8ffz

TFIIIA-TFIIIC-Brf1-TBP complex bound to 5S rRNA gene

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription factor IIIA

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 8 DNA 2	Transcription factor tau 138 kDa subunit × 1 （P34111） Transcription factor tau 131 kDa subunit × 1 （P33339） Transcription factor tau 95 kDa subunit × 1 （P32367） Transcription factor tau 91 kDa subunit × 1 （Q06339） Transcription factor tau 60 kDa subunit × 1 （Q12308） Transcription factor tau 55 kDa subunit × 1 （Q12415） Transcription factor IIIB 70 kDa subunit,TATA-box-binding protein × 1 （P13393,P29056） DNA (151-MER) × 1 DNA (151-MER) × 1 ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TF3A_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–429； UniProt 1–429

Transcription factor tau 138 kDa subunit

Saccharomyces cerevisiae

UniProt P34111

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 8 DNA 2	Transcription factor IIIA × 1 （P39933） Transcription factor tau 131 kDa subunit × 1 （P33339） Transcription factor tau 95 kDa subunit × 1 （P32367） Transcription factor tau 91 kDa subunit × 1 （Q06339） Transcription factor tau 60 kDa subunit × 1 （Q12308） Transcription factor tau 55 kDa subunit × 1 （Q12415） Transcription factor IIIB 70 kDa subunit,TATA-box-binding protein × 1 （P13393,P29056） DNA (151-MER) × 1 DNA (151-MER) × 1 ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TFC3_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–1160； UniProt 1–1160

Transcription factor tau 131 kDa subunit

Saccharomyces cerevisiae

UniProt P33339

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 8 DNA 2	Transcription factor IIIA × 1 （P39933） Transcription factor tau 138 kDa subunit × 1 （P34111） Transcription factor tau 95 kDa subunit × 1 （P32367） Transcription factor tau 91 kDa subunit × 1 （Q06339） Transcription factor tau 60 kDa subunit × 1 （Q12308） Transcription factor tau 55 kDa subunit × 1 （Q12415） Transcription factor IIIB 70 kDa subunit,TATA-box-binding protein × 1 （P13393,P29056） DNA (151-MER) × 1 DNA (151-MER) × 1 ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TFC4_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–1025； UniProt 1–1025

Transcription factor tau 95 kDa subunit

Saccharomyces cerevisiae

UniProt P32367

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 8 DNA 2	Transcription factor IIIA × 1 （P39933） Transcription factor tau 138 kDa subunit × 1 （P34111） Transcription factor tau 131 kDa subunit × 1 （P33339） Transcription factor tau 91 kDa subunit × 1 （Q06339） Transcription factor tau 60 kDa subunit × 1 （Q12308） Transcription factor tau 55 kDa subunit × 1 （Q12415） Transcription factor IIIB 70 kDa subunit,TATA-box-binding protein × 1 （P13393,P29056） DNA (151-MER) × 1 DNA (151-MER) × 1 ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TFC1_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–649； UniProt 1–649

Transcription factor tau 91 kDa subunit

Saccharomyces cerevisiae

UniProt Q06339

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 8 DNA 2	Transcription factor IIIA × 1 （P39933） Transcription factor tau 138 kDa subunit × 1 （P34111） Transcription factor tau 131 kDa subunit × 1 （P33339） Transcription factor tau 95 kDa subunit × 1 （P32367） Transcription factor tau 60 kDa subunit × 1 （Q12308） Transcription factor tau 55 kDa subunit × 1 （Q12415） Transcription factor IIIB 70 kDa subunit,TATA-box-binding protein × 1 （P13393,P29056） DNA (151-MER) × 1 DNA (151-MER) × 1 ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TFC6_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–672； UniProt 1–672

Transcription factor tau 60 kDa subunit

Saccharomyces cerevisiae

UniProt Q12308

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 8 DNA 2	Transcription factor IIIA × 1 （P39933） Transcription factor tau 138 kDa subunit × 1 （P34111） Transcription factor tau 131 kDa subunit × 1 （P33339） Transcription factor tau 95 kDa subunit × 1 （P32367） Transcription factor tau 91 kDa subunit × 1 （Q06339） Transcription factor tau 55 kDa subunit × 1 （Q12415） Transcription factor IIIB 70 kDa subunit,TATA-box-binding protein × 1 （P13393,P29056） DNA (151-MER) × 1 DNA (151-MER) × 1 ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TFC8_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–588； UniProt 1–588

Transcription factor tau 55 kDa subunit

Saccharomyces cerevisiae

UniProt Q12415

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 8 DNA 2	Transcription factor IIIA × 1 （P39933） Transcription factor tau 138 kDa subunit × 1 （P34111） Transcription factor tau 131 kDa subunit × 1 （P33339） Transcription factor tau 95 kDa subunit × 1 （P32367） Transcription factor tau 91 kDa subunit × 1 （Q06339） Transcription factor tau 60 kDa subunit × 1 （Q12308） Transcription factor IIIB 70 kDa subunit,TATA-box-binding protein × 1 （P13393,P29056） DNA (151-MER) × 1 DNA (151-MER) × 1 ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TFC7_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–435； UniProt 1–435

Transcription factor IIIB 70 kDa subunit,TATA-box-binding protein

Saccharomyces cerevisiae S288C

UniProt P13393

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 8 DNA 2	Transcription factor IIIA × 1 （P39933） Transcription factor tau 138 kDa subunit × 1 （P34111） Transcription factor tau 131 kDa subunit × 1 （P33339） Transcription factor tau 95 kDa subunit × 1 （P32367） Transcription factor tau 91 kDa subunit × 1 （Q06339） Transcription factor tau 60 kDa subunit × 1 （Q12308） Transcription factor tau 55 kDa subunit × 1 （Q12415） DNA (151-MER) × 1 DNA (151-MER) × 1 ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBP_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 387–566； UniProt 61–240

Transcription factor IIIB 70 kDa subunit,TATA-box-binding protein

Saccharomyces cerevisiae S288C

UniProt P29056

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 8 DNA 2	Transcription factor IIIA × 1 （P39933） Transcription factor tau 138 kDa subunit × 1 （P34111） Transcription factor tau 131 kDa subunit × 1 （P33339） Transcription factor tau 95 kDa subunit × 1 （P32367） Transcription factor tau 91 kDa subunit × 1 （Q06339） Transcription factor tau 60 kDa subunit × 1 （Q12308） Transcription factor tau 55 kDa subunit × 1 （Q12415） DNA (151-MER) × 1 DNA (151-MER) × 1 ZINC ION × 9	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TF3B_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–382； UniProt 1–382 Author chain H； PDBConstruct 579–736； UniProt 439–596

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8ffz
Deposition date deposition_date	2022-12-11
Structure title title	TFIIIA-TFIIIC-Brf1-TBP complex bound to 5S rRNA gene
Keywords keywords	transcription factor, TRANSCRIPTION, TRANSCRIPTION-DNA complex; TRANSCRIPTION/DNA
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8ffz__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8ffz__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8ffz__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	75.19 Å
Rg (electron density)	74.46 Å
Total Rg	74.63 Å
Atom count	38962
Residues	4347
Excluded volume	677080 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8ffz__assembly_1__model_1`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (11)

Entity 1 Entity 1 polymer

Description description	Transcription factor IIIA
Molecular weight formula_weight	52522.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	38962

MGGEVLNNEGMPLAELKQETIPISRSESSESLNSLTSTRSSSSNRPKTYFCDYDGCDKAFTRPSILTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHLYTHSDTKPFQCSYCGKGVTTRQQLKRHEVTHTKSFICPEEGCNLRFYKHPQLRAHILSVHLHKLTCPHCNKSFQRPYRLRNHISKHHDPEVENPYQCTFAGCCKEFRIWSQLQSHIKNDHPKLKCPICSKPCVGENGLQMHMIIHDDSLVTKNWKCHICPDMSFSRKHDLLTHYGSIHTEEDIPLELKYKISDIQQLVQDHGVQLGNSKHSNEQDEEKISNRLRKRRKLTENNNVEFLQNEVDLEKRLESGENGLNLLLNTVGRKYRCFYNNCSRTFKTKEKYEKHIDKHKVHELKLKILQEKEENKTLVDQNHKEPFIIQKETQSAGDKADPNSSSVDKLAAALEHHHHHH

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Transcription factor tau 138 kDa subunit
Molecular weight formula_weight	132313.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MVLTIYPDELVQIVSDKIASNKGKITLNQLWDISGKYFDLSDKKVKQFVLSCVILKKDIEVYCDGAITTKNVTDIIGDANHSYSVGITEDSLWTLLTGYTKKESTIGNSAFELLLEVAKSGEKGINTMDLAQVTGQDPRSVTGRIKKINHLLTSSQLIYKGHVVKQLKLKKFSHDGVDSNPYINIRDHLATIVEVVKRSKNGIRQIIDLKRELKFDKEKRLSKAFIAAIAWLDEKEYLKKVLVVSPKNPAIKIRCVKYVKDIPDSKGSPSFEYDSNSADEDSVSDSKAAFEDEDLVEGLDNFNATDLLQNQGLVMEEKEDAVKNEVLLNRFYPLQNQTYDIADKSGLKGISTMDVVNRITGKEFQRAFTKSSEYYLESVDKQKENTGGYRLFRIYDFEGKKKFFRLFTAQNFQKLTNAEDEISVPKGFDELGKSRTDLKTLNEDNFVALNNTVRFTTDSDGQDIFFWHGELKIPPNSKKTPNKNKRKRQVKNSTNASVAGNISNPKRIKLEQHVSTAQEPKSAEDSPSSNGGTVVKGKVVNFGGFSARSLRSLQRQRAILKVMNTIGGVAYLREQFYESVSKYMGSTTTLDKKTVRGDVDLMVESEKLGARTEPVSGRKIIFLPTVGEDAIQRYILKEKDSKKATFTDVIHDTEIYFFDQTEKNRFHRGKKSVERIRKFQNRQKNAKIKASDDAISKKSTSVNVSDGKIKRRDKKVSAGRTTVVVENTKEDKTVYHAGTKDGVQALIRAVVVTKSIKNEIMWDKITKLFPNNSLDNLKKKWTARRVRMGHSGWRAYVDKWKKMLVLAIKSEKISLRDVEELDLIKLLDIWTSFDEKEIKRPLFLYKNYEENRKKFTLVRDDTLTHSGNDLAMSSMIQREISSLKKTYTRKISASTKDLSKSQSDDYIRTVIRSILIESPSTTRNEIEALKNVGNESIDNVIMDMAKEKQIYLHGSKLECTDTLPDILENRGNYKDFGVAFQYRCKVNELLEAGNAIVINQEPSDISSWVLIDLISGELLNMDVIPMVRNVRPLTYTSRRFEIRTLTPPLIIYANSQTKLNTARKSAVKVPLGKPFSRLWVNGSGSIRPNIWKQVVTMVVNEIIFHPGITLSRLQSRCREVLSLHEISEICKWLLERQVLITTDFDGYWVNHNWYSIYEST

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 3 Entity 3 polymer

Description description	Transcription factor tau 131 kDa subunit
Molecular weight formula_weight	120388.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MAAGKLKKEQQNQSAERESADTGKVNDEDEEHLYGNIDDYKHLIQDEEYDDEDVPHDLQLSEDEYNSERDSSLLAEFSDYGEISEDDEEDFMNAIREASNFKVKKKKKNDKGKSYGRQRKERVLDPEVAQLLSQANEAFVRNDLQVAERLFNEVIKKDARNFAAYETLGDIYQLQGRLNDCCNSWFLAAHLNASDWEFWKIVAILSADLDHVRQAIYCFSRVISLNPMEWESIYRRSMLYKKTGQLARALDGFQRLYMYNPYDANILRELAILYVDYDRIEDSIELYMKVFNANVERREAILAALENALDSSDEESAAEGEDADEKEPLEQDEDRQMFPDINWKKIDAKYKCIPFDWSSLNILAELFLKLAVSEVDGIKTIKKCARWIQRRESQTFWDHVPDDSEFDNRRFKNSTFDSLLAAEKEKSYNIPIDIRVRLGLLRLNTDNLVEALNHFQCLYDETFSDVADLYFEAATALTRAEKYKEAIDFFTPLLSLEEWRTTDVFKPLARCYKEIESYETAKEFYELAIKSEPDDLDIRVSLAEVYYRLNDPETFKHMLVDVVEMRKHQVDETLHRISNEKSSNDTSDISSKPLLEDSKFRTFRKKKRTPYDAERERIERERRITAKVVDKYEKMKKFELNSGLNEAKQASIWINTVSELVDIFSSVKNFFMKSRSRKFVGILRRTKKFNTELDFQIERLSKLAEGDSVFEGPLMEERVTLTSATELRGLSYEQWFELFMELSLVIAKYQSVEDGLSVVETAQEVNVFFQDPERVKMMKFVKLAIVLQMDDEEELAENLRGLLNQFQFNRKVLQVFMYSLCRGPSSLNILSSTIQQKFFLRQLKAFDSCRYNTEVNGQASITNKEVYNPNKKSSPYLYYIYAVLLYSSRGFLSALQYLTRLEEDIPDDPMVNLLMGLSHIHRAMQRLTAQRHFQIFHGLRYLYRYHKIRKSLYTDLEKQEADYNLGRAFHLIGLVSIAIEYYNRVLENYDDGKLKKHAAYNSIIIYQQSGNVELADHLMEKYLSI

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 4 Entity 4 polymer

Description description	Transcription factor tau 95 kDa subunit
Molecular weight formula_weight	73649.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MPVEEPLATLSSIPDSSADQAPPLIADEFTLDLPRIPSLELPLNVSTKHSSIQKAIKMCGGIEKVKEAFKEHGPIESQHGLQLYLNDDTDSDGSKSYFNEHPVIGKRVPFRDESVILKVTMPKGTLSKNNNSVKDSIKSLKDSNKLRVTPVSIVDNTIKFREMSDFQIKLDNVPSAREFKSSFGSLEWNNFKSFVNSVPDNDSQPQENIGNLILDRSVKIPSTDFQLPPPPKLSMVGFPLLYKYKANPFAKKKKNGVTEVKGTYIKNYQLFVHDLSDKTVIPSQAHEQVLYDFEVAKKTKVYPGTKSDSKFYESLEECLKILRELFARRPIWVKRHLDGIVPKKIHHTMKIALALISYRFTMGPWRNTYIKFGIDPRSSVEYAQYQTEYFKIERKLLSSPIVKKNVPKPPPLVFESDTPGGIDSRFKFDGKRIPWYLMLQIDLLIGEPNIAEVFHNVEYLDKANELTGWFKELDLVKIRRIVKYELGCMVQGNYEYNKYKLKYFKTMLFVKESMVPENKNSEEGMGVNTNKDADGDINMDAGSQMSSNAIEEDKGIAAGDDFDDNGAITEEPDDAALENEEMDTDQNLKVPASIDDDVDDVDADEEEQESFDVKTASFQDIINKIAKLDPKTAETMKSELKGFVDEVDL

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 5 Entity 5 polymer

Description description	Transcription factor tau 91 kDa subunit
Molecular weight formula_weight	74803.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MAVIPAKKRGRPRKSVVAEVPYDSLASPVSENSGSKRPRRNASKKAVANFAQLVHAGRDDVINTTQVNNVDDTDDDDFVLNDEGDGEESDNVEIEFENELESTKNEVADLNSSGSGASVRPSGRRNTVQKLRLKKNSTKNMKSSSPGSSLGQKGRPIRLLKDLSSARDKIERIYGLNKEKLLLLAKVKEGFETSVFDFPFKNIQPDSPYFVCLDPPCKKESAYNKVIGDKNRTVYHEINKTEFENMIKLRTKRLKLLIGEVDAEVSTGDKIEFPVLANGKRRGFIYNVGGLVTDIAWLNIEENTDIGKDIQYLAVAVSQYMDEPLNEHLEMFDKEKHSSCIQIFKMNTSTLHCVKVQTIVHSFGEVWDLKWHEGCHAPHLVGCLSFVSQEGTINFLEIIDNATDVHVFKMCEKPSLTLSLADSLITTFDFLSPTTVVCGFKNGFVAEFDLTDPEVPSFYDQVHDSYILSVSTAYSDFEDTVVSTVAVDGYFYIFNPKDIATTKTTVSRFRGSNLVPVVYCPQIYSYIYSDGASSLRAVPSRAAFAVHPLVSRETTITAIGVSRLHPMVLAGSADGSLIITNAARRLLHGIKNSSATQKSLRLWKWDYSIKDDKYRIDSSYEVYPLTVNDVSKAKIDAHGINITCTKWNETSAGGKCYAFSNSAGLLTLEYLS

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 6 Entity 6 polymer

Description description	Transcription factor tau 60 kDa subunit
Molecular weight formula_weight	67755.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MKLLKDLLVDRKEFEDWKNNLTWARDGTLYLTTFPDISIGQPKYAKDINCNSKNLFHVKEFPLEFENKLDFELAQQNGLLNSQPVCYPRVCKPSPIDDWMAVLSNNGNVSVFKDNKMLTNLDSKGNLSSRTYHCFEWNPIESSIVVGNEDGELQFFSIRKNSENTPEFYFESSIRLSDAGSKDWVTHIVWYEDVLVAALSNNSVFSMTVSASSHQPVSRMIQNASRRKITDLKIVDYKVVLTCPGYVHKIDLKNYSISSLKTGSLENFHIIPLNHEKESTILLMSNKTSYKVLLEDELHVTADNIIAPYLEKKFKKWSTIWNEFNNYETTLVIHGISLSPDGYSIAIVYDMERVAFKYKIASEQSFNIMFAPLYHTWTISERAVGLAWYQTYQIYNQSLPKLPENFSMNKKLLNGNYPISLDFQSYLNALMKSEEMRIIMFLNMTIDKPSILSFLEALYEYAINKKSELTNSFDLACVLSIAAILKREAPIYNGTLLMKNSFLEETFNLESFTADPETVTSTTNNTWKRCGVTLLPILTTHVKICPVSKQRVIDIKRDDLNDYGWFTRGLLERFNEISVYCGTTLEVM

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 7 Entity 7 polymer

Description description	Transcription factor tau 55 kDa subunit
Molecular weight formula_weight	49198.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MVVNTIYIARHGYRSNWLPEGPYPDPLTGIDSDVPLAEHGVQQAKELAHYLLSLDNQPEAAFASPFYRCLETVQPIAKLLEIPVYLERGIGEWYRPDRKPVIPVPAGYEILSKFFPGVISQEWDSTLTPNEKGETEQEMYMRFKKFWPLFIERVEKEYPNVECILLVTHAASKIALGMSLLGYDNPRMSLNENGDKIRSGSCSLDKYEILKKSYDTIDETDDQTSFTYIPFSDRKWVLTMNGNTEFLSSGEEMNWNFDCVAEAGSDADIKKRQMTKKTSSPIPEADDQTEVETVYISVDIPSGNYKERTEIAKSAILQYSGLETDAPLFRIGNRLYEGSWERLVGTELAFPNAAHVHKKTAGLLSPTEENETTNAGQSKGSSTANDPNIQIQEEDVGLPDSTNTSRDHTGDKEEVQSEKIYRIKERIVLSNVRPM

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 8 Entity 8 polymer

Description description	Transcription factor IIIB 70 kDa subunit,TATA-box-binding protein
Molecular weight formula_weight	82097.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MPVCKNCHGTEFERDLSNANNDLVCKACGVVSEDNPIVSEVTFGETSAGAAVVQGSFIGAGQSHAAFGGSSALESREATLNNARRKLRAVSYALHIPEYITDAAFQWYKLALANNFVQGRRSQNVIASCLYVACRKEKTHHMLIDFSSRLQVSVYSIGATFLKMVKKLHITELPLADPSLFIQHFAEKLDLADKKIKVVKDAVKLAQRMSKDWMFEGRRPAGIAGACILLACRMNNLRRTHTEIVAVSHVAEETLQQRLNEFKNTKAAKLSVQKFRENDVEDGEARPPSFVKNRKKERKIKDSLDKEEMFQTSEEALNKNPILTQVLGEQELSSKEVLFYLKQFSERRARVVERIKATNGIDGENIYHEGSENETRKRKLSEAMPWSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKMGSGSGSGSGSGSPRNLHLLPTTDTYLSKVSDDPDNLEDVDDEELNAHLLNEEASKLKERIWIGLNADFLLEQESKRLKQEADIATGNTSVKKKRTRRRNNTRSDEPTKTVDAAAAIGLMSDLQDKSGLHAALKAAEESGDFTTADSVKNMLQKASFSKKINYDAIDGLFR

Source Source

Source organism organism	Saccharomyces cerevisiae S288C
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli

Entity 9 Entity 9 polymer

Description description	DNA (151-MER)
Molecular weight formula_weight	52636.6 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	I

AACATGTCTGGACCCTGCCCTCATATCACCTGCGTTTCCGTTAAACTATCGGTTGCGGCCATATCTACCAGAAAGCACCGTTTCCCGTCCGATCAACTGTAGTTAAGCTGGTAAGAGCCTGACCGAGTAGTGTAGTGGGTGACCATACGCGAAACTCAGGTGCTGCAATCT

Entity 10 Entity 10 polymer

Description description	DNA (151-MER)
Molecular weight formula_weight	52934.8 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	J

AGATTGCAGCACCTGAGTTTCGCGTATGGTCACCCACTACACTACTCGGTCAGGCTCTTACCAGCTTAACTACAGTTGATCGGACGGGAAACGGTGCTTTCTGGTAGATATGGCCGCAACCGATAGTTTAACGGAAACGCAGGTGATATGAGGGCAGGGTCCAGACATGTT

Entity 11 Entity 11 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	9

▼

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	8ffzG01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1240 — Phosphoglycerate mutase-like

▶

Resolution resolution	3.80 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	78512

TFIIIA-TFIIIC-Brf1-TBP complex bound to 5S rRNA gene

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription factor IIIA

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription factor tau 138 kDa subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription factor tau 131 kDa subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription factor tau 95 kDa subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription factor tau 91 kDa subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription factor tau 60 kDa subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription factor tau 55 kDa subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription factor IIIB 70 kDa subunit,TATA-box-binding protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription factor IIIB 70 kDa subunit,TATA-box-binding protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8ffz__assembly_1__model_1

8ffz__assembly_1__model_1 | I(q)

8ffz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment