SAXSdb — 8xqb

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Head-tail connector protein FII

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 71 PDB declaration: 71-meric（71） Consistent with protein copy count	Chain f； UniProt 1–117 Chain f1； UniProt 1–117 Chain f2； UniProt 1–117 Chain f3； UniProt 1–117 Chain f4； UniProt 1–117 Chain f5； UniProt 1–117	Not recorded	Head completion protein × 12 （P68660） Tail tube terminator protein × 6 （P03732） Portal protein B × 12 （P03710） Major capsid protein × 15 （P03713） Capsid decoration protein × 20 （P03712）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7 cryo-EM vitrification conditions：Cryogen NITROGEN	Resolution 4.07 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8XQB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1K0H Solution structure of bacteriophage lambda gpFII Deposited 2001-09-19	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–117（117 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 200mM NaCl；Pressure ambient NMR sample composition 1.3mM gpFII U-15N, 13C; 10MM PHOSPHATE BUFFER NA, 200MM NACL \| 90% H2O/10% D2O	Resolution not provided
2KX4 Solution structure of Bacteriophage Lambda gpFII Deposited 2010-04-26	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–117（117 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 0.15；Pressure ambient NMR sample composition 1.5 mM [U-100% 13C; U-100% 15N] gpFII, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
8K37 Structure of the bacteriophage lambda neck Deposited 2023-07-14	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain M 1–117（117 aa） Chain N 1–117（117 aa） Chain O 1–117（117 aa） Chain P 1–117（117 aa） Chain Q 1–117（117 aa） Chain R 1–117（117 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8XOW Mature virion portal of bacteriophage lambda Deposited 2024-01-02	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain f 1–117（117 aa） Chain f1 1–117（117 aa） Chain f2 1–117（117 aa） Chain f3 1–117（117 aa） Chain f4 1–117（117 aa） Chain f5 1–117（117 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.32 Å
8XPM Mature virion portal of phage lambda with DNA Deposited 2024-01-04	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 66 PDB declaration: 68-meric	Chain f 1–117（117 aa） Chain f1 1–117（117 aa） Chain f2 1–117（117 aa） Chain f3 1–117（117 aa） Chain f4 1–117（117 aa） Chain f5 1–117（117 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.90 Å

5 other PDB entries and 5 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FII_LAMBD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain f； PDBConstruct 1–117； UniProt 1–117 Author chain f1； PDBConstruct 1–117； UniProt 1–117 Author chain f2； PDBConstruct 1–117； UniProt 1–117 Author chain f3； PDBConstruct 1–117； UniProt 1–117 Author chain f4； PDBConstruct 1–117； UniProt 1–117 Author chain f5； PDBConstruct 1–117； UniProt 1–117

Head completion protein

OrganismNot specified

UniProt P68660

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 71 PDB declaration: 71-meric（71） Consistent with protein copy count	Chain W； UniProt 1–68 Chain W1； UniProt 1–68 Chain W2； UniProt 1–68 Chain W3； UniProt 1–68 Chain W4； UniProt 1–68 Chain W5； UniProt 1–68 Chain w； UniProt 1–68 Chain w1； UniProt 1–68 Chain w2； UniProt 1–68 Chain w3； UniProt 1–68 Chain w4； UniProt 1–68 Chain w5； UniProt 1–68	Not recorded	Head-tail connector protein FII × 6 （P03714） Tail tube terminator protein × 6 （P03732） Portal protein B × 12 （P03710） Major capsid protein × 15 （P03713） Capsid decoration protein × 20 （P03712）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7 cryo-EM vitrification conditions：Cryogen NITROGEN	Resolution 4.07 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8XQB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1HYW SOLUTION STRUCTURE OF BACTERIOPHAGE LAMBDA GPW Deposited 2001-01-22	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–68（68 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 200mM NaCl；Pressure ambient NMR sample composition 1.5mM gpW U-15N, 13C; 10mM phosphate buffer NA, 200mM NaCl,90% H2O,10% D2O \| 90% H2O/10% D2O	Resolution not provided
8K38 The structure of bacteriophage lambda portal-adaptor Deposited 2023-07-14	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain M 1–68（68 aa） Chain N 1–68（68 aa） Chain O 1–68（68 aa） Chain P 1–68（68 aa） Chain Q 1–68（68 aa） Chain R 1–68（68 aa） Chain S 1–68（68 aa） Chain T 1–68（68 aa） Chain U 1–68（68 aa） Chain V 1–68（68 aa） Chain W 1–68（68 aa） Chain X 1–68（68 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8XOW Mature virion portal of bacteriophage lambda Deposited 2024-01-02	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain W 1–68（68 aa） Chain W1 1–68（68 aa） Chain W2 1–68（68 aa） Chain W3 1–68（68 aa） Chain W4 1–68（68 aa） Chain W5 1–68（68 aa） Chain w 1–68（68 aa） Chain w1 1–68（68 aa） Chain w2 1–68（68 aa） Chain w3 1–68（68 aa） Chain w4 1–68（68 aa） Chain w5 1–68（68 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.32 Å
8XPM Mature virion portal of phage lambda with DNA Deposited 2024-01-04	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 66 PDB declaration: 68-meric	Chain W 1–68（68 aa） Chain W1 1–68（68 aa） Chain W2 1–68（68 aa） Chain W3 1–68（68 aa） Chain W4 1–68（68 aa） Chain W5 1–68（68 aa） Chain w 1–68（68 aa） Chain w1 1–68（68 aa） Chain w2 1–68（68 aa） Chain w3 1–68（68 aa） Chain w4 1–68（68 aa） Chain w5 1–68（68 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.90 Å

4 other PDB entries and 4 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	HCP_LAMBD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain W； PDBConstruct 1–68； UniProt 1–68 Author chain W1； PDBConstruct 1–68； UniProt 1–68 Author chain W2； PDBConstruct 1–68； UniProt 1–68 Author chain W3； PDBConstruct 1–68； UniProt 1–68 Author chain W4； PDBConstruct 1–68； UniProt 1–68 Author chain W5； PDBConstruct 1–68； UniProt 1–68 Author chain w； PDBConstruct 1–68； UniProt 1–68 Author chain w1； PDBConstruct 1–68； UniProt 1–68 Author chain w2； PDBConstruct 1–68； UniProt 1–68 Author chain w3； PDBConstruct 1–68； UniProt 1–68 Author chain w4； PDBConstruct 1–68； UniProt 1–68 Author chain w5； PDBConstruct 1–68； UniProt 1–68

Tail tube terminator protein

OrganismNot specified

UniProt P03732

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 71 PDB declaration: 71-meric（71） Consistent with protein copy count	Chain U； UniProt 1–131 Chain U1； UniProt 1–131 Chain U2； UniProt 1–131 Chain U3； UniProt 1–131 Chain U4； UniProt 1–131 Chain U5； UniProt 1–131	Not recorded	Head-tail connector protein FII × 6 （P03714） Head completion protein × 12 （P68660） Portal protein B × 12 （P03710） Major capsid protein × 15 （P03713） Capsid decoration protein × 20 （P03712）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7 cryo-EM vitrification conditions：Cryogen NITROGEN	Resolution 4.07 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8XQB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1Z1Z NMR structure of the gpu tail protein from lambda bacteriophage Deposited 2005-03-07	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–131（131 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.8；293 K；Ionic strength (raw mmCIF value) 50 mM KCl；Pressure 1 NMR sample composition 0.9 mM gpU, U-15N,13C, 10 mM Tris-d11, pH 7.8, 50 mM potassium chloride, 0.02% sodium azide, 10% D2O, 90% H2O \| 10% D2O, 90% H2O	Resolution not provided
3FZ2 Crystal structure of the tail terminator protein from phage lambda (gpU-D74A) Deposited 2009-01-23	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–131（131 aa） Chain B 1–131（131 aa） Chain E 1–131（131 aa） Chain F 1–131（131 aa） Chain I 1–131（131 aa） Chain K 1–131（131 aa）	Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF)	SO4 SULFATE ION × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；0.2M Di-ammonium tartrate, 2.2M Ammonium sulfate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.70 Å R-free 0.283
3FZ2 Crystal structure of the tail terminator protein from phage lambda (gpU-D74A) Deposited 2009-01-23	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain C 1–131（131 aa） Chain D 1–131（131 aa） Chain G 1–131（131 aa） Chain H 1–131（131 aa） Chain J 1–131（131 aa） Chain L 1–131（131 aa）	Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF)	SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；0.2M Di-ammonium tartrate, 2.2M Ammonium sulfate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.70 Å R-free 0.283
3FZ2 Crystal structure of the tail terminator protein from phage lambda (gpU-D74A) Deposited 2009-01-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 1–131（131 aa） Chain B 1–131（131 aa） Chain C 1–131（131 aa） Chain D 1–131（131 aa） Chain E 1–131（131 aa） Chain F 1–131（131 aa） Chain G 1–131（131 aa） Chain H 1–131（131 aa） Chain I 1–131（131 aa） Chain J 1–131（131 aa） Chain K 1–131（131 aa） Chain L 1–131（131 aa）	Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：D74A Non-standard monomer：Yes (specific site not provided by mmCIF)	SO4 SULFATE ION × 13	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；0.2M Di-ammonium tartrate, 2.2M Ammonium sulfate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.70 Å R-free 0.283
3FZB Crystal structure of the tail terminator protein from phage lambda (gpU-WT) Deposited 2009-01-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 5 PDB declaration: pentameric	Chain A 1–131（131 aa） Chain B 1–131（131 aa） Chain F 1–131（131 aa） Chain H 1–131（131 aa） Chain I 1–131（131 aa）	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；0.2M Tri-sodium citrate, 2.2M Ammonium sulfate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.80 Å R-free 0.309
3FZB Crystal structure of the tail terminator protein from phage lambda (gpU-WT) Deposited 2009-01-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 5 PDB declaration: pentameric	Chain C 1–131（131 aa） Chain D 1–131（131 aa） Chain E 1–131（131 aa） Chain G 1–131（131 aa） Chain J 1–131（131 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；0.2M Tri-sodium citrate, 2.2M Ammonium sulfate, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.80 Å R-free 0.309
8IYD Tail cap of phage lambda tail Deposited 2023-04-04	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain G 1–131（131 aa） Chain K 1–131（131 aa） Chain Q 1–131（131 aa） Chain U 1–131（131 aa） Chain W 1–131（131 aa） Chain u 1–131（131 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.10 Å
8K37 Structure of the bacteriophage lambda neck Deposited 2023-07-14	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain A 1–131（131 aa） Chain B 1–131（131 aa） Chain C 1–131（131 aa） Chain D 1–131（131 aa） Chain E 1–131（131 aa） Chain F 1–131（131 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8XOW Mature virion portal of bacteriophage lambda Deposited 2024-01-02	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain U 1–131（131 aa） Chain U1 1–131（131 aa） Chain U2 1–131（131 aa） Chain U3 1–131（131 aa） Chain U4 1–131（131 aa） Chain U5 1–131（131 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.32 Å
8XPM Mature virion portal of phage lambda with DNA Deposited 2024-01-04	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 66 PDB declaration: 68-meric	Chain U 1–131（131 aa） Chain U1 1–131（131 aa） Chain U2 1–131（131 aa） Chain U3 1–131（131 aa） Chain U4 1–131（131 aa） Chain U5 1–131（131 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.90 Å

7 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TTTP_LAMBD
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain U； PDBConstruct 1–131； UniProt 1–131 Author chain U1； PDBConstruct 1–131； UniProt 1–131 Author chain U2； PDBConstruct 1–131； UniProt 1–131 Author chain U3； PDBConstruct 1–131； UniProt 1–131 Author chain U4； PDBConstruct 1–131； UniProt 1–131 Author chain U5； PDBConstruct 1–131； UniProt 1–131

Portal protein B

OrganismNot specified

UniProt P03710

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 71 PDB declaration: 71-meric（71） Consistent with protein copy count	Chain B； UniProt 1–533 Chain B1； UniProt 1–533 Chain B2； UniProt 1–533 Chain B3； UniProt 1–533 Chain B4； UniProt 1–533 Chain B5； UniProt 1–533 Chain b； UniProt 1–533 Chain b1； UniProt 1–533 Chain b2； UniProt 1–533 Chain b3； UniProt 1–533 Chain b4； UniProt 1–533 Chain b5； UniProt 1–533	Not recorded	Head-tail connector protein FII × 6 （P03714） Head completion protein × 12 （P68660） Tail tube terminator protein × 6 （P03732） Major capsid protein × 15 （P03713） Capsid decoration protein × 20 （P03712）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7 cryo-EM vitrification conditions：Cryogen NITROGEN	Resolution 4.07 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8XQB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8K38 The structure of bacteriophage lambda portal-adaptor Deposited 2023-07-14	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain A 1–533（533 aa） Chain B 1–533（533 aa） Chain C 1–533（533 aa） Chain D 1–533（533 aa） Chain E 1–533（533 aa） Chain F 1–533（533 aa） Chain G 1–533（533 aa） Chain H 1–533（533 aa） Chain I 1–533（533 aa） Chain J 1–533（533 aa） Chain K 1–533（533 aa） Chain L 1–533（533 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8K39 Structure of the bacteriophage lambda portal vertex Deposited 2023-07-14	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 42 PDB declaration: 42-meric	Chain U 1–533（533 aa） Chain V 1–533（533 aa） Chain W 1–533（533 aa） Chain X 1–533（533 aa） Chain Y 1–533（533 aa） Chain Z 1–533（533 aa） Chain a 1–533（533 aa） Chain b 1–533（533 aa） Chain c 1–533（533 aa） Chain d 1–533（533 aa） Chain e 1–533（533 aa） Chain f 1–533（533 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
8XOT Prohead portal of bacteriophage lambda Deposited 2024-01-02	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: 12-meric	Chain B 1–533（533 aa） Chain B1 1–533（533 aa） Chain B2 1–533（533 aa） Chain B3 1–533（533 aa） Chain B4 1–533（533 aa） Chain B5 1–533（533 aa） Chain b 1–533（533 aa） Chain b1 1–533（533 aa） Chain b2 1–533（533 aa） Chain b3 1–533（533 aa） Chain b4 1–533（533 aa） Chain b5 1–533（533 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.51 Å
8XOU Prohead portal vertex of bacteriophage lambda Deposited 2024-01-02	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 42 PDB declaration: 42-meric	Chain B 1–533（533 aa） Chain B1 1–533（533 aa） Chain B2 1–533（533 aa） Chain B3 1–533（533 aa） Chain B4 1–533（533 aa） Chain B5 1–533（533 aa） Chain b 1–533（533 aa） Chain b1 1–533（533 aa） Chain b2 1–533（533 aa） Chain b3 1–533（533 aa） Chain b4 1–533（533 aa） Chain b5 1–533（533 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 5.58 Å
8XOW Mature virion portal of bacteriophage lambda Deposited 2024-01-02	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain B 1–533（533 aa） Chain B1 1–533（533 aa） Chain B2 1–533（533 aa） Chain B3 1–533（533 aa） Chain B4 1–533（533 aa） Chain B5 1–533（533 aa） Chain b 1–533（533 aa） Chain b1 1–533（533 aa） Chain b2 1–533（533 aa） Chain b3 1–533（533 aa） Chain b4 1–533（533 aa） Chain b5 1–533（533 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.32 Å
8XPM Mature virion portal of phage lambda with DNA Deposited 2024-01-04	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 66 PDB declaration: 68-meric	Chain B 1–533（533 aa） Chain B1 1–533（533 aa） Chain B2 1–533（533 aa） Chain B3 1–533（533 aa） Chain B4 1–533（533 aa） Chain B5 1–533（533 aa） Chain b 1–533（533 aa） Chain b1 1–533（533 aa） Chain b2 1–533（533 aa） Chain b3 1–533（533 aa） Chain b4 1–533（533 aa） Chain b5 1–533（533 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.90 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PORTL_LAMBD
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain B； PDBConstruct 1–533； UniProt 1–533 Author chain B1； PDBConstruct 1–533； UniProt 1–533 Author chain B2； PDBConstruct 1–533； UniProt 1–533 Author chain B3； PDBConstruct 1–533； UniProt 1–533 Author chain B4； PDBConstruct 1–533； UniProt 1–533 Author chain B5； PDBConstruct 1–533； UniProt 1–533 Author chain b； PDBConstruct 1–533； UniProt 1–533 Author chain b1； PDBConstruct 1–533； UniProt 1–533 Author chain b2； PDBConstruct 1–533； UniProt 1–533 Author chain b3； PDBConstruct 1–533； UniProt 1–533 Author chain b4； PDBConstruct 1–533； UniProt 1–533 Author chain b5； PDBConstruct 1–533； UniProt 1–533

Major capsid protein

OrganismNot specified

UniProt P03713

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 71 PDB declaration: 71-meric（71） Consistent with protein copy count	Chain A0； UniProt 1–341 Chain A1； UniProt 1–341 Chain A2； UniProt 1–341 Chain A3； UniProt 1–341 Chain A4； UniProt 1–341 Chain C0； UniProt 1–341 Chain C1； UniProt 1–341 Chain C2； UniProt 1–341 Chain C3； UniProt 1–341 Chain C4； UniProt 1–341 Chain G0； UniProt 1–341 Chain G1； UniProt 1–341 Chain G2； UniProt 1–341 Chain G3； UniProt 1–341 Chain G4； UniProt 1–341	Not recorded	Head-tail connector protein FII × 6 （P03714） Head completion protein × 12 （P68660） Tail tube terminator protein × 6 （P03732） Portal protein B × 12 （P03710） Capsid decoration protein × 20 （P03712）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7 cryo-EM vitrification conditions：Cryogen NITROGEN	Resolution 4.07 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8XQB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7SJ5 Bacteriophage lambda major capsid protein mutant - W308A Deposited 2021-10-15	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–341（341 aa） Chain B 1–341（341 aa） Chain C 1–341（341 aa） Chain D 1–341（341 aa）	Mutation：W308A Mutation：W308A Mutation：W308A Mutation：W308A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.7；291.15 K；0.1 M bis-tris, 0.1 M ammonium sulfate, 5% v/v glycerol, 30% v/v PEG-3350	Resolution 2.69 Å R-free 0.230
7VI9 Cryo-EM structure of bacteriophage lambda procapsid at 5.03 Angstrom Deposited 2021-09-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 420 PDB declaration: 420-meric	Chain A 1–341（341 aa） Chain B 1–341（341 aa） Chain C 1–341（341 aa） Chain D 1–341（341 aa） Chain E 1–341（341 aa） Chain F 1–341（341 aa） Chain G 1–341（341 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 5.03 Å
7VI9 Cryo-EM structure of bacteriophage lambda procapsid at 5.03 Angstrom Deposited 2021-09-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 7 PDB declaration: heptameric	Chain A 1–341（341 aa） Chain B 1–341（341 aa） Chain C 1–341（341 aa） Chain D 1–341（341 aa） Chain E 1–341（341 aa） Chain F 1–341（341 aa） Chain G 1–341（341 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 5.03 Å
7VI9 Cryo-EM structure of bacteriophage lambda procapsid at 5.03 Angstrom Deposited 2021-09-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 35 PDB declaration: 35-meric	Chain A 1–341（341 aa） Chain B 1–341（341 aa） Chain C 1–341（341 aa） Chain D 1–341（341 aa） Chain E 1–341（341 aa） Chain F 1–341（341 aa） Chain G 1–341（341 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 5.03 Å
7VI9 Cryo-EM structure of bacteriophage lambda procapsid at 5.03 Angstrom Deposited 2021-09-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 42 PDB declaration: 42-meric	Chain A 1–341（341 aa） Chain B 1–341（341 aa） Chain C 1–341（341 aa） Chain D 1–341（341 aa） Chain E 1–341（341 aa） Chain F 1–341（341 aa） Chain G 1–341（341 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 5.03 Å
7VI9 Cryo-EM structure of bacteriophage lambda procapsid at 5.03 Angstrom Deposited 2021-09-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 7 PDB declaration: heptameric	Chain A 1–341（341 aa） Chain B 1–341（341 aa） Chain C 1–341（341 aa） Chain D 1–341（341 aa） Chain E 1–341（341 aa） Chain F 1–341（341 aa） Chain G 1–341（341 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 5.03 Å
7VIA Focused refinement of asymmetric unit of bacteriophage lambda procapsid at 3.88 Angstrom Deposited 2021-09-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 7 PDB declaration: heptameric	Chain A 1–341（341 aa） Chain B 1–341（341 aa） Chain C 1–341（341 aa） Chain D 1–341（341 aa） Chain E 1–341（341 aa） Chain F 1–341（341 aa） Chain G 1–341（341 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.88 Å
7VII cryoEM structure of bacteriophage lambda capsid at 5.6 Angstrom Deposited 2021-09-27	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 840 PDB declaration: 840-meric	Chain A 1–341（341 aa） Chain B 1–341（341 aa） Chain C 1–341（341 aa） Chain D 1–341（341 aa） Chain E 1–341（341 aa） Chain F 1–341（341 aa） Chain G 1–341（341 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 5.60 Å
7VII cryoEM structure of bacteriophage lambda capsid at 5.6 Angstrom Deposited 2021-09-27	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain A 1–341（341 aa） Chain B 1–341（341 aa） Chain C 1–341（341 aa） Chain D 1–341（341 aa） Chain E 1–341（341 aa） Chain F 1–341（341 aa） Chain G 1–341（341 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 5.60 Å
7VII cryoEM structure of bacteriophage lambda capsid at 5.6 Angstrom Deposited 2021-09-27	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 70 PDB declaration: 70-meric	Chain A 1–341（341 aa） Chain B 1–341（341 aa） Chain C 1–341（341 aa） Chain D 1–341（341 aa） Chain E 1–341（341 aa） Chain F 1–341（341 aa） Chain G 1–341（341 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 5.60 Å
7VII cryoEM structure of bacteriophage lambda capsid at 5.6 Angstrom Deposited 2021-09-27	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 84 PDB declaration: 84-meric	Chain A 1–341（341 aa） Chain B 1–341（341 aa） Chain C 1–341（341 aa） Chain D 1–341（341 aa） Chain E 1–341（341 aa） Chain F 1–341（341 aa） Chain G 1–341（341 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 5.60 Å
7VII cryoEM structure of bacteriophage lambda capsid at 5.6 Angstrom Deposited 2021-09-27	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain A 1–341（341 aa） Chain B 1–341（341 aa） Chain C 1–341（341 aa） Chain D 1–341（341 aa） Chain E 1–341（341 aa） Chain F 1–341（341 aa） Chain G 1–341（341 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 5.60 Å
7VIK Asymmetric unit of cryoEM structure of bacteriophage lambda capsid at 3.76 Angstrom Deposited 2021-09-27	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain A 1–341（341 aa） Chain B 1–341（341 aa） Chain C 1–341（341 aa） Chain D 1–341（341 aa） Chain E 1–341（341 aa） Chain F 1–341（341 aa） Chain G 1–341（341 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.76 Å
8K39 Structure of the bacteriophage lambda portal vertex Deposited 2023-07-14	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 42 PDB declaration: 42-meric	Chain 0 1–341（341 aa） Chain 1 1–341（341 aa） Chain 2 1–341（341 aa） Chain 3 1–341（341 aa） Chain 4 1–341（341 aa） Chain 5 1–341（341 aa） Chain 6 1–341（341 aa） Chain 7 1–341（341 aa） Chain A 1–341（341 aa） Chain B 1–341（341 aa） Chain C 1–341（341 aa） Chain D 1–341（341 aa） Chain E 1–341（341 aa） Chain F 1–341（341 aa） Chain G 1–341（341 aa） Chain H 1–341（341 aa） Chain I 1–341（341 aa） Chain J 1–341（341 aa） Chain K 1–341（341 aa） Chain L 1–341（341 aa） Chain M 1–341（341 aa） Chain N 1–341（341 aa） Chain O 1–341（341 aa） Chain P 1–341（341 aa） Chain Q 1–341（341 aa） Chain R 1–341（341 aa） Chain S 1–341（341 aa） Chain T 1–341（341 aa） Chain g 1–341（341 aa） Chain h 1–341（341 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
8XOU Prohead portal vertex of bacteriophage lambda Deposited 2024-01-02	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 42 PDB declaration: 42-meric	Chain A0 1–341（341 aa） Chain A1 1–341（341 aa） Chain A2 1–341（341 aa） Chain A3 1–341（341 aa） Chain A4 1–341（341 aa） Chain C0 1–341（341 aa） Chain C1 1–341（341 aa） Chain C2 1–341（341 aa） Chain C3 1–341（341 aa） Chain C4 1–341（341 aa） Chain D0 1–341（341 aa） Chain D1 1–341（341 aa） Chain D2 1–341（341 aa） Chain D3 1–341（341 aa） Chain D4 1–341（341 aa） Chain E0 1–341（341 aa） Chain E1 1–341（341 aa） Chain E2 1–341（341 aa） Chain E3 1–341（341 aa） Chain E4 1–341（341 aa） Chain F0 1–341（341 aa） Chain F1 1–341（341 aa） Chain F2 1–341（341 aa） Chain F3 1–341（341 aa） Chain F4 1–341（341 aa） Chain G0 1–341（341 aa） Chain G1 1–341（341 aa） Chain G2 1–341（341 aa） Chain G3 1–341（341 aa） Chain G4 1–341（341 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 5.58 Å

7 other PDB entries and 15 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CAPSD_LAMBD
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain A0； PDBConstruct 1–341； UniProt 1–341 Author chain A1； PDBConstruct 1–341； UniProt 1–341 Author chain A2； PDBConstruct 1–341； UniProt 1–341 Author chain A3； PDBConstruct 1–341； UniProt 1–341 Author chain A4； PDBConstruct 1–341； UniProt 1–341 Author chain C0； PDBConstruct 1–341； UniProt 1–341 Author chain C1； PDBConstruct 1–341； UniProt 1–341 Author chain C2； PDBConstruct 1–341； UniProt 1–341 Author chain C3； PDBConstruct 1–341； UniProt 1–341 Author chain C4； PDBConstruct 1–341； UniProt 1–341 Author chain G0； PDBConstruct 1–341； UniProt 1–341 Author chain G1； PDBConstruct 1–341； UniProt 1–341 Author chain G2； PDBConstruct 1–341； UniProt 1–341 Author chain G3； PDBConstruct 1–341； UniProt 1–341 Author chain G4； PDBConstruct 1–341； UniProt 1–341

Capsid decoration protein

OrganismNot specified

UniProt P03712

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 71 PDB declaration: 71-meric（71） Consistent with protein copy count	Chain H0； UniProt 1–110 Chain H1； UniProt 1–110 Chain H2； UniProt 1–110 Chain H3； UniProt 1–110 Chain H4； UniProt 1–110 Chain I0； UniProt 1–110 Chain I1； UniProt 1–110 Chain I2； UniProt 1–110 Chain I3； UniProt 1–110 Chain I4； UniProt 1–110 Chain J0； UniProt 1–110 Chain J1； UniProt 1–110 Chain J2； UniProt 1–110 Chain J3； UniProt 1–110 Chain J4； UniProt 1–110 Chain N0； UniProt 1–110 Chain N1； UniProt 1–110 Chain N2； UniProt 1–110 Chain N3； UniProt 1–110 Chain N4； UniProt 1–110	Not recorded	Head-tail connector protein FII × 6 （P03714） Head completion protein × 12 （P68660） Tail tube terminator protein × 6 （P03732） Portal protein B × 12 （P03710） Major capsid protein × 15 （P03713）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7 cryo-EM vitrification conditions：Cryogen NITROGEN	Resolution 4.07 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8XQB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1C5E BACTERIOPHAGE LAMBDA HEAD PROTEIN D Deposited 1999-11-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 16–110（95 aa） Chain B 16–110（95 aa） Chain C 16–110（95 aa）	Not recorded	GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；28% PEG 4000, 0.1 M BIS-TRIS PH 6.5, 10 % GLYCEROL	Resolution 1.10 Å R-free 0.133
1TCZ Crystal structure of a truncated version of the phage lamda protein gpD Deposited 2004-05-21	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 16–110（95 aa） Fragment：N-terminal truncation Chain B 16–110（95 aa） Fragment：N-terminal truncation Chain C 16–110（95 aa） Fragment：N-terminal truncation	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；295 K；Tris-HCl, PEG 4000, Mg acetate, glycerol, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.85 Å R-free 0.232
1TCZ Crystal structure of a truncated version of the phage lamda protein gpD Deposited 2004-05-21	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain D 16–110（95 aa） Fragment：N-terminal truncation Chain E 16–110（95 aa） Fragment：N-terminal truncation Chain F 16–110（95 aa） Fragment：N-terminal truncation	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；295 K；Tris-HCl, PEG 4000, Mg acetate, glycerol, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.85 Å R-free 0.232
1VD0 Capsid stabilizing protein GPD, NMR, 20 Structures Deposited 2004-03-17	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–110（109 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6；298 K；Pressure AMBIENT NMR sample composition 1.3mm 15N labelled GPD, 20mm sodium phosphate \| 90% H2O/10% D2O NMR sample composition 1.3mm GPD, 50mm sodium phosphate \| 100% D2O	Resolution not provided
5MFD Designed armadillo repeat protein YIIIM''6AII in complex with pD_(KR)5 Deposited 2016-11-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 21–110（90 aa） Fragment：UNP residues 21-110	Not recorded	CA CALCIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；28.0%v/v PEG 400, 0.2M Calcium chloride, 0.1M Na HEPES pH 7.5	Resolution 2.30 Å R-free 0.214
5MFD Designed armadillo repeat protein YIIIM''6AII in complex with pD_(KR)5 Deposited 2016-11-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 21–110（90 aa） Fragment：UNP residues 21-110	Not recorded	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；28.0%v/v PEG 400, 0.2M Calcium chloride, 0.1M Na HEPES pH 7.5	Resolution 2.30 Å R-free 0.214
5MFD Designed armadillo repeat protein YIIIM''6AII in complex with pD_(KR)5 Deposited 2016-11-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 21–110（90 aa） Fragment：UNP residues 21-110	Not recorded	CA CALCIUM ION × 10	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；28.0%v/v PEG 400, 0.2M Calcium chloride, 0.1M Na HEPES pH 7.5	Resolution 2.30 Å R-free 0.214
5MFD Designed armadillo repeat protein YIIIM''6AII in complex with pD_(KR)5 Deposited 2016-11-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 21–110（90 aa） Fragment：UNP residues 21-110	Not recorded	CA CALCIUM ION × 10	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；28.0%v/v PEG 400, 0.2M Calcium chloride, 0.1M Na HEPES pH 7.5	Resolution 2.30 Å R-free 0.214
7VII cryoEM structure of bacteriophage lambda capsid at 5.6 Angstrom Deposited 2021-09-27	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 840 PDB declaration: 840-meric	Chain H 1–110（110 aa） Chain I 1–110（110 aa） Chain J 1–110（110 aa） Chain K 1–110（110 aa） Chain L 1–110（110 aa） Chain M 1–110（110 aa） Chain N 1–110（110 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 5.60 Å
7VII cryoEM structure of bacteriophage lambda capsid at 5.6 Angstrom Deposited 2021-09-27	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain H 1–110（110 aa） Chain I 1–110（110 aa） Chain J 1–110（110 aa） Chain K 1–110（110 aa） Chain L 1–110（110 aa） Chain M 1–110（110 aa） Chain N 1–110（110 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 5.60 Å
7VII cryoEM structure of bacteriophage lambda capsid at 5.6 Angstrom Deposited 2021-09-27	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 70 PDB declaration: 70-meric	Chain H 1–110（110 aa） Chain I 1–110（110 aa） Chain J 1–110（110 aa） Chain K 1–110（110 aa） Chain L 1–110（110 aa） Chain M 1–110（110 aa） Chain N 1–110（110 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 5.60 Å
7VII cryoEM structure of bacteriophage lambda capsid at 5.6 Angstrom Deposited 2021-09-27	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 84 PDB declaration: 84-meric	Chain H 1–110（110 aa） Chain I 1–110（110 aa） Chain J 1–110（110 aa） Chain K 1–110（110 aa） Chain L 1–110（110 aa） Chain M 1–110（110 aa） Chain N 1–110（110 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 5.60 Å
7VII cryoEM structure of bacteriophage lambda capsid at 5.6 Angstrom Deposited 2021-09-27	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain H 1–110（110 aa） Chain I 1–110（110 aa） Chain J 1–110（110 aa） Chain K 1–110（110 aa） Chain L 1–110（110 aa） Chain M 1–110（110 aa） Chain N 1–110（110 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 5.60 Å
7VIK Asymmetric unit of cryoEM structure of bacteriophage lambda capsid at 3.76 Angstrom Deposited 2021-09-27	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain H 1–110（110 aa） Chain I 1–110（110 aa） Chain J 1–110（110 aa） Chain K 1–110（110 aa） Chain L 1–110（110 aa） Chain M 1–110（110 aa） Chain N 1–110（110 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.76 Å

6 other PDB entries and 14 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	DECO_LAMBD
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain H0； PDBConstruct 1–110； UniProt 1–110 Author chain H1； PDBConstruct 1–110； UniProt 1–110 Author chain H2； PDBConstruct 1–110； UniProt 1–110 Author chain H3； PDBConstruct 1–110； UniProt 1–110 Author chain H4； PDBConstruct 1–110； UniProt 1–110 Author chain I0； PDBConstruct 1–110； UniProt 1–110 Author chain I1； PDBConstruct 1–110； UniProt 1–110 Author chain I2； PDBConstruct 1–110； UniProt 1–110 Author chain I3； PDBConstruct 1–110； UniProt 1–110 Author chain I4； PDBConstruct 1–110； UniProt 1–110 Author chain J0； PDBConstruct 1–110； UniProt 1–110 Author chain J1； PDBConstruct 1–110； UniProt 1–110 Author chain J2； PDBConstruct 1–110； UniProt 1–110 Author chain J3； PDBConstruct 1–110； UniProt 1–110 Author chain J4； PDBConstruct 1–110； UniProt 1–110 Author chain N0； PDBConstruct 1–110； UniProt 1–110 Author chain N1； PDBConstruct 1–110； UniProt 1–110 Author chain N2； PDBConstruct 1–110； UniProt 1–110 Author chain N3； PDBConstruct 1–110； UniProt 1–110 Author chain N4； PDBConstruct 1–110； UniProt 1–110

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8xqb
Deposition date deposition_date	2024-01-05
Structure title title	Mature virion portal vertex of bacteriophage lambda
Keywords keywords	caudovirales, siphoviridae, portal, capsid, connector/neck, tail, delivery device, B-DNA, phage lambda, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	85.36 Å
Radius of gyration Rg (electron density) rg_electron	85.40 Å
Forward intensity I(0) i0	41003400000.00
Molecular weight molecular_weight	1683600.0 kDa
Excluded volume excluded_volume	2087400 Å³
Envelope volume envelope_volume	3303200 Å³
Hydration-shell volume shell_volume	305220 Å³
Envelope diameter envelope_diameter	311.0 Å
Shell Rg shell_rg	92.07 Å
Envelope Rg envelope_rg	86.23 Å
Shape Rg shape_rg	85.40 Å
Total Rg total_rg	85.45 Å
Total atoms total_atoms	118454
Residues n_residues	15222
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	224.1 Å
Rg (real space) rg_real	82.13 Å
Rg uncertainty (real space) rg_real_error	0.42 Å
I(0) (real space) i0_real	3.9070e+10
I(0) uncertainty (real space) i0_real_error	6.0870e+08
Rg (reciprocal space) rg_reciprocal	86.03 Å
I(0) (reciprocal space) i0_reciprocal	41080000000.0000
Solution quality estimate total_estimate	0.9097
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	99.6 Å
Skewness Skewness skewness	0.128
Kurtosis Kurtosis kurtosis	-0.573
Angular range angular_range	— – 0.0900 Å⁻¹
Current regularization parameter α current_alpha	0.9452
Highest regularization parameter α highest_alpha	4697000000.0000
Real-space data points n_real_points	19
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.999; Stabil: 0.963; Sysdev: 1.000; Positv: 1.000; Valcen: 0.942; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Head-tail connector protein FII
Molecular weight formula_weight	12775.0 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f,f1,f2,f3,f4,f5
Atom count atom_count	118514

MADFDNLFDAAIARADETIRGYMGTSATITSGEQSGAVIRGVFDDPENISYAGQGVRVEGSSPSLFVRTDEVRQLRRGDTLTIGEENFWVDRVSPDDGGSCHLWLGRGVPPAVNRRR

Entity 2 Entity 2 polymer

Description description	Head completion protein
Molecular weight formula_weight	7625.7 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W,w,W1,w1,W2,w2,W3,w3,W4,w4,W5,w5

MTRQEELAAARAALHDLMTGKRVATVQKDGRRVEFTATSVSDLKKYIAELEVQTGMTQRRRGPAGFYV

Entity 3 Entity 3 polymer

Description description	Tail tube terminator protein
Molecular weight formula_weight	14659.1 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U,U1,U2,U3,U4,U5

MKHTELRAAVLDALEKHDTGATFFDGRPAVFDEADFPAVAVYLTGAEYTGEELDSDTWQAELHIEVFLPAQVPDSELDAWMESRIYPVMSDIPALSDLITSMVASGYDYRRDDDAGLWSSADLTYVITYEM

Entity 4 Entity 4 polymer

Description description	Portal protein B
Molecular weight formula_weight	59529.6 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,b,B1,b1,B2,b2,B3,b3,B4,b4,B5,b5

MKTPTIPTLLGPDGMTSLREYAGYHGGGSGFGGQLRSWNPPSESVDAALLPNFTRGNARADDLVRNNGYAANAIQLHQDHIVGSFFRLSHRPSWRYLGIGEEEARAFSREVEAAWKEFAEDDCCCIDVERKRTFTMMIREGVAMHAFNGELFVQATWDTSSSRLFRTQFRMVSPKRISNPNNTGDSRNCRAGVQINDSGAALGYYVSEDGYPGWMPQKWTWIPRELPGGRASFIHVFEPVEDGQTRGANVFYSVMEQMKMLDTLQNTQLQSAIVKAMYAATIESELDTQSAMDFILGANSQEQRERLTGWIGEIAAYYAAAPVRLGGAKVPHLMPGDSLNLQTAQDTDNGYSVFEQSLLRYIAAGLGVSYEQLSRNYAQMSYSTARASANESWAYFMGRRKFVASRQASQMFLCWLEEAIVRRVVTLPSKARFSFQEARSAWGNCDWIGSGRMAIDGLKEVQEAVMLIEAGLSTYEKECAKRGDDYQEIFAQQVRETMERRAAGLKPPAWAAAAFESGLRQSTEEEKSDSRAA

Entity 5 Entity 5 polymer

Description description	Major capsid protein
Molecular weight formula_weight	38229.2 kDa
Source method src_method	nat
Copy count entity_count	15

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A0,G0,C0,A1,G1,C1,A2,G2,C2,A3,G3,C3,A4,G4,C4

MSMYTTAQLLAANEQKFKFDPLFLRLFFRESYPFTTEKVYLSQIPGLVNMALYVSPIVSGEVIRSRGGSTSEFTPGYVKPKHEVNPQMTLRRLPDEDPQNLADPAYRRRRIIMQNMRDEELAIAQVEEMQAVSAVLKGKYTMTGEAFDPVEVDMGRSEENNITQSGGTEWSKRDKSTYDPTDDIEAYALNASGVVNIIVFDPKGWALFRSFKAVKEKLDTRRGSNSELETAVKDLGKAVSYKGMYGDVAIVVYSGQYVENGVKKNFLPDNTMVLGNTQARGLRTYGCIQDADAQREGINASARYPKNWVTTGDPAREFTMIQSAPLMLLADPDEFVSVQLA

Entity 6 Entity 6 polymer

Description description	Capsid decoration protein
Molecular weight formula_weight	11582.9 kDa
Source method src_method	nat
Copy count entity_count	20

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H0,I0,J0,N0,H1,I1,J1,N1,H2,I2,J2,N2,H3,I3,J3,N3,H4,I4,J4,N4

MTSKETFTHYQPQGNSDPAHTATAPGGLSAKAPAMTPLMLDTSSRKLVAWDGTTDGAAVGILAVAADQTSTTLTFYKSGTFRYEDVLWPEAASDETKKRTAFAGTAISIV

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	4.07 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	9851

fit	/app/data/saxs_computation/xq/8xqb/8xqb.fit
pddf	/app/data/pr_computation/xq/8xqb/8xqb.pr.out
profile	/app/data/saxs_computation/xq/8xqb/8xqb.dat

Mature virion portal vertex of bacteriophage lambda

1. Protein Identity and Related Structures Protein Identity & Related Structures

Head-tail connector protein FII

State in the Current Structure

Other States of the Same Protein in the Database

Head completion protein

State in the Current Structure

Other States of the Same Protein in the Database

Tail tube terminator protein

State in the Current Structure

Other States of the Same Protein in the Database

Portal protein B

State in the Current Structure

Other States of the Same Protein in the Database

Major capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

Capsid decoration protein

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)