6xf4

Crystal structure of STING REF variant in complex with E7766

Method: X-RAY DIFFRACTION D_max: 75.0 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Stimulator of interferon genes protein

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 155–341 Chain B； UniProt 155–341	Not recorded	V5V (1R,3R,15E,28R,29R,30R,31R,34R,36R,39S,41R)-29,41-difluoro-34,39-disulfanyl-2,33,35,38,40,42-hexaoxa-4,6,9,11,13,18,20,22,25,27-decaaza-34,39-diphosphaoctacyclo[28.6.4.1~3,36~.1~28,31~.0~4,8~.0~7,12~.0~19,24~.0~23,27~]dotetraconta-5,7,9,11,15,19,21,23,25-nonaene 34,39-dioxide (non-preferred name) × 1 EDO 1,2-ETHANEDIOL × 6	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；291 K；0.1M HEPES pH 7.5, 0.2M CaCl2, 15% (w/v) PEG 8000	Resolution 2.77 Å R-free 0.271

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6XF4	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4EF4 Crystal structure of STING CTD complex with c-di-GMP Deposited 2012-03-29	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 139–379（241 aa） Fragment：C-TERMINAL DOMAIN Chain B 139–379（241 aa） Fragment：C-TERMINAL DOMAIN	Not recorded	C2E 9,9'-[(2R,3R,3aS,5S,7aR,9R,10R,10aS,12S,14aR)-3,5,10,12-tetrahydroxy-5,12-dioxidooctahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-2,9-diyl]bis(2-amino-1,9-dihydro-6H-purin-6-one) × 1 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；289 K；14.4%(w/v) PEG8000, 0.08M Cacodylate, 0.16M calcium acetate, 20%(v/v) glycerol, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 2.15 Å R-free 0.257
4EF5 Crystal structure of STING CTD Deposited 2012-03-29	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 139–379（241 aa） Fragment：C-TERMINAL DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；289 K；14.4%(w/v) PEG8000, 0.08M Cacodylate, 0.16M calcium acetate, 20%(v/v) glycerol, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 2.45 Å R-free 0.288
4EMT Crystal Structure of human STING bound to c-di-GMP Deposited 2012-04-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 155–341（187 aa） Fragment：UNP residues 155 - 341 Chain B 155–341（187 aa） Fragment：UNP residues 155 - 341	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	C2E 9,9'-[(2R,3R,3aS,5S,7aR,9R,10R,10aS,12S,14aR)-3,5,10,12-tetrahydroxy-5,12-dioxidooctahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-2,9-diyl]bis(2-amino-1,9-dihydro-6H-purin-6-one) × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；28% PEG400, 0.2M CaCl2, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.50 Å R-free 0.210
4EMT Crystal Structure of human STING bound to c-di-GMP Deposited 2012-04-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 155–341（187 aa） Fragment：UNP residues 155 - 341 Chain B 155–341（187 aa） Fragment：UNP residues 155 - 341	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	C2E 9,9'-[(2R,3R,3aS,5S,7aR,9R,10R,10aS,12S,14aR)-3,5,10,12-tetrahydroxy-5,12-dioxidooctahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-2,9-diyl]bis(2-amino-1,9-dihydro-6H-purin-6-one) × 2 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；28% PEG400, 0.2M CaCl2, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.50 Å R-free 0.210
4EMU Crystal structure of ligand free human STING Deposited 2012-04-12	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 155–341（187 aa） Fragment：UNP residues 155 - 341 Chain B 155–341（187 aa） Fragment：UNP residues 155 - 341	Not recorded	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；0.1 M HEPES, pH 8.5, 28% PEG400, 0.2M CaCl2, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.90 Å R-free 0.248
4EMU Crystal structure of ligand free human STING Deposited 2012-04-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 155–341（187 aa） Fragment：UNP residues 155 - 341 Chain B 155–341（187 aa） Fragment：UNP residues 155 - 341	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；0.1 M HEPES, pH 8.5, 28% PEG400, 0.2M CaCl2, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.90 Å R-free 0.248
4F5D ERIS/STING in complex with ligand Deposited 2012-05-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 141–379（239 aa） Fragment：UNP residues 141-379 Chain B 141–379（239 aa） Fragment：UNP residues 141-379	Mutation：G230A Mutation：G230A	C2E 9,9'-[(2R,3R,3aS,5S,7aR,9R,10R,10aS,12S,14aR)-3,5,10,12-tetrahydroxy-5,12-dioxidooctahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-2,9-diyl]bis(2-amino-1,9-dihydro-6H-purin-6-one) × 1 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；289 K；0.025M MgSO4, 0.05M Tris-HCl pH 8.5, 1.8M AmSO4, VAPOR DIFFUSION, SITTING DROP, temperature 289K	Resolution 3.00 Å R-free 0.242
4F5E Crystal structure of ERIS/STING Deposited 2012-05-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 141–379（239 aa） Fragment：UNP residues 141-379	Mutation：G230A	EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；289 K；25.0% PEG 3350, 0.1M Bis-tris pH 6.5, 0.2M NH4-acetate, 5% Glycerol, 0.025% Dichloromethane, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 2.60 Å R-free 0.255
4F5W Crystal structure of ligand free human STING CTD Deposited 2012-05-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 149–379（231 aa） Fragment：UNP RESIDUES 149-379	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.08M Sodium cacodylate pH 6.5, 0.16M Calcium acetate, 15% PEG 8000, 20% glycerol, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.20 Å R-free 0.275
4F5Y Crystal structure of human STING CTD complex with C-di-GMP Deposited 2012-05-13	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 149–379（231 aa） Fragment：UNP RESIDUES 149-379 Chain B 149–379（231 aa） Fragment：UNP RESIDUES 149-379	Not recorded	CA CALCIUM ION × 2 C2E 9,9'-[(2R,3R,3aS,5S,7aR,9R,10R,10aS,12S,14aR)-3,5,10,12-tetrahydroxy-5,12-dioxidooctahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-2,9-diyl]bis(2-amino-1,9-dihydro-6H-purin-6-one) × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；15% PEG 8000, 0.08M sodium cacodylate pH6.5, 0.16M calcium acetate and 20% glycerol, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.40 Å R-free 0.275
4F9E Cyclic di-GMP Sensing via the Innate Immune Signaling Protein STING Deposited 2012-05-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 139–379（241 aa） Fragment：C-terminal Domain (unp residues 139-379)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.75 Å R-free 0.258
4F9G Crystal structure of STING complex with Cyclic di-GMP. Deposited 2012-05-18	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 139–379（241 aa） Fragment：C-terminal Domain (unp residues 139-379) Chain C 139–379（241 aa） Fragment：C-terminal Domain (unp residues 139-379)	Not recorded	C2E 9,9'-[(2R,3R,3aS,5S,7aR,9R,10R,10aS,12S,14aR)-3,5,10,12-tetrahydroxy-5,12-dioxidooctahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-2,9-diyl]bis(2-amino-1,9-dihydro-6H-purin-6-one) × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；289 K；12-15% PEG8000, 0.08 M sodium cacodylate pH 6.3-6.5, 0.16 M calcium acetate and 20% glycerol, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 2.95 Å R-free 0.255
4KSY Crystal structure of STING in complex with cGAMP Deposited 2013-05-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 138–379（242 aa） Fragment：UNP residues 138-379	Not recorded	1SY cGAMP × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；27% PEG 3,350, 0.1 M Bis-Tris, pH 6.8, 0.2 M NaCl, VAPOR DIFFUSION, HANGING DROP	Resolution 1.88 Å R-free 0.181
4LOH Crystal structure of hSTING(H232) in complex with c[G(2',5')pA(3',5')p] Deposited 2013-07-12	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 155–341（187 aa） Fragment：c-di-GMP-binding domain Chain B 155–341（187 aa） Fragment：c-di-GMP-binding domain	Not recorded	1SY cGAMP × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；0.01 M NiCl2, 0.1 M Tris, 20% PEG2000, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.25 Å R-free 0.215
4LOI Crystal structure of hSTING(H232) in complex with c[G(2',5')pA(2',5')p] Deposited 2013-07-12	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 155–341（187 aa） Fragment：c-di-GMP-binding domain Chain B 155–341（187 aa） Fragment：c-di-GMP-binding domain	Not recorded	PO4 PHOSPHATE ION × 1 1YC 2-amino-9-[(1R,3R,6R,8R,9R,11S,14R,16R,17R,18R)-16-(6-amino-9H-purin-9-yl)-3,11,17,18-tetrahydroxy-3,11-dioxido-2,4,7,10,12,15-hexaoxa-3,11-diphosphatricyclo[12.2.1.1~6,9~]octadec-8-yl]-1,9-dihydro-6H-purin-6-one × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.2；293 K；1.6 M NaH2PO4, 0.4 M Na2HPO4, 0.1 M phosphate-citrate, pH 4.2, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 1.89 Å R-free 0.199
4QXO Crystal structure of hSTING(group2) in complex with DMXAA Deposited 2014-07-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 155–341（187 aa） Fragment：C-TERMINAL DOMAIN (UNP residues 155-341)	Mutation：L222R, K224M, T229N, G230I, H232R, D237N, I244V	1YE (5,6-dimethyl-9-oxo-9H-xanthen-4-yl)acetic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.8；293 K；2 M LiCl, 10% PEG6000, 0.01 M CaCl2, 0.1 M Tris, pH 7.8, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 1.88 Å R-free 0.218
4QXP Crystal structure of hSTING(G230I) in complex with DMXAA Deposited 2014-07-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 155–341（187 aa） Fragment：C-TERMINAL DOMAIN (UNP RESIDUES 155-341) Chain B 155–341（187 aa） Fragment：C-TERMINAL DOMAIN (UNP RESIDUES 155-341)	Mutation：G230I, H232R Mutation：G230I, H232R	1YE (5,6-dimethyl-9-oxo-9H-xanthen-4-yl)acetic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.1；293 K；0.2 M Li2SO4, 20% PEG 3350, 0.015 mM CYMAL-7, 0.1 M Tris, pH 8.1, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.51 Å R-free 0.239
4QXQ Crystal structure of hSTING(S162A/Q266I) in complex with DMXAA Deposited 2014-07-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 155–341（187 aa） Fragment：C-TERMINAL DOMAIN (UNP RESIDUES 155-341) Chain B 155–341（187 aa） Fragment：C-TERMINAL DOMAIN (UNP RESIDUES 155-341)	Mutation：S162A, H232R, Q266I Mutation：S162A, H232R, Q266I	1YE (5,6-dimethyl-9-oxo-9H-xanthen-4-yl)acetic acid × 2 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.1；293 K；0.2 M Ca(Ac)2, 15% PEG3000, 0.01 M L-Proline, 0.1 M NaAc, pH 5.1, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.42 Å R-free 0.229
4QXR Crystal structure of hSTING(S162A/G230I/Q266I) in complex with DMXAA Deposited 2014-07-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 155–341（187 aa） Fragment：C-TERMINAL DOMAIN (UNP RESIDUES 155-341) Chain B 155–341（187 aa） Fragment：C-TERMINAL DOMAIN (UNP RESIDUES 155-341)	Mutation：S162A, G230I, H232R, Q266I Mutation：S162A, G230I, H232R, Q266I	1YE (5,6-dimethyl-9-oxo-9H-xanthen-4-yl)acetic acid × 2 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.1；293 K；0.2 M Ca(Ac)2, 15% PEG3000, 0.1 M LiCl, 0.1 M NaAc, pH 5.1, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.37 Å R-free 0.231
5BQX Crystal structure of human STING in complex with 3'2'-cGAMP Deposited 2015-05-29	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 138–379（242 aa）	Not recorded	4UR 3'2'-cGAMP × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.8；293 K；0.2 M ammonium acetate, 0.1 M trisodium citrate, pH 5.8, 25% PEG4000	Resolution 2.00 Å R-free 0.226
5JEJ Phosphorylated STING in complex with IRF-3 CTD Deposited 2016-04-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 342–379（38 aa） Fragment：UNP residues 342-379 Chain D 342–379（38 aa） Fragment：UNP residues 342-379 Chain E 342–379（38 aa） Fragment：UNP residues 342-379	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M Bis-Tris, pH 5.5, 200 mM MgCl2, 20% PEG 3350	Resolution 2.00 Å R-free 0.237
6CFF Stimulator of Interferon Genes Human Deposited 2018-02-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 139–379（241 aa）	Not recorded	2BA (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8 ]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.2；285 K；Sodium citrate tribasic, PEG 3350, pH 8.2	Resolution 2.40 Å R-free 0.249
6CY7 Human Stimulator of Interferon Genes Deposited 2018-04-04	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 139–379（241 aa） Fragment：UNP residues 139-379	Not recorded	2BA (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8 ]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide × 2 IMD IMIDAZOLE × 2 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；285 K；ammonium citrate tribasic, imidazole, PEG5000 MME	Resolution 2.20 Å R-free 0.258
6DNK Human Stimulator of Interferon Genes Deposited 2018-06-06	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 154–337（184 aa）	Not recorded	1SY cGAMP × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.7；285 K；Sodium sulfate, PEG 3350	Resolution 1.95 Å R-free 0.241
6MX0 Crystal structure of human STING apoprotein (G230A, H232R, R293Q) Deposited 2018-10-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 155–341（187 aa） Fragment：C-terminal domain Chain B 155–341（187 aa） Fragment：C-terminal domain	Mutation：G230A,H232R,R293Q Mutation：G230A,H232R,R293Q	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8；277 K；31.0 v/v PEG 400, 0.1 M Tris hydrochloride, 0.2 M calcium chloride	Resolution 1.73 Å R-free 0.220
6MX3 Crystal structure of human STING (G230A, H232R, R293Q) in complex with Compound 1 Deposited 2018-10-30	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 155–341（187 aa） Chain B 155–341（187 aa）	Mutation：G230A, H232R, R293Q Mutation：G230A, H232R, R293Q	K5P (3S,4S)-2-(4-tert-butylphenyl)-3-(4-methoxyphenyl)-1-oxo-1,2,3,4-tetrahydroisoquinoline-4-carboxylic acid × 2 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；277 K；33.0 v/v PEG 400 0.1 M Tris hydrochloride pH 8.0 0.2 M calcium chloride	Resolution 1.36 Å R-free 0.202
6MXE Crystal structure of human STING (G230A, H232R, R293Q) in complex with Compound 18 Deposited 2018-10-30	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 155–341（187 aa） Chain B 155–341（187 aa）	Mutation：G230A,H232R,R293Q Mutation：G230A,H232R,R293Q	K5S [(3S,4S)-2-(4-tert-butyl-3-chlorophenyl)-3-(2,3-dihydro-1,4-benzodioxin-6-yl)-7-fluoro-1-oxo-1,2,3,4-tetrahydroisoquinolin-4-yl]acetic acid × 2 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8；277 K；0.2 M CaCl2 29.0 v/v PEG 400 0.1 M TRIS 0.002 M DTT	Resolution 2.47 Å R-free 0.248
6O8B Crystal structure of STING CTD in complex with TBK1 Deposited 2019-03-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 155–379（225 aa） Chain E 155–379（225 aa）	Mutation：T376E, F378M,S379W Mutation：T376E, F378M,S379W	BX7 N-(3-{[5-iodo-4-({3-[(thiophen-2-ylcarbonyl)amino]propyl}amino)pyrimidin-2-yl]amino}phenyl)pyrrolidine-1-carboxamide × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；277 K；0.8 M (NH4)2SO4, 0.1 M BIS-TRIS pH 5.5 and 1% PEG3350	Resolution 3.40 Å R-free 0.258
6O8C Crystal structure of STING CTT in complex with TBK1 Deposited 2019-03-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 342–379（38 aa） Chain E 342–379（38 aa）	Mutation：V343W Mutation：V343W	BX7 N-(3-{[5-iodo-4-({3-[(thiophen-2-ylcarbonyl)amino]propyl}amino)pyrimidin-2-yl]amino}phenyl)pyrrolidine-1-carboxamide × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；18% v/v tacsimate pH 7.0, 0.1 M HEPES pH 7.0, 2% PEG3350	Resolution 3.17 Å R-free 0.231
6XF3 Crystal structure of STING in complex with E7766 Deposited 2020-06-15	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 155–341（187 aa） Chain B 155–341（187 aa）	Not recorded	V5V (1R,3R,15E,28R,29R,30R,31R,34R,36R,39S,41R)-29,41-difluoro-34,39-disulfanyl-2,33,35,38,40,42-hexaoxa-4,6,9,11,13,18,20,22,25,27-decaaza-34,39-diphosphaoctacyclo[28.6.4.1~3,36~.1~28,31~.0~4,8~.0~7,12~.0~19,24~.0~23,27~]dotetraconta-5,7,9,11,15,19,21,23,25-nonaene 34,39-dioxide (non-preferred name) × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；291 K；0.1M HEPES pH 7.5, 0.2M CaCl2, 15% (w/v) PEG 8000	Resolution 2.38 Å R-free 0.261
6Y99 hSTING mutant R232K in complex with 2',3'-cGAMP Deposited 2020-03-06	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 140–343（204 aa）	Not recorded	1SY cGAMP × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；0.2 M tri-Sodium Citrate dihydrate 20% (w/v) PEG 3350	Resolution 2.98 Å R-free 0.284
6YWA Human REF STING in complex with 3',3'-c-[2'FdAMP-2'FdAM(PS)] Deposited 2020-04-29	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 140–343（204 aa） Chain B 140–343（204 aa）	Not recorded	GOL GLYCEROL × 1 PWB 3',3'-c-[2'FdAMP-2'FdAM(PS)] × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；0.1 M Citric acid pH 5.0, 20% PEG 6000	Resolution 2.31 Å R-free 0.244
7MHC Structure of human STING in complex with MK-1454 Deposited 2021-04-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 154–341（188 aa）	Mutation：G230A, H232R, R293Q	ZEV (2R,5R,7R,8S,10R,12aR,14R,15S,15aR,16R)-7-(2-amino-6-oxo-1,6-dihydro-9H-purin-9-yl)-14-(6-amino-9H-purin-9-yl)-15,16-difluoro-2,10-bis(sulfanyl)octahydro-2H,10H,12H-5,8-methano-2lambda~5~,10lambda~5~-furo[3,2-l][1,3,6,9,11,2,10]pentaoxadiphosphacyclotetradecine-2,10-dione × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；0.1 M TRIS; 0.2 M NaCl; 28.0 w/v PEG 6K	Resolution 2.32 Å R-free 0.224
7OB3 hSTING in complex with 3',3'-c-di-araAMP Deposited 2021-04-20	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 140–343（204 aa）	Not recorded	V7E 3',3'-c-di-araAMP × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.4；291 K；0.2 M Sodium chlorid, 0.1 M Tris pH 7.4, 30% PEG 300, 10 mM EDTA	Resolution 2.30 Å R-free 0.230
7Q3B Crystal structure of human STING in complex with 3'3'-c-(2'F,2'dA-isonucA)MP Deposited 2021-10-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 140–343（204 aa）	Not recorded	8SC 3'3'-c-(2'F,2'dA-isonucA)MP × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；0.2 M Lithium acetate, 20% (w/v) PEG 3350	Resolution 2.56 Å R-free 0.232
7Q85 Crystal structure of human STING in complex with MD1193 Deposited 2021-11-10	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 140–343（204 aa）	Not recorded	98F 9-[(1R,6R,8R,13E,15R,17R,18R)-17-(6-aminopurin-9-yl)-9,18-bis(fluoranyl)-3,12-bis(oxidanyl)-3,12-bis(oxidanylidene)-2,4,7,11,16-pentaoxa-3$l^{5},12$l^{5}-diphosphatricyclo[13.3.0.0^{6,10}]octadec-13-en-8-yl]purin-6-amine × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；0.2 M Lithium acetate, 20% (w/v) PEG 3350	Resolution 2.36 Å R-free 0.252
7R4H phospho-STING binding to adaptor protein complex-1 Deposited 2022-02-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain L 359–367（9 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	GTP GUANOSINE-5'-TRIPHOSPHATE × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；PBS buffer cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.34 Å
7SHO Crystal structure of hSTING in complex with c[2',3'-(ara-2'-G, ribo-3'-A)-MP] (RJ242) Deposited 2021-10-10	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 155–341（187 aa）	Not recorded	9UH (2R,5R,7R,8S,10R,12aR,14R,15R,15aS,16R)-7-(2-amino-6-oxo-1,6-dihydro-9H-purin-9-yl)-14-(6-amino-9H-purin-9-yl)-2,10,15,16-tetrahydroxyoctahydro-2H,10H,12H-5,8-methano-2lambda~5~,10lambda~5~-furo[3,2-l][1,3,6,9,11,2,10]pentaoxadiphosphacyclotetradecine-2,10-dione × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.2 M Potassium Sodium tartrate, 20% PEG3350	Resolution 2.25 Å R-free 0.222
7SHP Crystal structure of hSTING in complex with c[2',3'-(ribo-2'-G, xylo-3'-A)-MP](RJ244) Deposited 2021-10-11	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 155–341（187 aa） Chain B 155–341（187 aa）	Not recorded	9UR (2S,5R,7R,8R,10S,12aR,14R,15R,15aR,16R)-7-(2-amino-6-oxo-3,6-dihydro-9H-purin-9-yl)-14-(6-amino-9H-purin-9-yl)-2,10,15,16-tetrahydroxyoctahydro-2H,10H,12H-5,8-methano-2lambda~5~,10lambda~5~-furo[3,2-l][1,3,6,9,11,2,10]pentaoxadiphosphacyclotetradecine-2,10-dione × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.2 M potassium formate, 20% PEG3350	Resolution 2.20 Å R-free 0.251
7SHP Crystal structure of hSTING in complex with c[2',3'-(ribo-2'-G, xylo-3'-A)-MP](RJ244) Deposited 2021-10-11	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 155–341（187 aa） Chain D 155–341（187 aa）	Not recorded	9UR (2S,5R,7R,8R,10S,12aR,14R,15R,15aR,16R)-7-(2-amino-6-oxo-3,6-dihydro-9H-purin-9-yl)-14-(6-amino-9H-purin-9-yl)-2,10,15,16-tetrahydroxyoctahydro-2H,10H,12H-5,8-methano-2lambda~5~,10lambda~5~-furo[3,2-l][1,3,6,9,11,2,10]pentaoxadiphosphacyclotetradecine-2,10-dione × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.2 M potassium formate, 20% PEG3350	Resolution 2.20 Å R-free 0.251
7SII Human STING bound to both cGAMP and 1-[(2-chloro-6-fluorophenyl)methyl]-3,3-dimethyl-2-oxo-N-[(2,4,6-trifluorophenyl)methyl]-2,3-dihydro-1H-indole-6-carboxamide (Compound 53) Deposited 2021-10-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–344（344 aa） Chain B 1–344（344 aa） Chain C 1–344（344 aa） Chain D 1–344（344 aa）	Not recorded	9IM 1-[(2-chloro-6-fluorophenyl)methyl]-3,3-dimethyl-2-oxo-N-[(2,4,6-trifluorophenyl)methyl]-2,3-dihydro-1H-indole-6-carboxamide × 2 1SY cGAMP × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.45 Å
7T9U Crystal structure of hSTING with an agonist (SHR169224) Deposited 2021-12-20	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 149–345（197 aa）	Not recorded	CA CALCIUM ION × 2 GD2 (3S,4S)-2-[(1-ethyl-3-methyl-1H-pyrazole-5-carbonyl)amino]-4-(prop-2-en-1-yl)-4,5-dihydroimidazo[1,5,4-de][1,4]benzoxazine-8-carboxamide × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.07M CACODYLATE PH 6.8, 0.8M CALCIUM ACETATE, 13-15% PEG8000, AND 20% GLYCEROL	Resolution 2.46 Å R-free 0.233
7T9V Crystal structure of hSTING with the agonist, SHR171032 Deposited 2021-12-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 149–345（197 aa） Chain B 149–345（197 aa）	Not recorded	CA CALCIUM ION × 2 GC0 (3S,4S)-4-(3-{5-carbamoyl-2-[(1-ethyl-3-methyl-1H-pyrazole-5-carbonyl)amino]-7-methoxy-1H-benzimidazol-1-yl}propyl)-2-[(1-ethyl-3-methyl-1H-pyrazole-5-carbonyl)amino]-4,5-dihydroimidazo[1,5,4-de][1,4]benzoxazine-8-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.8；298 K；0.07M CACODYLATE PH 6.8, 0.8M CALCIUM ACETATE, 13-15% PEG8000, AND 20% GLYCEROL	Resolution 2.68 Å R-free 0.235
7X9P Crystal structure of human STING complexed with compound BSP17 Deposited 2022-03-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 150–379（230 aa）	Not recorded	A8A 4-[6-methoxy-5-[3-[[6-methoxy-2-(4-oxidanyl-4-oxidanylidene-butanoyl)-1-benzoselenophen-5-yl]oxy]propoxy]-1-benzoselenophen-2-yl]-4-oxidanylidene-butanoic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 7.5；293 K；PEG3350	Resolution 2.70 Å R-free 0.279
7X9Q Crystal structure of human STING complexed with compound BSP16 Deposited 2022-03-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 150–379（230 aa）	Not recorded	A9X (2R)-4-(5,6-dimethoxy-1-benzoselenophen-2-yl)-2-ethyl-4-oxidanylidene-butanoic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 7.5；293 K；PEG3350	Resolution 2.40 Å R-free 0.267
8A2H human STING in complex with 2',3'-cyclic-GMP-7-deazaphenyl-AMP Deposited 2022-06-03	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 140–379（240 aa） Chain B 140–379（240 aa）	Not recorded	OK6 2-azanyl-9-[(1~{R},6~{R},8~{R},9~{R},10~{S},15~{R},17~{R},18~{R})-8-(4-azanyl-5-phenyl-pyrrolo[2,3-d]pyrimidin-7-yl)-3,9,12,18-tetrakis(oxidanyl)-3,12-bis(oxidanylidene)-2,4,7,11,13,16-hexaoxa-3$l^{5},12$l^{5}-diphosphatricyclo[13.2.1.0^{6,10}]octadecan-17-yl]-1~{H}-purin-6-one × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；200mM ammonium nitrate, 20% (w/v) PEG 3350, 10mM EDTA	Resolution 2.69 Å R-free 0.285
8A2I human STING in complex with 2'-3'-cyclic-GMP-7-deaza(4-(2-naphthyl)phenyl)-AMP Deposited 2022-06-03	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 140–379（240 aa） Chain B 140–379（240 aa）	Not recorded	KWF 2-azanyl-9-[(1~{R},6~{R},8~{R},9~{R},10~{S},15~{R},17~{R},18~{R})-8-[4-azanyl-5-(4-naphthalen-2-ylphenyl)pyrrolo[2,3-d]pyrimidin-7-yl]-3,9,12,18-tetrakis(oxidanyl)-3,12-bis(oxidanylidene)-2,4,7,11,13,16-hexaoxa-3$l^{5},12$l^{5}-diphosphatricyclo[13.2.1.0^{6,10}]octadecan-17-yl]-3~{H}-purin-6-one × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；100 mM PIPES [pH 7.0], 100 mM magnesium formate dihydrate, 100 mM rubidium chloride, 25% (w/v) PEG smear high	Resolution 2.16 Å R-free 0.251
8A2J human STING in complex with 2'-3'-cyclic-GMP-7-deaza(4-biphenylyl)-AMP Deposited 2022-06-03	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 140–379（240 aa） Chain B 140–379（240 aa）	Not recorded	KWO 2-azanyl-9-[(1~{R},6~{R},8~{R},9~{R},10~{S},15~{R},17~{R},18~{R})-8-[4-azanyl-5-(4-phenylphenyl)pyrrolo[2,3-d]pyrimidin-7-yl]-3,9,12,18-tetrakis(oxidanyl)-3,12-bis(oxidanylidene)-2,4,7,11,13,16-hexaoxa-3$l^{5},12$l^{5}-diphosphatricyclo[13.2.1.0^{6,10}]octadecan-17-yl]-1~{H}-purin-6-one × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；100 mM citric acid, 20% (w/v) PEG 6000	Resolution 2.32 Å R-free 0.264
8A2K human STING in complex with 2'-3'-cyclic-GMP-7-deaza(4-[(2-naphthyloxy)methyl]phenyl)-AMP Deposited 2022-06-03	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 140–379（240 aa） Chain B 140–379（240 aa）	Not recorded	KXD 2-azanyl-9-[(1~{R},6~{R},8~{R},9~{R},10~{S},15~{R},17~{R},18~{R})-8-[4-azanyl-5-[4-(naphthalen-1-yloxymethyl)phenyl]pyrrolo[2,3-d]pyrimidin-7-yl]-3,9,12,18-tetrakis(oxidanyl)-3,12-bis(oxidanylidene)-2,4,7,11,13,16-hexaoxa-3$l^{5},12$l^{5}-diphosphatricyclo[13.2.1.0^{6,10}]octadecan-17-yl]-3~{H}-purin-6-one × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；100 mM PIPES [pH 7.0], 100 mM magnesium formate dihydrate, 100 mM rubidium chloride, 25% (w/v) PEG smear high, 10 mM EDTA, 100 mM tri-sodium citrate	Resolution 1.89 Å R-free 0.260
8B2J Crystal structure of human STING in complex with ADU-S100 Deposited 2022-09-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 138–379（242 aa）	Not recorded	GJF (1~{R},3~{S},6~{R},8~{R},9~{R},10~{S},12~{S},15~{R},17~{R},18~{R})-8,17-bis(6-aminopurin-9-yl)-3,12-bis(oxidanylidene)-3,12-bis(sulfanyl)-2,4,7,11,13,16-hexaoxa-3$l^{5},12$l^{5}-diphosphatricyclo[13.2.1.0^{6,10}]octadecane-9,18-diol × 1 CA CALCIUM ION × 1 NA SODIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；278 K；20% PEG 3350, 0.04 M Citric acid, 0.06 M BIS-TRIS propane pH 6.4	Resolution 2.17 Å R-free 0.285
8B2J Crystal structure of human STING in complex with ADU-S100 Deposited 2022-09-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 138–379（242 aa）	Not recorded	CA CALCIUM ION × 1 NA SODIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；278 K；20% PEG 3350, 0.04 M Citric acid, 0.06 M BIS-TRIS propane pH 6.4	Resolution 2.17 Å R-free 0.285
8FLK Cryo-EM structure of STING oligomer bound to cGAMP and NVS-STG2 Deposited 2022-12-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–344（344 aa） Chain B 1–344（344 aa） Chain C 1–344（344 aa） Chain D 1–344（344 aa）	Not recorded	1SY cGAMP × 2 Y6H 4-({[4-(2-tert-butyl-5,5-dimethyl-1,3-dioxan-2-yl)phenyl]methyl}amino)-3-methoxybenzoic acid × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 4.00 Å
8FLM Cryo-EM structure of STING oligomer bound to cGAMP, NVS-STG2 and C53 Deposited 2022-12-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–344（344 aa） Chain B 1–344（344 aa） Chain C 1–344（344 aa） Chain D 1–344（344 aa）	Not recorded	Y6H 4-({[4-(2-tert-butyl-5,5-dimethyl-1,3-dioxan-2-yl)phenyl]methyl}amino)-3-methoxybenzoic acid × 2 1SY cGAMP × 2 9IM 1-[(2-chloro-6-fluorophenyl)methyl]-3,3-dimethyl-2-oxo-N-[(2,4,6-trifluorophenyl)methyl]-2,3-dihydro-1H-indole-6-carboxamide × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 2.90 Å
8GJX Structure of the human STING receptor bound to 2'3'-cUA Deposited 2023-03-16	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 154–341（188 aa） Chain B 154–341（188 aa）	Not recorded	ZNT 2'3'-cUA × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.2 M Lithium Sulfate, 0.1 M Tris pH 8.5, 16% PEG 4000	Resolution 2.60 Å R-free 0.254
8GSZ Structure of STING SAVI-related mutant V147L Deposited 2022-09-07	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–379（379 aa） Chain B 1–379（379 aa）	Mutation：V147L Mutation：V147L	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.65 Å
8GT6 human STING With agonist HB3089 Deposited 2022-09-07	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–379（379 aa） Chain B 1–379（379 aa）	Not recorded	WJ6 1-[(2E)-4-{5-carbamoyl-2-[(1-ethyl-3-methyl-1H-pyrazole-5-carbonyl)amino]-7-[3-(morpholin-4-yl)propoxy]-1H-benzimidazol-1-yl}but-2-en-1-yl]-2-[(1-ethyl-3-methyl-1H-pyrazole-5-carbonyl)amino]-7-methyl-1H-furo[3,2-e]benzimidazole-5-carboxamide × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.47 Å
8IK3 Structure of Stimulator of interferon genes/ligand complex Deposited 2023-02-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–379（379 aa） Chain B 1–379（379 aa） Chain C 1–379（379 aa） Chain D 1–379（379 aa） Chain E 1–379（379 aa） Chain F 1–379（379 aa） Chain G 1–379（379 aa） Chain H 1–379（379 aa）	Not recorded	1SY cGAMP × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20mM HEPES, 150 mM NaCl, 1mM DTT cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
8P01 Crystal structure of human STING ectodomain in complex with BI 7446, a potent cyclic dinucleotide STING agonist with broad-spectrum variant activity for the treatment of cancer Deposited 2023-05-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 149–379（231 aa）	Not recorded	W78 3-[(1~{R},3~{R},6~{R},8~{R},9~{R},10~{R},12~{R},15~{R},17~{R},18~{R})-8-(6-aminopurin-9-yl)-9-fluoranyl-18-oxidanyl-3,12-bis(oxidanylidene)-3,12-bis(sulfanyl)-2,4,7,11,13,16-hexaoxa-3$l^{5},12$l^{5}-diphosphatricyclo[13.2.1.0^{6,10}]octadecan-17-yl]-6~{H}-imidazo[4,5-d]pyridazin-7-one × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；20% polyethelene glycol 3350, 200mM tri-sodium citrate	Resolution 2.09 Å R-free 0.262
8P45 Crystal structure of human STING in complex with the agonist MD1202D Deposited 2023-05-19	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 140–343（204 aa）	Not recorded	WY8 9-[(1~{S},3~{R},6~{R},8~{R},9~{R},10~{R},12~{R},15~{R},17~{R},18~{R})-8-(6-aminopurin-9-yl)-9,18-bis(fluoranyl)-3,12-bis(oxidanylidene)-3,12-bis(sulfanyl)-2,4,7,11,13-pentaoxa-3$l^{5},12$l^{5}-diphosphatricyclo[13.2.1.0^{6,10}]octadecan-17-yl]-1~{H}-purin-6-one × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；200 mM sodium chloride; 100 mM HEPES pH 7.5; 20 % w/v PEG 4000; 10 mM spermine, 10 mM spermidine, 10mM ornithine, 10 mM 1,4-diaminobutane	Resolution 3.23 Å R-free 0.259
8STH human STING with diABZI agonist 15 Deposited 2023-05-10	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 153–339（187 aa） Fragment：Cyclic dinucleotide-binding domain	Not recorded	WWU 1-[(2E)-4-{5-carbamoyl-2-[(4-ethyl-2-methyl-1,3-oxazole-5-carbonyl)amino]-7-(3-hydroxypropoxy)-1H-benzimidazol-1-yl}but-2-en-1-yl]-2-[(4-ethyl-2-methyl-1,3-oxazole-5-carbonyl)amino]-7-methoxy-1H-benzimidazole-5-carboxamide × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；PEG 3350; ammonium tartrate	Resolution 1.97 Å R-free 0.247
8STI human STING with agonist XMT-1616 Deposited 2023-05-10	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 153–339（187 aa） Fragment：Cyclic dinucleotide-binding domain	Not recorded	WX8 3-[(2E)-4-{5-carbamoyl-2-[(4-ethyl-2-methyl-1,3-oxazole-5-carbonyl)amino]-7-(3-hydroxypropoxy)-1H-benzimidazol-1-yl}but-2-en-1-yl]-2-[(4-ethyl-2-methyl-1,3-oxazole-5-carbonyl)amino]-3H-imidazo[4,5-b]pyridine-6-carboxamide × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；PEG 3350; ammonium tartrate	Resolution 1.72 Å R-free 0.257
8T5K Crystal structure of STING CTD in complex with BDW-OH Deposited 2023-06-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 154–341（188 aa） Fragment：C-terminal domain (UNP residues 154-341)	Not recorded	YGI {[(4S)-8,9-dimethylthieno[3,2-e][1,2,4]triazolo[4,3-c]pyrimidin-3-yl]sulfanyl}acetic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.2 M ammonium sulfate, 0.1 M HEPES, pH 7.5, 25% PEG3350	Resolution 1.95 Å R-free 0.230
8T5L Crystal structure of STING CTD in complex with 2'3'-cGAMP Deposited 2023-06-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 154–341（188 aa） Fragment：C-terminal domain (UNP residues 154-341)	Not recorded	1SY cGAMP × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.2 M ammonium sulfate, 0.1 M HEPES, pH 7.5, 25% PEG3350	Resolution 2.01 Å R-free 0.220
8YWB a protein with a ligand Deposited 2024-03-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–379（379 aa） Chain D 1–379（379 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions LIQUID DIFFUSION；291.15 K；Sodium phosphate monobasic, HEPES/Sodium hydroxide, Potassium phosphate dibasic	Resolution 2.49 Å R-free 0.306
8Z37 Crystal structure of human STING ligand binding domain. Deposited 2024-04-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 152–343（192 aa）	Not recorded	CL CHLORIDE ION × 2 CA CALCIUM ION × 2 Y4T (1P)-3',5-di(prop-2-en-1-yl)[1,1'-biphenyl]-2,4'-diol × 2	X-RAY DIFFRACTION X-ray crystallization conditions LIQUID DIFFUSION；289 K；0.16 M calcium acetate, 0.08 M sodium cacodylate, pH [6.5], 14.4 % w/v PEG 8000, 20 % v/v glycerol	Resolution 2.40 Å R-free 0.245
9CT3 HsSTING with SR-717 and C53 Deposited 2024-07-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–344（344 aa） Chain B 1–344（344 aa） Chain C 1–344（344 aa） Chain D 1–344（344 aa）	Not recorded	V67 4,5-difluoro-2-{[6-(1H-imidazol-1-yl)pyridazine-3-carbonyl]amino}benzoic acid × 4 9IM 1-[(2-chloro-6-fluorophenyl)methyl]-3,3-dimethyl-2-oxo-N-[(2,4,6-trifluorophenyl)methyl]-2,3-dihydro-1H-indole-6-carboxamide × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.09 Å
9CT4 HsSTING with diABZI and C53, curved conformation Deposited 2024-07-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–344（344 aa） Chain B 1–344（344 aa） Chain C 1–344（344 aa） Chain D 1–344（344 aa）	Not recorded	A1AZ0 1-[(2E)-4-{5-carbamoyl-2-[(1-ethyl-3-methyl-1H-pyrazole-5-carbonyl)amino]-7-methoxy-1H-1,3-benzimidazol-1-yl}but-2-en-1-yl]-2-[(1-ethyl-3-methyl-1H-pyrazole-5-carbonyl)amino]-7-[3-(morpholin-4-yl)propoxy]-1H-1,3-benzimidazole-5-carboxamide × 2 9IM 1-[(2-chloro-6-fluorophenyl)methyl]-3,3-dimethyl-2-oxo-N-[(2,4,6-trifluorophenyl)methyl]-2,3-dihydro-1H-indole-6-carboxamide × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.29 Å
9CT5 HsSTING with diABZI and C53, together conformation Deposited 2024-07-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 1–344（344 aa） Chain B 1–344（344 aa） Chain C 1–344（344 aa） Chain D 1–344（344 aa） Chain E 1–344（344 aa） Chain F 1–344（344 aa） Chain G 1–344（344 aa） Chain H 1–344（344 aa）	Not recorded	9IM 1-[(2-chloro-6-fluorophenyl)methyl]-3,3-dimethyl-2-oxo-N-[(2,4,6-trifluorophenyl)methyl]-2,3-dihydro-1H-indole-6-carboxamide × 4 A1AZ0 1-[(2E)-4-{5-carbamoyl-2-[(1-ethyl-3-methyl-1H-pyrazole-5-carbonyl)amino]-7-methoxy-1H-1,3-benzimidazol-1-yl}but-2-en-1-yl]-2-[(1-ethyl-3-methyl-1H-pyrazole-5-carbonyl)amino]-7-[3-(morpholin-4-yl)propoxy]-1H-1,3-benzimidazole-5-carboxamide × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.67 Å
9CT6 HsSTING with diABZI and C53, apart conformation Deposited 2024-07-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 1–344（344 aa） Chain B 1–344（344 aa） Chain C 1–344（344 aa） Chain D 1–344（344 aa） Chain E 1–344（344 aa） Chain F 1–344（344 aa） Chain G 1–344（344 aa） Chain H 1–344（344 aa） Chain I 1–344（344 aa） Chain J 1–344（344 aa） Chain K 1–344（344 aa） Chain L 1–344（344 aa）	Not recorded	A1AZ0 1-[(2E)-4-{5-carbamoyl-2-[(1-ethyl-3-methyl-1H-pyrazole-5-carbonyl)amino]-7-methoxy-1H-1,3-benzimidazol-1-yl}but-2-en-1-yl]-2-[(1-ethyl-3-methyl-1H-pyrazole-5-carbonyl)amino]-7-[3-(morpholin-4-yl)propoxy]-1H-1,3-benzimidazole-5-carboxamide × 6 9IM 1-[(2-chloro-6-fluorophenyl)methyl]-3,3-dimethyl-2-oxo-N-[(2,4,6-trifluorophenyl)methyl]-2,3-dihydro-1H-indole-6-carboxamide × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.56 Å
9CUA Human STING G230A/R293Q variant bound to cGAMP Deposited 2024-07-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 155–341（187 aa） Fragment：residues 155-341 Chain B 155–341（187 aa） Fragment：residues 155-341	Mutation：G230A/R293Q variant Mutation：G230A/R293Q variant	1SY cGAMP × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；295 K；1.1 M Sodium/Potassium Tartrate, 0.1 M MES pH 6.0	Resolution 2.22 Å R-free 0.231
9CUB Human STING G230A/R293Q variant bound to diABZI-a1 Deposited 2024-07-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 155–341（187 aa） Fragment：residues 155-341 Chain B 155–341（187 aa） Fragment：residues 155-341	Mutation：G230A/R293Q variant Mutation：G230A/R293Q variant	A1A3A 1,1'-[(2E)-but-2-ene-1,4-diyl]bis{2-[(1-ethyl-3-methyl-1H-pyrazole-5-carbonyl)amino]-7-methoxy-1H-1,3-benzimidazole-5-carboxamide} × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；295 K；0.1 M Bis-Tris pH 5.5, 0.2 M ammonium acetate, 25% (w/v) PEG 3,350	Resolution 1.87 Å R-free 0.287
9CUC Human STING G230A/R293Q variant bound to THIQi Deposited 2024-07-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 155–341（187 aa） Fragment：residues 155-341 Chain B 155–341（187 aa） Fragment：residues 155-341	Mutation：G230A/R293Q variant Mutation：G230A/R293Q variant	A1A4R (3S,4S)-2-(4-tert-butyl-3-chlorophenyl)-3-(2,3-dihydro-1,4-benzodioxin-6-yl)-1-oxo-1,2,3,4-tetrahydroisoquinoline-4-carboxylic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；295 K；0.1 M Bis-Tris pH 5.5, 0.2 M magnesium chloride, 25% (w/v) PEG 3,350	Resolution 2.10 Å R-free 0.321
9CUC Human STING G230A/R293Q variant bound to THIQi Deposited 2024-07-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 155–341（187 aa） Fragment：residues 155-341 Chain D 155–341（187 aa） Fragment：residues 155-341	Mutation：G230A/R293Q variant Mutation：G230A/R293Q variant	A1A4R (3S,4S)-2-(4-tert-butyl-3-chlorophenyl)-3-(2,3-dihydro-1,4-benzodioxin-6-yl)-1-oxo-1,2,3,4-tetrahydroisoquinoline-4-carboxylic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；295 K；0.1 M Bis-Tris pH 5.5, 0.2 M magnesium chloride, 25% (w/v) PEG 3,350	Resolution 2.10 Å R-free 0.321
9CUC Human STING G230A/R293Q variant bound to THIQi Deposited 2024-07-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 155–341（187 aa） Fragment：residues 155-341 Chain F 155–341（187 aa） Fragment：residues 155-341	Mutation：G230A/R293Q variant Mutation：G230A/R293Q variant	A1A4R (3S,4S)-2-(4-tert-butyl-3-chlorophenyl)-3-(2,3-dihydro-1,4-benzodioxin-6-yl)-1-oxo-1,2,3,4-tetrahydroisoquinoline-4-carboxylic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；295 K；0.1 M Bis-Tris pH 5.5, 0.2 M magnesium chloride, 25% (w/v) PEG 3,350	Resolution 2.10 Å R-free 0.321
9CUD Human STING G230A/R293Q variant bound to diABZI-i Deposited 2024-07-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 155–341（187 aa） Fragment：residues 155-341 Chain B 155–341（187 aa） Fragment：residues 155-341	Mutation：G230A/R293Q variant Mutation：G230A/R293Q variant	A1A4W (2E)-1-[(2E)-4-{(2E)-5-carbamoyl-2-[(1-ethyl-3-methyl-1H-pyrazole-5-carbonyl)imino]-3-methyl-2,3-dihydro-1H-1,3-benzimidazol-1-yl}-2,3-dimethylbut-2-en-1-yl]-2-[(1-ethyl-3-methyl-1H-pyrazole-5-carbonyl)imino]-7-[(3-methoxyphenyl)methoxy]-3-methyl-2,3-dihydro-1H-1,3-benzimidazole-5-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；295 K；0.1 M Bis-Tris pH 5.5, 0.2 M magnesium chloride, 25% (w/v) PEG 3,350	Resolution 1.53 Å R-free 0.258
9CUE Human STING H232R variant bound to ABZI Deposited 2024-07-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 155–341（187 aa） Fragment：residues 155-341 Chain B 155–341（187 aa） Fragment：residues 155-341	Mutation：H232R variant Mutation：H232R variant	A1A4X benzyl (3-{5-carbamoyl-2-[(1-ethyl-3-methyl-1H-pyrazole-5-carbonyl)amino]-7-methoxy-1H-1,3-benzimidazol-1-yl}propyl)carbamate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；295 K；0.1 M tri-sodium citrate dihydrate pH 5.6, 20% (w/v) PEG 4,000, 20% (v/v) isopropanol	Resolution 1.95 Å R-free 0.334
9DAN STING oligomer bound to PI(4,5)P2 Deposited 2024-08-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–344（344 aa） Chain B 1–344（344 aa） Chain C 1–344（344 aa） Chain D 1–344（344 aa）	Not recorded	Y6H 4-({[4-(2-tert-butyl-5,5-dimethyl-1,3-dioxan-2-yl)phenyl]methyl}amino)-3-methoxybenzoic acid × 2 A1BBG (2R)-3-{[(S)-hydroxy{[(1R,2R,3S,4R,5R,6S)-2,3,6-trihydroxy-4,5-bis(phosphonooxy)cyclohexyl]oxy}phosphoryl]oxy}propane-1,2-diyl di[(9Z)-octadec-9-enoate] × 2 Y01 CHOLESTEROL HEMISUCCINATE × 2 1SY cGAMP × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9DAT STING oligomer bound to PI(3,5)P2 Deposited 2024-08-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–344（344 aa） Chain B 1–344（344 aa） Chain C 1–344（344 aa） Chain D 1–344（344 aa）	Not recorded	Y6H 4-({[4-(2-tert-butyl-5,5-dimethyl-1,3-dioxan-2-yl)phenyl]methyl}amino)-3-methoxybenzoic acid × 2 A1BBH (2R)-3-{[(R)-hydroxy{[(1S,2R,3R,4S,5S,6R)-2,4,6-trihydroxy-3,5-bis(phosphonooxy)cyclohexyl]oxy}phosphoryl]oxy}propane-1,2-diyl di[(9Z)-octadec-9-enoate] × 2 Y01 CHOLESTEROL HEMISUCCINATE × 2 1SY cGAMP × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9DAV STING oligomer bound to cGAMP and STG2 in the presence of PI4P Deposited 2024-08-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–344（344 aa） Chain B 1–344（344 aa） Chain C 1–344（344 aa） Chain D 1–344（344 aa）	Not recorded	Y6H 4-({[4-(2-tert-butyl-5,5-dimethyl-1,3-dioxan-2-yl)phenyl]methyl}amino)-3-methoxybenzoic acid × 2 1SY cGAMP × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9DAW STING oligomer bound to cGAMP, C53 and PI(3,5)P2 Deposited 2024-08-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–344（344 aa） Chain B 1–344（344 aa） Chain C 1–344（344 aa） Chain D 1–344（344 aa）	Not recorded	A1BBH (2R)-3-{[(R)-hydroxy{[(1S,2R,3R,4S,5S,6R)-2,4,6-trihydroxy-3,5-bis(phosphonooxy)cyclohexyl]oxy}phosphoryl]oxy}propane-1,2-diyl di[(9Z)-octadec-9-enoate] × 2 Y01 CHOLESTEROL HEMISUCCINATE × 2 1SY cGAMP × 2 9IM 1-[(2-chloro-6-fluorophenyl)methyl]-3,3-dimethyl-2-oxo-N-[(2,4,6-trifluorophenyl)methyl]-2,3-dihydro-1H-indole-6-carboxamide × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9JW6 STING bound with a novel small molecule agonist Deposited 2024-10-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 6–336（331 aa） Chain B 6–336（331 aa） Chain C 6–336（331 aa） Chain D 6–336（331 aa）	Not recorded	A1EDL 4-[6-(2-chloranyl-6-cyclopropyl-phenyl)carbonylimidazo[1,5-a]pyrimidin-8-yl]-2-oxidanyl-benzoic acid × 2 A1EER [(2R)-2-dodecanoyloxy-3-[oxidanyl-[(2R,3R,5S,6R)-2,3,5,6-tetrakis(oxidanyl)-4-phosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] dodecanoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.71 Å
9K76 Crystal structure of human STING in complex with F2W Deposited 2024-10-23	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 153–343（191 aa）	Not recorded	1T2 5-chloranyl-3-[(4-methylsulfonylphenyl)carbonylamino]-1-benzofuran-2-carboxylic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；289.15 K；0.2 M calcium acetate, 20% w/v polyethylene glycol 3350, 0.1 M sodium acetate, pH 6.0	Resolution 2.17 Å R-free 0.230
9KYA Crystal Structure of human STING Deposited 2024-12-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 155–341（187 aa）	Not recorded	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.16 M Calcium acetate hydrate, 0.08 M Sodium cacodylate, pH 6.5, 14.4 % w/v PEG 8000, 20 % v/v Glycerol	Resolution 1.89 Å R-free 0.240
9N7F HsSTING with cGAMP/C53/DCA Deposited 2025-02-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–344（344 aa） Chain B 1–344（344 aa） Chain C 1–344（344 aa） Chain D 1–344（344 aa）	Not recorded	9IM 1-[(2-chloro-6-fluorophenyl)methyl]-3,3-dimethyl-2-oxo-N-[(2,4,6-trifluorophenyl)methyl]-2,3-dihydro-1H-indole-6-carboxamide × 2 1SY cGAMP × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.93 Å
9QVT Crystal structure of STING CTD in complex with potent agonist D5 Deposited 2025-04-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 138–379（242 aa）	Mutation：L139S,H232R	A1JA0 4-[6-methoxy-5-[[6-methoxy-2-(4-oxidanyl-4-oxidanylidene-butanoyl)-1-benzothiophen-5-yl]sulfanylmethylsulfanyl]-1-benzothiophen-2-yl]-4-oxidanylidene-butanoic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.2 M NaNO3 (Salt) 20 %w/v PEG 3350 (Precipitant) 10 %v/v EG (Precipitant) 0.1 M BIS-TRIS prop 7.5 pH (Buffer)	Resolution 2.31 Å R-free 0.388
9SWM Stimulator of interferon genes protein Deposited 2025-10-07	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–379（379 aa） Chain B 1–379（379 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 5.6；20 mM MES, 150 mM NaCl, 0.001% LMNG/0.0001% CHS, 0.0001%GDN cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.38 Å
9SWQ Stimulator of interferon genes protein mutant - I165H Deposited 2025-10-07	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–379（379 aa） Chain B 1–379（379 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.31 Å
9SWR Stimulator of interferon genes protein mutant - W119K M120K Deposited 2025-10-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–379（379 aa） Chain B 1–379（379 aa） Chain C 1–379（379 aa） Chain D 1–379（379 aa） Chain E 1–379（379 aa） Chain F 1–379（379 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.86 Å
9SWS Stimulator of interferon genes protein mutant - D319K D320K Deposited 2025-10-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–379（379 aa） Chain B 1–379（379 aa） Chain C 1–379（379 aa） Chain D 1–379（379 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.04 Å
9WH8 Crystal Structure of Human STING bound to diABZI3 Deposited 2025-08-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 154–341（188 aa）	Not recorded	A1AZ0 1-[(2E)-4-{5-carbamoyl-2-[(1-ethyl-3-methyl-1H-pyrazole-5-carbonyl)amino]-7-methoxy-1H-1,3-benzimidazol-1-yl}but-2-en-1-yl]-2-[(1-ethyl-3-methyl-1H-pyrazole-5-carbonyl)amino]-7-[3-(morpholin-4-yl)propoxy]-1H-1,3-benzimidazole-5-carboxamide × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1M Imidazole pH6.5, 1M Sodium acetate trihydrate	Resolution 1.90 Å R-free 0.263

84 other PDB entries and 90 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	STING_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–189； UniProt 155–341 Author chain B； PDBConstruct 3–189； UniProt 155–341

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6xf4
Deposition date deposition_date	2020-06-15
Structure title title	Crystal structure of STING REF variant in complex with E7766
Keywords keywords	Stimulator of interferon genes (STING), REF variant, E7766, Agonist, Macrocycle, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	22.72 Å
Radius of gyration Rg (electron density) rg_electron	21.57 Å
Forward intensity I(0) i0	30599300.00
Molecular weight molecular_weight	41485.0 kDa
Excluded volume excluded_volume	51551 Å³
Envelope volume envelope_volume	61772 Å³
Hydration-shell volume shell_volume	23782 Å³
Envelope diameter envelope_diameter	76.1 Å
Shell Rg shell_rg	28.57 Å
Envelope Rg envelope_rg	22.03 Å
Shape Rg shape_rg	21.57 Å
Total Rg total_rg	22.45 Å
Total atoms total_atoms	2916
Residues n_residues	351
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	75.0 Å
Rg (real space) rg_real	22.68 Å
Rg uncertainty (real space) rg_real_error	0.46 Å
I(0) (real space) i0_real	3.0600e+07
I(0) uncertainty (real space) i0_real_error	3.8190e+05
Rg (reciprocal space) rg_reciprocal	22.69 Å
I(0) (reciprocal space) i0_reciprocal	30600000.0000
Solution quality estimate total_estimate	0.8855
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	26.1 Å
Skewness Skewness skewness	0.315
Kurtosis Kurtosis kurtosis	-0.387
Angular range angular_range	— – 0.3500 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	8251000.0000
Real-space data points n_real_points	67
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.838; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.999; Smooth: 0.994

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Stimulator of interferon genes protein
Molecular weight formula_weight	21581.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	3002

GSVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEV

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	;(1R,3R,15E,28R,29R,30R,31R,34R,36R,39S,41R)-29,41-difluoro-34,39-disulfanyl-2,33,35,38,40,42-hexaoxa-4,6,9,11,13,18,20,22,25,27-decaaza-34,39-diphosphaoctacyclo[28.6.4.1~3,36~.1~28,31~.0~4,8~.0~7,12~.0~19,24~.0~23,27~]dotetraconta-5,7,9,11,15,19,21,23,25-nonaene 34,39-dioxide (non-preferred name) ;
Molecular weight formula_weight	746.6 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	38

▼

7. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d6xf4a1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.387 — STING C-terminal-like
Superfamily Superfamily superfamily	d.387.1 — STING, TM173 CTD-like
Family Family family	d.387.1.1 — Tyrosinase cofactor MelC1

Domain ID domain_id	d6xf4a2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d6xf4b1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.387 — STING C-terminal-like
Superfamily Superfamily superfamily	d.387.1 — STING, TM173 CTD-like
Family Family family	d.387.1.1 — Tyrosinase cofactor MelC1

Domain ID domain_id	d6xf4b2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

▶

8. Citations (1)

▶

Unit-cell length a length_a	33.733 Å
Unit-cell length b length_b	77.831 Å
Unit-cell length c length_c	131.689 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.770 Å
Low-resolution limit resolution_low	38.950 Å
R factor r_factor	0.2235
R_work r_work	0.2212
R_free r_free	0.2711

fit	/app/data/saxs_computation/xf/6xf4/6xf4.fit
pddf	/app/data/pr_computation/xf/6xf4/6xf4.pr.out
profile	/app/data/saxs_computation/xf/6xf4/6xf4.dat