosystem I iron-sulfur center × 3 （P32422） Photosystem I reaction center subunit II × 3 （P19569） Photosystem I reaction center subunit IV × 3 （P12975） Photosystem I reaction center subunit III × 3 （P29256） Photosystem I reaction center subunit VIII × 3 （Q55330） Photosystem I reaction center subunit IX × 3 （Q55329） Photosystem I reaction center subunit XI × 3 （P37277） Photosystem I reaction center subunit XII × 3 （P72986） Iron stress-induced chlorophyll-binding protein × 18 （Q55274） 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 9 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 15 CHLOROPHYLL A ISOMER × 3 CHLOROPHYLL A × 588 PHYLLOQUINONE × 6 IRON/SULFUR CLUSTER × 9 BETA-CAROTENE × 135 DODECYL-BETA-D-MALTOSIDE × 3 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAK1_SYNY3
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain K； PDBConstruct 1–86； UniProt 1–86 Author chain T； PDBConstruct 1–86； UniProt 1–86 Author chain k； PDBConstruct 1–86； UniProt 1–86

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6nwa
Deposition date deposition_date	2019-02-06
Structure title title	The structure of the photosystem I IsiA super-complex
Keywords keywords	Photosystem, Antenna, Chlorophyll, Membrane, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6nwa__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6nwa__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6nwa__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	97.02 Å
Rg (electron density)	97.40 Å
Total Rg	96.85 Å
Atom count	137509
Residues	12666
Excluded volume	2567500 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6nwa__assembly_1__model_1`	51-meric （51）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (21)

Entity 1 Entity 1 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	83022.4 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,a,H
Atom count atom_count	137509

MTISPPEREAKAKVSVDNNPVPTSFEKWGKPGHFDRTLARGPKTTTWIWNLHANAHDFDSQTSDLEDVSRKIFSAHFGHLAVVFVWLSGMYFHGAKFSNYEGWLADPTHIKPSAQVVWPIVGQGILNGDVGGGFHGIQITSGLFYLWRASGFTDSYQLYCTAIGGLVMAALMLFAGWFHYHVKAPKLEWFQNVESMMNHHLAGLLGLGSLGWAGHQIHVSMPINKLLDAGVAPKDIPLPHEFILEPSKMAELYPSFAQGLTPFFTLNWGVYSDFLTFKGGLNPVTGGLWLSDTAHHHLAIAVLFIIAGHMYRTNWGIGHSMKEILEAHKGPFTGEGHKGLYEILTTSWHAQLAINLALLGSLTIIVAQHMYAMPPYPYQAIDYATQLSLFTHHMWIGGFLIVGAGAHGAIFMVRDYDPAKNVNNLLDRMLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMRALGRPQDMFSDTAIQLQPIFAQWVQHLHTLAPGATAPNALATASYAFGGETIAVAGKVAMMPITLGTADFMVHHIHAFTIHVTALILLKGVLYARSSRLVPDKANLGFRFPCDGPGRGGTCQVSGWDHVFLGLFWMYNSLSVVIFHFSWKMQSDVWGTVSPDGSVTHVTLGNFAQSAITINGWLRDFLWAQAANVINSYGSALSAYGIMFLAGHFVFAFSLMFLFSGRGYWQELIESIVWAHNKLNVAPAIQPRALSIIQGRAVGVAHYLLGGIVTTWAFFLARSLSIG

Entity 2 Entity 2 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	81369.5 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,b,G

MATKFPKFSQDLAQDPTTRRIWYGIATAHDFETHDGMTEENLYQKIFASHFGHIAIIFLWTSGTLFHVAWQGNFEQWIKDPLNIRPIAHAIWDPHFGEGAVNAFTQAGASNPVNIAYSGVYHWFYTIGMTTNQELYSGAVFLLVLASLFLFAGWLHLQPKFRPSLAWFKNAESRLNHHLAGLFGVSSLAWAGHLVHVAIPEARGQHVGWDNFLSTPPHPAGLMPFFTGNWGVYAADPDTAGHIFGTSEGAGTAILTFLGGFHPQTESLWLTDIAHHHLAIAVIFIIAGHMYRTNWGIGHSIKEILNAHKGPLTGAGHTNLYDTINNSLHFQLGLALASLGVITSLVAQHMYSLPSYAFIAQDHTTQAALYTHHQYIAGFLMVGAFAHGAIFFVRDYDPVANKDNVLARMLEHKEALISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQILIEPVFAQWIQATSGKALYGFDVLLSNPDSIASTTGAAWLPGWLDAINSGTNSLFLTIGPGDFLVHHAIALGLHTTALILIKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFYLAMFWMLNTLGWLTFYWHWKHLGVWSGNVAQFNENSTYLMGWFRDYLWANSAQLINGYNPYGVNNLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETIVWAHERTPLANLVRWKDKPVALSIVQARLVGLAHFTVGYVLTYAAFLIASTAGKFG

Entity 3 Entity 3 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8837.3 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,c,N

MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAAQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLAY

Entity 4 Entity 4 polymer

Description description	Photosystem I reaction center subunit II
Molecular weight formula_weight	15663.7 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,d,O

MTELSGQPPKFGGSTGGLLSKANREEKYAITWTSASEQVFEMPTGGAAIMNEGENLLYLARKEQCLALGTQLRTKFKPKIQDYKIYRVYPSGEVQYLHPADGVFPEKVNEGREAQGTKTRRIGQNPEPVTIKFSGKAPYEV

Entity 5 Entity 5 polymer

Description description	Photosystem I reaction center subunit IV
Molecular weight formula_weight	8154.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,e,P

MALNRGDKVRIKRTESYWYGDVGTVASVEKSGILYPVIVRFDRVNYNGFSGSASGVNTNNFAENELELVQAAAK

Entity 6 Entity 6 polymer

Description description	Photosystem I reaction center subunit III
Molecular weight formula_weight	18267.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,f,Q

MKHLLALLLAFTLWFNFAPSASADDFANLTPCSENPAYLAKSKNFLNTTNDPNSGKIRAERYASALCGPEGYPHLIVDGRFTHAGDFLIPSILFLYIAGWIGWVGRSYLIEIRESKNPEMQEVVINVPLAIKKMLGGFLWPLAAVGEYTSGKLVMKDSEIPTSPR

Entity 7 Entity 7 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	4414.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,i,R

MDGSYAASYLPWILIPMVGWLFPAVTMGLLFIHIESEGEG

Entity 8 Entity 8 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	4535.4 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,j,S

MDGLKSFLSTAPVMIMALLTFTAGILIEFNRFYPDLLFHP

Entity 9 Entity 9 polymer

Description description	Photosystem I reaction center subunit XI
Molecular weight formula_weight	16631.8 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,l,U

MAESNQVVQAYNGDPFVGHLSTPISDSAFTRTFIGNLPAYRKGLSPILRGLEVGMAHGYFLIGPWTLLGPLRDSEYQYIGGLIGALALILVATAALSSYGLVTFQGEQGSGDTLQTADGWSQFAAGFFVGGMGGAFVAYFLLENLSVVDGIFRGLFN

Entity 10 Entity 10 polymer

Description description	Photosystem I reaction center subunit XII
Molecular weight formula_weight	3382.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,m,V

MALSDTQILAALVVALLPAFLAFRLSTELYK

Entity 11 Entity 11 polymer

Description description	Iron stress-induced chlorophyll-binding protein
Molecular weight formula_weight	37250.7 kDa
Source method src_method	nat
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W,X,Y,Z,g,y,n,o,p,q,r,h,t,u,s,w,x,v

MQTYGNDTVQYEWWAGNARFADQSGLFIAAHVAQAALTAFWAGAFTLFEISRFDPTQAMGDQGLILLPHLATLGWGVGDGGQIVDTYPYFVIGSIHLIASAVLGAGALFHTLRAPADLSTLKGQGKKFHFTWENPQQLGIILGHHLLFLGAGALLLAGKAMYWGGLYDATTQTVRLVSQPTLDPLVIYGYQTHFASISSLEDLVGGHIFVGFLLIGGGIWHILVPPLGWAKKVLLFSGEAILSYSLGGIALAGFVAAYFCAVNTLAYPPEFYGPPLAIKLGIFPYFADTVELPMHAHTSRAWLANAHFFLAFFFLQGHLWHALRALGFDFKRVEQAFDSLQT

Entity 12 Entity 12 polymer

Description description	Photosystem I reaction center subunit PsaK 1
Molecular weight formula_weight	8649.3 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k,K,T

MHSFLLATAVPATLSWSPKVAGVMIACNILAIAFGKLTIKQQNVGTPMPSSNFFGGFGLGAVLGTASFGHILGAGVILGLANMGVL

Entity 13 Entity 13 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 14 Entity 14 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	15

Entity 15 Entity 15 non-polymer

Description description	CHLOROPHYLL A ISOMER
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 16 Entity 16 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	588

Entity 17 Entity 17 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 18 Entity 18 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 19 Entity 19 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	135

Entity 20 Entity 20 non-polymer

Description description	DODECYL-BETA-D-MALTOSIDE
Molecular weight formula_weight	510.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 21 Entity 21 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	3

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.48 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	74000

The structure of the photosystem I IsiA super-complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit II

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IV

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit III

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit XI

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit XII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer