7ozp

RNA Polymerase II dimer (Class 3)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase subunit beta

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	DNA-directed RNA polymerase subunit × 2 DNA-directed RNA polymerase II subunit RPB3 × 2 （A0A481DF93） RNA polymerase II subunit D × 2 （A0A287ADR4） DNA-directed RNA polymerase II subunit E × 2 （I3LSI7） DNA-directed RNA polymerase II subunit F × 2 （F1SKN8） DNA-directed RNA polymerase II subunit RPB7 × 2 （I3LJZ9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 2 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 2 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 2 （A0A7K6NXI9） RNA_pol_L_2 domain-containing protein × 2 （A0A4X1UK25） RNA polymerase II subunit K × 2 （I3LN51） ZINC ION × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0B8RVL1_PIG
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–1174； UniProt 1–1174 Author chain N； PDBConstruct 1–1174； UniProt 1–1174

DNA-directed RNA polymerase II subunit RPB3

OrganismNot specified

UniProt A0A481DF93

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	DNA-directed RNA polymerase subunit × 2 DNA-directed RNA polymerase subunit beta × 2 （A0A0B8RVL1） RNA polymerase II subunit D × 2 （A0A287ADR4） DNA-directed RNA polymerase II subunit E × 2 （I3LSI7） DNA-directed RNA polymerase II subunit F × 2 （F1SKN8） DNA-directed RNA polymerase II subunit RPB7 × 2 （I3LJZ9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 2 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 2 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 2 （A0A7K6NXI9） RNA_pol_L_2 domain-containing protein × 2 （A0A4X1UK25） RNA polymerase II subunit K × 2 （I3LN51） ZINC ION × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A481DF93_PIG
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–275； UniProt 46–320 Author chain O； PDBConstruct 1–275； UniProt 46–320

RNA polymerase II subunit D

OrganismNot specified

UniProt A0A287ADR4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	DNA-directed RNA polymerase subunit × 2 DNA-directed RNA polymerase subunit beta × 2 （A0A0B8RVL1） DNA-directed RNA polymerase II subunit RPB3 × 2 （A0A481DF93） DNA-directed RNA polymerase II subunit E × 2 （I3LSI7） DNA-directed RNA polymerase II subunit F × 2 （F1SKN8） DNA-directed RNA polymerase II subunit RPB7 × 2 （I3LJZ9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 2 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 2 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 2 （A0A7K6NXI9） RNA_pol_L_2 domain-containing protein × 2 （A0A4X1UK25） RNA polymerase II subunit K × 2 （I3LN51） ZINC ION × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A287ADR4_PIG
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–142； UniProt 43–184 Author chain P； PDBConstruct 1–142； UniProt 43–184

DNA-directed RNA polymerase II subunit E

OrganismNot specified

UniProt I3LSI7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	DNA-directed RNA polymerase subunit × 2 DNA-directed RNA polymerase subunit beta × 2 （A0A0B8RVL1） DNA-directed RNA polymerase II subunit RPB3 × 2 （A0A481DF93） RNA polymerase II subunit D × 2 （A0A287ADR4） DNA-directed RNA polymerase II subunit F × 2 （F1SKN8） DNA-directed RNA polymerase II subunit RPB7 × 2 （I3LJZ9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 2 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 2 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 2 （A0A7K6NXI9） RNA_pol_L_2 domain-containing protein × 2 （A0A4X1UK25） RNA polymerase II subunit K × 2 （I3LN51） ZINC ION × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LSI7_PIG
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–210； UniProt 1–210 Author chain Q； PDBConstruct 1–210； UniProt 1–210

DNA-directed RNA polymerase II subunit F

OrganismNot specified

UniProt F1SKN8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	DNA-directed RNA polymerase subunit × 2 DNA-directed RNA polymerase subunit beta × 2 （A0A0B8RVL1） DNA-directed RNA polymerase II subunit RPB3 × 2 （A0A481DF93） RNA polymerase II subunit D × 2 （A0A287ADR4） DNA-directed RNA polymerase II subunit E × 2 （I3LSI7） DNA-directed RNA polymerase II subunit RPB7 × 2 （I3LJZ9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 2 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 2 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 2 （A0A7K6NXI9） RNA_pol_L_2 domain-containing protein × 2 （A0A4X1UK25） RNA polymerase II subunit K × 2 （I3LN51） ZINC ION × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F1SKN8_PIG
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–127； UniProt 1–127 Author chain R； PDBConstruct 1–127； UniProt 1–127

DNA-directed RNA polymerase II subunit RPB7

OrganismNot specified

UniProt I3LJZ9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	DNA-directed RNA polymerase subunit × 2 DNA-directed RNA polymerase subunit beta × 2 （A0A0B8RVL1） DNA-directed RNA polymerase II subunit RPB3 × 2 （A0A481DF93） RNA polymerase II subunit D × 2 （A0A287ADR4） DNA-directed RNA polymerase II subunit E × 2 （I3LSI7） DNA-directed RNA polymerase II subunit F × 2 （F1SKN8） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 2 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 2 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 2 （A0A7K6NXI9） RNA_pol_L_2 domain-containing protein × 2 （A0A4X1UK25） RNA polymerase II subunit K × 2 （I3LN51） ZINC ION × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LJZ9_PIG
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–172； UniProt 1–172 Author chain S； PDBConstruct 1–172； UniProt 1–172

DNA-directed RNA polymerases I, II, and III subunit RPABC3

OrganismNot specified

UniProt A0A4X1ULF2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	DNA-directed RNA polymerase subunit × 2 DNA-directed RNA polymerase subunit beta × 2 （A0A0B8RVL1） DNA-directed RNA polymerase II subunit RPB3 × 2 （A0A481DF93） RNA polymerase II subunit D × 2 （A0A287ADR4） DNA-directed RNA polymerase II subunit E × 2 （I3LSI7） DNA-directed RNA polymerase II subunit F × 2 （F1SKN8） DNA-directed RNA polymerase II subunit RPB7 × 2 （I3LJZ9） DNA-directed RNA polymerase II subunit RPB9 × 2 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 2 （A0A7K6NXI9） RNA_pol_L_2 domain-containing protein × 2 （A0A4X1UK25） RNA polymerase II subunit K × 2 （I3LN51） ZINC ION × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1ULF2_PIG
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–150； UniProt 1–150 Author chain T； PDBConstruct 1–150； UniProt 1–150

DNA-directed RNA polymerase II subunit RPB9

OrganismNot specified

UniProt P60899

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	DNA-directed RNA polymerase subunit × 2 DNA-directed RNA polymerase subunit beta × 2 （A0A0B8RVL1） DNA-directed RNA polymerase II subunit RPB3 × 2 （A0A481DF93） RNA polymerase II subunit D × 2 （A0A287ADR4） DNA-directed RNA polymerase II subunit E × 2 （I3LSI7） DNA-directed RNA polymerase II subunit F × 2 （F1SKN8） DNA-directed RNA polymerase II subunit RPB7 × 2 （I3LJZ9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 2 （A0A4X1ULF2） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 2 （A0A7K6NXI9） RNA_pol_L_2 domain-containing protein × 2 （A0A4X1UK25） RNA polymerase II subunit K × 2 （I3LN51） ZINC ION × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPB9_PIG
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–125； UniProt 1–125 Author chain U； PDBConstruct 1–125； UniProt 1–125

DNA-directed RNA polymerases I, II, and III subunit RPABC5

OrganismNot specified

UniProt A0A7K6NXI9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	DNA-directed RNA polymerase subunit × 2 DNA-directed RNA polymerase subunit beta × 2 （A0A0B8RVL1） DNA-directed RNA polymerase II subunit RPB3 × 2 （A0A481DF93） RNA polymerase II subunit D × 2 （A0A287ADR4） DNA-directed RNA polymerase II subunit E × 2 （I3LSI7） DNA-directed RNA polymerase II subunit F × 2 （F1SKN8） DNA-directed RNA polymerase II subunit RPB7 × 2 （I3LJZ9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 2 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 2 （P60899） RNA_pol_L_2 domain-containing protein × 2 （A0A4X1UK25） RNA polymerase II subunit K × 2 （I3LN51） ZINC ION × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7K6NXI9_PEDTO
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–67； UniProt 1–67 Author chain V； PDBConstruct 1–67； UniProt 1–67

RNA_pol_L_2 domain-containing protein

OrganismNot specified

UniProt A0A4X1UK25

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	DNA-directed RNA polymerase subunit × 2 DNA-directed RNA polymerase subunit beta × 2 （A0A0B8RVL1） DNA-directed RNA polymerase II subunit RPB3 × 2 （A0A481DF93） RNA polymerase II subunit D × 2 （A0A287ADR4） DNA-directed RNA polymerase II subunit E × 2 （I3LSI7） DNA-directed RNA polymerase II subunit F × 2 （F1SKN8） DNA-directed RNA polymerase II subunit RPB7 × 2 （I3LJZ9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 2 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 2 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 2 （A0A7K6NXI9） RNA polymerase II subunit K × 2 （I3LN51） ZINC ION × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4X1UK25_PIG
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–117； UniProt 1–117 Author chain W； PDBConstruct 1–117； UniProt 1–117

RNA polymerase II subunit K

OrganismNot specified

UniProt I3LN51

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	DNA-directed RNA polymerase subunit × 2 DNA-directed RNA polymerase subunit beta × 2 （A0A0B8RVL1） DNA-directed RNA polymerase II subunit RPB3 × 2 （A0A481DF93） RNA polymerase II subunit D × 2 （A0A287ADR4） DNA-directed RNA polymerase II subunit E × 2 （I3LSI7） DNA-directed RNA polymerase II subunit F × 2 （F1SKN8） DNA-directed RNA polymerase II subunit RPB7 × 2 （I3LJZ9） DNA-directed RNA polymerases I, II, and III subunit RPABC3 × 2 （A0A4X1ULF2） DNA-directed RNA polymerase II subunit RPB9 × 2 （P60899） DNA-directed RNA polymerases I, II, and III subunit RPABC5 × 2 （A0A7K6NXI9） RNA_pol_L_2 domain-containing protein × 2 （A0A4X1UK25） ZINC ION × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I3LN51_PIG
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–58； UniProt 1–58 Author chain X； PDBConstruct 1–58； UniProt 1–58

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7ozp
Deposition date deposition_date	2021-06-28
Structure title title	RNA Polymerase II dimer (Class 3)
Keywords keywords	Polymerase, Dimer, Complex, TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7ozp__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7ozp__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7ozp__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	72.97 Å
Rg (electron density)	72.56 Å
Total Rg	72.55 Å
Atom count	54330
Residues	6774
Excluded volume	969180 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7ozp__assembly_1__model_1`	24-meric （24）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Description description	DNA-directed RNA polymerase subunit
Molecular weight formula_weight	217450.1 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,M
Atom count atom_count	54330

MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN

Entity 2 Entity 2 polymer

Description description	DNA-directed RNA polymerase subunit beta
Molecular weight formula_weight	134041.4 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,N

MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSMLARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEGTNRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV

Entity 3 Entity 3 polymer

Description description	DNA-directed RNA polymerase II subunit RPB3
Molecular weight formula_weight	31439.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,O

MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLHDEFIAHRLGLIPLTSDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDLISNSPRVIPVTSRNRDNDPSDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTAGVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLRPETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN

Entity 4 Entity 4 polymer

Description description	RNA polymerase II subunit D
Molecular weight formula_weight	16331.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,P

MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY

Entity 5 Entity 5 polymer

Description description	DNA-directed RNA polymerase II subunit E
Molecular weight formula_weight	24644.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,Q

MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ

Entity 6 Entity 6 polymer

Description description	DNA-directed RNA polymerase II subunit F
Molecular weight formula_weight	14477.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,R

MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIISD

Entity 7 Entity 7 polymer

Description description	DNA-directed RNA polymerase II subunit RPB7
Molecular weight formula_weight	19314.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,S

MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS

Entity 8 Entity 8 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC3
Molecular weight formula_weight	17162.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,T

MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF

Entity 9 Entity 9 polymer

Description description	DNA-directed RNA polymerase II subunit RPB9
Molecular weight formula_weight	14541.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,U

MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITHEVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCGHRWTE

Entity 10 Entity 10 polymer

Description description	DNA-directed RNA polymerases I, II, and III subunit RPABC5
Molecular weight formula_weight	7655.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,V

MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK

Entity 11 Entity 11 polymer

Description description	RNA_pol_L_2 domain-containing protein
Molecular weight formula_weight	13310.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,W

MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE

Entity 12 Entity 12 polymer

Description description	RNA polymerase II subunit K
Molecular weight formula_weight	7018.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,X

MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR

Entity 13 Entity 13 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	10

▼

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	7ozpB01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1110 — Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; domain 3
Homologous superfamily homologous superfamily	10 — RNA polymerase Rpb2, domain 2

Domain ID domain_id	7ozpN01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1110 — Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; domain 3
Homologous superfamily homologous superfamily	10 — RNA polymerase Rpb2, domain 2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.80 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	41379

RNA Polymerase II dimer (Class 3)

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA polymerase II subunit D

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit E

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit F

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase II subunit RPB9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerases I, II, and III subunit RPABC5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA_pol_L_2 domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer