SAXSdb — 8xaa

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nucleosome Assembly Protein

Caenorhabditis elegans

UniProt Q19007

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Histone H2A × 1 （Q6AZJ8） Histone H2B 1.1 × 1 （P02281）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	Histone H2A × 1 （Q6AZJ8） Histone H2B 1.1 × 1 （P02281）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q19007_CAEEL
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 22–308； UniProt 10–296 Author chain B； PDBConstruct 22–308； UniProt 10–296 Author chain C； PDBConstruct 22–308； UniProt 10–296 Author chain D； PDBConstruct 22–308； UniProt 10–296 Author chain E； PDBConstruct 22–308； UniProt 10–296 Author chain F； PDBConstruct 22–308； UniProt 10–296 Author chain G； PDBConstruct 22–308； UniProt 10–296 Author chain H； PDBConstruct 22–308； UniProt 10–296

Histone H2A

Xenopus laevis

UniProt Q6AZJ8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Nucleosome Assembly Protein × 4 （Q19007） Histone H2B 1.1 × 1 （P02281）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	Nucleosome Assembly Protein × 4 （Q19007） Histone H2B 1.1 × 1 （P02281）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6AZJ8_XENLA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain I； PDBConstruct 1–92； UniProt 15–106 Author chain K； PDBConstruct 1–92； UniProt 15–106

Histone H2B 1.1

Xenopus laevis

UniProt P02281

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Nucleosome Assembly Protein × 4 （Q19007） Histone H2A × 1 （Q6AZJ8）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	Nucleosome Assembly Protein × 4 （Q19007） Histone H2A × 1 （Q6AZJ8）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H2B11_XENLA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain J； PDBConstruct 1–99； UniProt 28–126 Author chain L； PDBConstruct 1–99； UniProt 28–126

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8xaa
Deposition date deposition_date	2023-12-03
Structure title title	Structure of NAP1 in complex with H2A-H2B
Keywords keywords	NAP1, H2A-H2B, H3-H4, histone chaperone, nucleosome, CHAPERONE; CHAPERONE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8xaa__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8xaa__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8xaa__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	42.58 Å
Rg (electron density)	42.39 Å
Total Rg	42.59 Å
Atom count	9689
Residues	1226
Excluded volume	172700 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8xaa__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`8xaa__assembly_2__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Nucleosome Assembly Protein
Molecular weight formula_weight	34989.2 kDa
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,E,F,C,D,G,H
Atom count atom_count	19338

MGSSHHHHHHSSGENLYFQHMGLLSTNFDMIQALPLNVKQRVCALKNLQMKTIQIESDFYKRVHELEIEFEGKFKSTFDQRKAIVAGEVEPTKEQIDTPILEGLEGDQLAELYKAAEADPSAKGIKDFWLTALRTHDLVAEAIEEHDVPILSYLTDVTTAASKDPAGFKIEFHFATNPYFKNQVLTKTYLLGFDPDAEAPLQFDGPHVIRAVGDTIEWEDGKNVTKKAVKKKQKKGANAGKFLTKTVKADSFFNFFEPPKSKDERNEDEDDEQAEEFLELDYEMGQAIRDTIIPRAVLFYTGELQSDD

Source Source

Source organism organism	Caenorhabditis elegans
NCBI taxonomy ID ncbi_taxonomy_id	6239
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Histone H2A
Molecular weight formula_weight	10133.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,K

AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQG

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Histone H2B 1.1
Molecular weight formula_weight	11165.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,L

KKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Escherichia coli

▶

Unit-cell length a length_a	79.489 Å
Unit-cell length b length_b	92.926 Å
Unit-cell length c length_c	119.354 Å
Unit-cell angle α angle_alpha	104.10 °
Unit-cell angle β angle_beta	106.24 °
Unit-cell angle γ angle_gamma	94.18 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.350 Å
Low-resolution limit resolution_low	45.930 Å
R factor r_factor	0.2066
R_work r_work	0.2037
R_free r_free	0.2613

Structure of NAP1 in complex with H2A-H2B

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nucleosome Assembly Protein

State in the Current Structure

Other States of the Same Protein in the Database

Histone H2A

State in the Current Structure

Other States of the Same Protein in the Database

Histone H2B 1.1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8xaa__assembly_1__model_1

8xaa__assembly_1__model_1 | I(q)

8xaa__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (1)

Structure of NAP1 in complex with H2A-H2B

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nucleosome Assembly Protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H2A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H2B 1.1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8xaa__assembly_1__model_1

8xaa__assembly_1__model_1 | I(q)

8xaa__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (1)