7o01

Dimeric Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） PSI subunit V × 2 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 4 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY9） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAA_CHLRE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–741； UniProt 11–751 Author chain a； PDBConstruct 1–741； UniProt 11–751

Photosystem I P700 chlorophyll a apoprotein A2

OrganismNot specified

UniProt P09144

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） PSI subunit V × 2 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 4 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY9） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAB_CHLRE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–733； UniProt 2–734 Author chain b； PDBConstruct 1–733； UniProt 2–734

Photosystem I iron-sulfur center

OrganismNot specified

UniProt Q00914

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） PSI subunit V × 2 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 4 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY9） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAC_CHLRE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–80； UniProt 2–81 Author chain c； PDBConstruct 1–80； UniProt 2–81

Photosystem I reaction center subunit II, chloroplastic

OrganismNot specified

UniProt Q39615

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） PSI subunit V × 2 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 4 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY9） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAD_CHLRE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–144； UniProt 53–196 Author chain d； PDBConstruct 1–144； UniProt 53–196

Photosystem I reaction center subunit IV, chloroplastic

OrganismNot specified

UniProt P12352

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） PSI subunit V × 2 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 4 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY9） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAE_CHLRE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–63； UniProt 34–96 Author chain e； PDBConstruct 1–63； UniProt 34–96

Photosystem I reaction center subunit III, chloroplastic

OrganismNot specified

UniProt P12356

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） PSI subunit V × 2 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 4 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY9） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAF_CHLRE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–165； UniProt 63–227 Author chain f； PDBConstruct 1–165； UniProt 63–227

Photosystem I reaction center subunit V, chloroplastic

OrganismNot specified

UniProt P14224

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） PSI subunit V × 2 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 4 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY9） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAG_CHLRE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–91； UniProt 32–122 Author chain g； PDBConstruct 1–91； UniProt 32–122

Photosystem I reaction center subunit VIII

OrganismNot specified

UniProt A8IFG7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit IX × 2 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） PSI subunit V × 2 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 4 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY9） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8IFG7_CHLRE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain I； PDBConstruct 1–37； UniProt 68–104 Author chain i； PDBConstruct 1–37； UniProt 68–104

Photosystem I reaction center subunit IX

OrganismNot specified

UniProt P59777

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） PSI subunit V × 2 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 4 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY9） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAJ_CHLRE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain J； PDBConstruct 1–39； UniProt 1–39 Author chain j； PDBConstruct 1–39； UniProt 1–39

Photosystem I reaction center subunit psaK, chloroplastic

OrganismNot specified

UniProt P14225

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） PSI subunit V × 2 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 4 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY9） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAK_CHLRE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain K； PDBConstruct 1–84； UniProt 29–112 Author chain k； PDBConstruct 1–84； UniProt 29–112

PSI subunit V

OrganismNot specified

UniProt A8IL32

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） Chlorophyll a-b binding protein, chloroplastic × 4 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY9） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8IL32_CHLRE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain L； PDBConstruct 1–138； UniProt 53–190 Author chain l； PDBConstruct 1–138； UniProt 53–190

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q7DM26

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） PSI subunit V × 2 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY9） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7DM26_CHLRE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain 1； PDBConstruct 1–194； UniProt 31–224 Author chain Z； PDBConstruct 1–194； UniProt 31–224 Author chain p； PDBConstruct 1–194； UniProt 31–224 Author chain z； PDBConstruct 1–194； UniProt 31–224

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q75VY9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） PSI subunit V × 2 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 4 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75VY9_CHLRE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain 3； PDBConstruct 1–219； UniProt 45–263 Author chain q； PDBConstruct 1–219； UniProt 45–263

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q84Y02

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） PSI subunit V × 2 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 4 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY9） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q84Y02_CHLRE
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain 7； PDBConstruct 1–213； UniProt 29–241 Author chain r； PDBConstruct 1–213； UniProt 29–241

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q75VY7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） PSI subunit V × 2 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 4 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY9） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75VY7_CHLRE
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain 8； PDBConstruct 1–217； UniProt 27–243 Author chain s； PDBConstruct 1–217； UniProt 27–243

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q75VZ0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） PSI subunit V × 2 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 4 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY9） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75VZ0_CHLRE
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain 4； PDBConstruct 1–210； UniProt 55–264 Author chain t； PDBConstruct 1–210； UniProt 55–264

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q75VY8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） PSI subunit V × 2 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 4 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY9） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75VY8_CHLRE
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain 5； PDBConstruct 1–227； UniProt 31–257 Author chain u； PDBConstruct 1–227； UniProt 31–257

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q75VY6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） PSI subunit V × 2 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 4 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY9） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75VY6_CHLRE
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain 6； PDBConstruct 1–229； UniProt 29–257 Author chain v； PDBConstruct 1–229； UniProt 29–257

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt A8IKC8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） PSI subunit V × 2 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 4 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY9） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q8S567）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8IKC8_CHLRE
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain 2； PDBConstruct 1–198； UniProt 28–225

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q8S567

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 40	Photosystem I P700 chlorophyll a apoprotein A1 × 2 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 2 （P09144） Photosystem I iron-sulfur center × 2 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 2 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 2 （P12352） Photosystem I reaction center subunit III, chloroplastic × 2 （P12356） Photosystem I reaction center subunit V, chloroplastic × 2 （P14224） Photosystem I reaction center subunit VIII × 2 （A8IFG7） Photosystem I reaction center subunit IX × 2 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 2 （P14225） PSI subunit V × 2 （A8IL32） Chlorophyll a-b binding protein, chloroplastic × 4 （Q7DM26） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY9） Chlorophyll a-b binding protein, chloroplastic × 2 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY7） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 2 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （A8IKC8）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8S567_CHLRE
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain 9； PDBConstruct 1–183； UniProt 28–210

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7o01
Deposition date deposition_date	2021-03-25
Structure title title	Dimeric Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii
Keywords keywords	chlamydomonas, photosystem I, temperature sensitive, water molecules, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7o01__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7o01__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7o01__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	103.90 Å
Total Rg	103.70 Å
Atom count	64554
Residues	8357
Excluded volume	1155600 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7o01__assembly_1__model_1`	40-meric （40）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (20)

Entity 1 Entity 1 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	82121.9 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,a
Atom count atom_count	64554

KKVKIAVDRNPVETSFEKWAKPGHFSRTLSKGPNTTTWIWNLHADAHDFDSHTSDLEEISRKVFSAHFGQLGIIFIWLSGMYFHGARFSNYEAWLSDPTHIKPSAQVVWPIVGQEILNGDVGGGFQGIQITSGFFQLWRASGITSELQLYTTAIGGLVMAAAMFFAGWFHYHKAAPKLEWFQNVESMLNHHLGGLLGLGSLAWAGHQIHVSLPVNKLLDAGVDPKEIPLPHDLLLNRAIMADLYPSFAKGIAPFFTLNWSEYSDFLTFKGGLNPVTGGLWLSDTAHHHVAIAVLFLVAGHMYRTNWGIGHSMKEILEAHRGPFTGEGHVGLYEILTTSWHAQLAINLALFGSLSIIVAHHMYAMPPYPYLATDYGTQLSLFTHHTWIGGFCIVGAGAHAAIFMVRDYDPTNNYNNLLDRVIRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNTHFLAPQLTAPNALAATSLTWGGDLVAVGGKVAMMPISLGTSDFMVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVTASGVSHITGGNFAQSANTINGWLRDFLWAQSSQVIQSYGSALSAYGLIFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIATTWSFFLARIISVG

Entity 2 Entity 2 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	81996.0 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,b

ATKLFPKFSQGLAQDPTTRRIWYGLAMAHDFESHDGMTEENLYQKIFASHFGQLSIIFLWTSGNLFHVAWQGNFEQWVTDPVHIRPIAHAIWDPHFGQPAVEAFTRGGASGPVNISTSGVYQWWYTIGMRTNQDLYVGSVFLALVSAIFLFAGWLHLQPNFQPSLSWFKDAESRLNHHLSGLFGVSSLAWTGHLVHVAIPESRGQHVGWDNFLSVLPHPQGLTPFFTGNWAAYAQSPDTASHVFGTAQGSGQAILTFLGGFHPQTQSLWLTDMAHHHLAIAVIFIVAGHMYRTNFGIGHRMQAILEAHTPPSGSLGAGHKGLFDTVNNSLHFQLGLALASVGTITSLVAQHMYSLPPYAFQAIDFTTQAALYTHHQYIAGFIMCGAFAHGAIFFIRDYDPEQNKGNVLARMLDHKEALISHLSWVSLFLGFHTLGLYVHNDVMQAFGTPEKQILIEPVFAQWIQAAHGKALYGFDFLLSSKTSAAFANGQSLWLPGWLDAINNNQNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAYDAFYLAVFWMLNTIGWVTFYWHWKHLTLWQGNVAQFDESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWTFLFGHLIYATGFMFLISWRGYWQELIETLVWAHEKTPLANLVYWKDKPVALSIVQARLVGLAHFSVGYIFTYAAFLIASTSGRF

Entity 3 Entity 3 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8738.1 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,c

AHIVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKASQMASAPRTEDCVGCKRCETACPTDFLSVRVYLGSESTRSMGLSY

Entity 4 Entity 4 polymer

Description description	Photosystem I reaction center subunit II, chloroplastic
Molecular weight formula_weight	16152.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,d

WTVPTLNPDTPSPIFGGSTGGLLRKAQTEEFYVITWEAKKEQIFEMPTGGAAIMRQGPNLLKFGKKEQCLALTTQLRNKFKLTPCFYRVFPDGKVQYLHPADGVYPEKVNAGRVGANQNMRRIGQNVNPIKVKFSGRMMSPAEI

Entity 5 Entity 5 polymer

Description description	Photosystem I reaction center subunit IV, chloroplastic
Molecular weight formula_weight	7021.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,e

EVGPKRGSLVKILRPESYWFNQVGKVVSVDQSGVRYPVVVRFENQNYAGVTTNNYALDEVVAA

Entity 6 Entity 6 polymer

Description description	Photosystem I reaction center subunit III, chloroplastic
Molecular weight formula_weight	17957.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,f

DIAGLTPCSESKAYAKLEKKELKTLEKRLKQYEADSAPAVALKATMERTKARFANYAKAGLLCGNDGLPHLIADPGLALKYGHAGEVFIPTFGFLYVAGYIGYVGRQYLIAVKGEAKPTDKEIIIDVPLATKLAWQGAGWPLAAVQELQRGTLLEKEENITVSPR

Entity 7 Entity 7 polymer

Description description	Photosystem I reaction center subunit V, chloroplastic
Molecular weight formula_weight	9572.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,g

LDPQIVISGSTAAFLAIGRFVFLGYQRREANFDSTVGPKTTGATYFDDLQKNSTIFATNDPAGFNIIDVAGWGALGHAVGFAVLAINSLQG

Entity 8 Entity 8 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	3970.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,i

PFVPPSWAPSVFVPLTGLVLPAIAMATLFVYIEKEAP

Entity 9 Entity 9 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	4516.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,j

MKDFTTYLSTAPVIATIWFTFTAGLLIEINRYFPDPLVF

Entity 10 Entity 10 polymer

Description description	Photosystem I reaction center subunit psaK, chloroplastic
Molecular weight formula_weight	8146.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,k

FIGSSTNLIMVASTTATLAAARFGLAPTVKKNTTAGLKLVDSKNSAGVISNDPAGFTIVDVLAMGAAGHGLGVGIVLGLKGIGA

Entity 11 Entity 11 polymer

Description description	PSI subunit V
Molecular weight formula_weight	14130.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,l

GMLETPVTSAPIVATYLSNLPAYRTGVAPVLRGVEIGLAHGFLLAGPFIKLGPLRNVPETAEIAGSLSAAGLVLILALCLSIYGSAQFQSTPSIGVKTLSGRSVARDPLFSADGWSEFAAGFLVGGEAGVAWAYVCTQ

Entity 12 Entity 12 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	20368.0 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,Z,p,z

KAGNWLPGSDAPAWLPDDLPGNYGFDPLSLGKEPASLKRFTESEVIHGRWAMLGVAGSLAVELLGYGNWYDAPLWAVNGGKATWFGIEVPFDLNALLAFEFVAMAAAEGQRGDAGGVVYPGGAFDPLGFAKDSSKSGELKLKEIKNGRLAMVAFLGFVAQHAATGKGPIAALGEHLANPWGANFATNGISVPFF

Entity 13 Entity 13 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	23689.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3,q

LYVGASQSSLAYLDGSLPGDFGFDPLGLLDPVNSGGFIEPKWLQYSEVIHARWAMLGAAGCIAPEVLGAAGLIPDATNIKWFESGVIPPAGSYNGYWADPYTIFFVEIVAMQFAELRRLQDFRYPGSMGQQYFLGLEAIFKGSGDAAYPGGPFFNLFNLGKTEAAMKELKLKEIKNGRLAMLAMLGYGAQAVMTGKGPFQNLVEHLADPVNNNILTNFG

Entity 14 Entity 14 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	23304.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7,r

VRPVWFPGNPPPAHLDGSLAGDYGFDPLFLGQEPQTLKWYVQAELVHGRFAMLGAAGIILTSIGAKVGLGFPEWYDAGKVVVEKNNIDFPTLMVIQFYLMGWAETKRWYDFKNPGSQADGSFLGFTEEFKGLENGYPGGRFFDPMGLSRGDAAKYQEYKQKEVKNGRLAMIACLGFAAQYAATGKGPLDNLADHLADPNHVNFATNGVSIPIA

Entity 15 Entity 15 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	23293.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8,s

RQSWLPGSQIPAHLDTPAAQALAGNFGFDPLGLGKDPVALRWYQQAELIHCRTAMAGVAGILIPGLLTKAGALNVPEWYDAGKVAIENSFAPWGSLLAVQLFLCGFVEAKRWQDIRKPGSQGEPGSFLGFEASLKGTSELGYPGGPFDPLGLSKEADKWADWKLKEVKNGRLAMLAFLGFVAQKYATGAGPVDNLAAHLKDPWHVNYATNGVSLPFL

Entity 16 Entity 16 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	23018.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4,t

DAALPSWMPGADLPGYLNGTLPGDFGFDPLYLGQDPVKLKWYAQAELMNARFAMLAVAGILVPELLSNIGFSWPGAGVAWYDAGKFEYFAPASSLFGVQMLLFAWVEIRRYQDFVKPGSANQDPIFTNNKLPDGNEPGYPGGIFDPFGWSKGDIKSLKLKEIKNGRLAMLAFAGFIGQAYTTGTTPLKNLSTHLADPWSTTVWQNDLARL

Entity 17 Entity 17 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	25122.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5,u

DRKLWAPGVVAPEYLKGDLAGDYGWDPLGLGADPTALKWYRQSELQHARWAMLGVAGVLVQEIVKPDVYFYEAGLPQNLPEPFTNINMGGLLAWEFILMHWVEVRRWQDYKNFGSVNEDPIFKGNKVPNPEMGYPGGIFDPFGFSKGNLKELQTKEIKNGRLAMIAYMAFILQAQATGKGPLAALSAHLSNPFGNNILKNIGTCTVPHSVDVQGLTIPLTCLWPGSQ

Entity 18 Entity 18 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	24937.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6,v

RPLWLPGSTPPAHLKGDLPGDFGFDPLGLGANAESLKWFKESELVHSRWAMAAVAGILVQEIVRPDVFWYNAGKEVESPLGPLGLLAVEFFLMHWVEVRRWQDLRKPGSVDQDPIFSQYKLPPHEVGYPGGVFAPFIPGDLAELKVKEIKNGRLAMLAFVGFVMAAQVTGKGPIAALQEHLADPWGTTIFSKAAVVPGQAVAPPCKIPASVSYKGIEIPTPCFLQGLWP

Entity 19 Entity 19 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	21658.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

RPMWYPGATAPAHLDGSMLGDYGFDPLRLGVNKDNLKWFREAELTNGRWAMAAVVGILFTDAVGLPKFWTAGAEKYALDNQTLALIEVAVFAVLEGKRYEIYKKTGETGFLSFAPFDPMGMKSEEMKLKELKNGRLAMLAFLGFCSQAAVYGKGPIETLQLHLADPGHNNIYTSSVGPETAVTVAVLCVLPMIIEATK

Entity 20 Entity 20 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	19929.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	9

RPTWLPGLNPPAHLKGALAGDNGFDPLGLGQDEGRLKWYAEAEKTNGRWAMMAVAGILGQELLGVTPAWWEAGAKEYDIPAQALTPIEFIVMGFLEIKRYQGFKQTGTSGFINSFPFDPAGMNSPSMATKEVKNGRLAMVAFIGFCVQALATRTQPIEGLTAHLADPFGKNITYYLTHLPETL

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	17.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	5707

Dimeric Photosystem I of a temperature sensitive mutant Chlamydomonas reinhardtii

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit II, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IV, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit III, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit V, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit psaK, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer