9cx7

Native human GABAA receptor of beta3-alpha1-gamma2-beta3-alpha2 assembly

Method: ELECTRON MICROSCOPY D_max: 131.1 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Gamma-aminobutyric acid receptor subunit beta-3

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 7 其他Polymer 6 PDB declaration: heptameric（7） Consistent with protein copy count	Chain A； UniProt 26–473 Chain D； UniProt 26–473	Not recorded	Gamma-aminobutyric acid receptor subunit alpha-1 × 1 （P14867） Gamma-aminobutyric acid receptor subunit gamma-2 × 1 （P18507） Gamma-aminobutyric acid receptor subunit alpha-2 × 1 （P47869） IgG2b Fab_1F4 Heavy Chain × 1 Kappa Fab_1F4 Light Chain × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 3 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ;alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 ABU GAMMA-AMINO-BUTANOIC ACID × 2 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE；3.5 s Blot.	Resolution 3.30 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9CX7	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4COF Crystal structure of a human gamma-aminobutyric acid receptor, the GABA(A)R-beta3 homopentamer Deposited 2014-01-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 5 PDB declaration: pentameric	Chain A 26–312（287 aa） Fragment：RESIDUES 26-312,447-473 Chain A 447–473（27 aa） Fragment：RESIDUES 26-312,447-473 Chain B 26–312（287 aa） Fragment：RESIDUES 26-312,447-473 Chain B 447–473（27 aa） Fragment：RESIDUES 26-312,447-473 Chain C 26–312（287 aa） Fragment：RESIDUES 26-312,447-473 Chain C 447–473（27 aa） Fragment：RESIDUES 26-312,447-473 Chain D 26–312（287 aa） Fragment：RESIDUES 26-312,447-473 Chain D 447–473（27 aa） Fragment：RESIDUES 26-312,447-473 Chain E 26–312（287 aa） Fragment：RESIDUES 26-312,447-473 Chain E 447–473（27 aa） Fragment：RESIDUES 26-312,447-473	Not recorded	BEN BENZAMIDINE × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 CL CHLORIDE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；11.5% PEG4000 100 MM SODIUM CHLORIDE, 100 MM LITHIUM SULPHATE, 100 MM N-2-ACETAMIDO-IMINODIACETIC ACID, PH 6.5, 2% (W/V) BENZAMIDINE	Resolution 2.97 Å R-free 0.226
5O8F Structure of a chimaeric beta3-alpha5 GABAA receptor in complex with nanobody Nb25 and pregnanolone Deposited 2017-06-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 10 PDB declaration: decameric	Chain A 26–246（221 aa） Chain B 26–246（221 aa） Chain C 26–246（221 aa） Chain D 26–246（221 aa） Chain E 26–246（221 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 P9N Pregnanolone × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；277 K；14% PEG 6000, 0.1M N-(2-Acetamido)iminodiacetic acid (ADA), 7.6 mM 4-Cyclohexyl-1-Butyl-beta-D-Maltoside (CYMAL-4)	Resolution 3.20 Å R-free 0.242
5OJM Structure of a chimaeric beta3-alpha5 GABAA receptor in complex with nanobody Nb25 Deposited 2017-07-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 10 PDB declaration: decameric	Chain A 26–242（217 aa） Chain B 26–242（217 aa） Chain C 26–242（217 aa） Chain D 26–242（217 aa） Chain E 26–242（217 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.8；277.15 K；14% poly-ethylene glycol (PEG) 5000, 0.08M magnesium acetate, 0.1M sodium citrate, 1mM ethylene glycol-bis(beta-aminoethyl ether)-N,N,N',N'-tetraacetic acid (EGTA)	Resolution 3.30 Å R-free 0.250
6A96 Cryo-EM structure of the human alpha5beta3 GABAA receptor in complex with GABA and Nb25 Deposited 2018-07-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–332（332 aa） Chain B 447–473（27 aa） Chain C 1–332（332 aa） Chain C 447–473（27 aa） Chain D 1–332（332 aa） Chain D 447–473（27 aa） Chain E 1–332（332 aa） Chain E 447–473（27 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.51 Å
6HUG CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with picrotoxin and megabody Mb38. Deposited 2018-10-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–473（473 aa） Chain E 1–473（473 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 RI5 (1aR,2aR,3S,6R,6aS,8aS,8bR,9R)-2a-hydroxy-8b-methyl-9-(prop-1-en-2-yl)hexahydro-3,6-methano-1,5,7-trioxacyclopenta[ij]c yclopropa[a]azulene-4,8(3H)-dione × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
6HUJ CryoEM structure of human full-length heteromeric alpha1beta3gamma2L GABA(A)R in complex with picrotoxin, GABA and megabody Mb38. Deposited 2018-10-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–473（473 aa） Chain E 1–473（473 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 RI5 (1aR,2aR,3S,6R,6aS,8aS,8bR,9R)-2a-hydroxy-8b-methyl-9-(prop-1-en-2-yl)hexahydro-3,6-methano-1,5,7-trioxacyclopenta[ij]c yclopropa[a]azulene-4,8(3H)-dione × 1 ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.04 Å
6HUK CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with bicuculline and megabody Mb38. Deposited 2018-10-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–473（473 aa） Chain E 1–473（473 aa）	Not recorded	H0Z bicuculline methochloride × 2 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.69 Å
6HUO CryoEM structure of human full-length heteromeric alpha1beta3gamma2L GABA(A)R in complex with alprazolam (Xanax), GABA and megabody Mb38. Deposited 2018-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–473（473 aa） Chain E 1–473（473 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 08H 8-chloro-1-methyl-6-phenyl-4H-[1,2,4]triazolo[4,3-a][1,4]benzodiazepine × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.26 Å
6HUP CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with diazepam (Valium), GABA and megabody Mb38. Deposited 2018-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–473（473 aa） Chain E 1–473（473 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 DZP 7-CHLORO-1-METHYL-5-PHENYL-1,3-DIHYDRO-2H-1,4-BENZODIAZEPIN-2-ONE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.58 Å
6I53 Cryo-EM structure of the human synaptic alpha1-beta3-gamma2 GABAA receptor in complex with Megabody38 in a lipid nanodisc Deposited 2018-11-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–473（473 aa） Chain E 1–473（473 aa）	Not recorded	POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 3 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6QFA CryoEM structure of a beta3K279T GABA(A)R homomer in complex with histamine and megabody Mb25 Deposited 2019-01-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain A 26–332（307 aa） Chain A 447–473（27 aa） Chain B 26–332（307 aa） Chain B 447–473（27 aa） Chain C 26–332（307 aa） Chain C 447–473（27 aa） Chain D 26–332（307 aa） Chain D 447–473（27 aa） Chain E 26–332（307 aa） Chain E 447–473（27 aa）	Mutation：K279T Mutation：K279T Mutation：K279T Mutation：K279T Mutation：K279T Mutation：K279T Mutation：K279T Mutation：K279T Mutation：K279T Mutation：K279T	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 HSM HISTAMINE × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.49 Å
7A5V CryoEM structure of a human gamma-aminobutyric acid receptor, the GABA(A)R-beta3 homopentamer, in complex with histamine and megabody Mb25 in lipid nanodisc Deposited 2020-08-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: pentamer	Chain A 26–332（307 aa） Chain A 447–473（27 aa）	Not recorded	R16 HEXADECANE × 5 D10 DECANE × 20 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 OCT N-OCTANE × 5 HSM HISTAMINE × 5 CL CHLORIDE ION × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 1.70 Å
7PBD a1b3 GABA-A receptor + GABA Deposited 2021-08-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 33–332（300 aa） Chain B 447–473（27 aa） Chain C 33–332（300 aa） Chain C 447–473（27 aa） Chain E 33–332（300 aa） Chain E 447–473（27 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 HSM HISTAMINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.04 Å
7PBZ a1b3 GABA-A receptor + GABA + Zn2+ Deposited 2021-08-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 26–332（307 aa） Chain B 447–473（27 aa） Chain C 26–332（307 aa） Chain C 447–473（27 aa） Chain E 26–332（307 aa） Chain E 447–473（27 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 UND UNDECANE × 2 OCT N-OCTANE × 2 HEX HEXANE × 4 ABU GAMMA-AMINO-BUTANOIC ACID × 2 ZN ZINC ION × 1 HSM HISTAMINE × 1 D10 DECANE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.79 Å
7PC0 GABA-A receptor bound by a-Cobratoxin Deposited 2021-08-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain B 33–332（300 aa） Chain B 447–473（27 aa） Chain C 33–332（300 aa） Chain C 447–473（27 aa） Chain E 33–332（300 aa） Chain E 447–473（27 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 HSM HISTAMINE × 1 ZN ZINC ION × 1 HEX HEXANE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
7QN5 Cryo-EM structure of human full-length extrasynaptic alpha4beta3delta GABA(A)R in complex with nanobody Nb25 Deposited 2021-12-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain B 1–473（473 aa） Chain C 1–473（473 aa） Chain D 1–473（473 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 PX6 1,2-DIPALMITOYL-SN-GLYCERO-3-PHOSPHATE × 1 D10 DECANE × 2 OCT N-OCTANE × 2 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 2 CL CHLORIDE ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
7QN6 Cryo-EM structure of human full-length beta3delta GABA(A)R in complex with nanobody Nb25 Deposited 2021-12-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–473（473 aa） Chain B 1–473（473 aa） Chain C 1–473（473 aa） Chain D 1–473（473 aa）	Not recorded	EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7QN7 Cryo-EM structure of human full-length extrasynaptic alpha4beta3delta GABA(A)R in complex with GABA, histamine and nanobody Nb25 Deposited 2021-12-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain B 1–473（473 aa） Chain C 1–473（473 aa） Chain D 1–473（473 aa）	Not recorded	PX6 1,2-DIPALMITOYL-SN-GLYCERO-3-PHOSPHATE × 1 D10 DECANE × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 ABU GAMMA-AMINO-BUTANOIC ACID × 1 R16 HEXADECANE × 2 HSM HISTAMINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
7QN8 Cryo-EM structure of human full-length beta3delta GABA(A)R in complex with histamine and nanobody Nb25 Deposited 2021-12-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–473（473 aa） Chain B 1–473（473 aa） Chain C 1–473（473 aa） Chain D 1–473（473 aa）	Not recorded	HSM HISTAMINE × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
7QN9 Cryo-EM structure of human full-length extrasynaptic alpha4beta3delta GABA(A)R in complex with GABA, histamine and nanobody Nb25 in a pre-open/closed state Deposited 2021-12-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain B 1–473（473 aa） Chain C 1–473（473 aa） Chain D 1–473（473 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 HSM HISTAMINE × 3 R16 HEXADECANE × 1 D10 DECANE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7QNA Cryo-EM structure of human full-length alpha4beta3gamma2 GABA(A)R in complex with GABA and nanobody Nb25 Deposited 2021-12-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–473（473 aa） Chain D 1–473（473 aa） Chain E 1–473（473 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
7QNB Cryo-EM structure of human full-length beta3gamma2 GABA(A)R in complex with GABA and nanobody Nb25 Deposited 2021-12-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–473（473 aa） Chain D 1–473（473 aa） Chain E 1–473（473 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
7QNC Cryo-EM structure of human full-length extrasynaptic alpha4beta3delta GABA(A)R in complex with THIP (gaboxadol), histamine and nanobody Nb25 Deposited 2021-12-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain B 1–473（473 aa） Chain C 1–473（473 aa） Chain D 1–473（473 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 D10 DECANE × 3 EI7 4,5,6,7-tetrahydro-[1,2]oxazolo[5,4-c]pyridin-3-one × 2 HSM HISTAMINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7QND Cryo-EM structure of human full-length extrasynaptic beta3delta GABA(A)R in complex with THIP (gaboxadol), histamine and nanobody Nb25 Deposited 2021-12-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–473（473 aa） Chain B 1–473（473 aa） Chain C 1–473（473 aa） Chain D 1–473（473 aa）	Not recorded	HSM HISTAMINE × 3 EI7 4,5,6,7-tetrahydro-[1,2]oxazolo[5,4-c]pyridin-3-one × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
7QNE Cryo-EM structure of human full-length synaptic alpha1beta3gamma2 GABA(A)R in complex with Ro15-4513 and megabody Mb38 Deposited 2021-12-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–473（473 aa） Chain E 1–473（473 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 OCT N-OCTANE × 1 D10 DECANE × 4 CL CHLORIDE ION × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 EIE ethyl 8-[(azanylidene-$l^{4}-azanylidene)amino]-5-methyl-6-oxidanylidene-4~{H}-imidazo[1,5-a][1,4]benzodiazepine-3-carboxylate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
8PET Cryo-EM structure of the full-length human alpha1beta3 GABA(A) receptor (babba arrangement) in complex with nanobody Nb25, expressed with a 5-fold excess of beta3 over alpha1 Deposited 2023-06-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 26–473（448 aa） Chain D 26–473（448 aa） Chain E 26–473（448 aa）	Not recorded	R16 HEXADECANE × 2 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 D10 DECANE × 12 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
8PVB Structure of GABAAR determined by cryoEM at 100 keV Deposited 2023-07-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain A 26–332（307 aa）	Not recorded	R16 HEXADECANE × 5 D10 DECANE × 20 HSM HISTAMINE × 5 CL CHLORIDE ION × 10 V8D Etomidate × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9CSB Native human GABAA receptor of beta3-alpha1-beta2-alpha2-gamma2 assembly Deposited 2024-07-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 26–473（448 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5 s Blot.	Resolution 3.34 Å
9CTJ Native human GABAA receptor of beta2-alpha1-beta3-alpha2-gamma2 assembly Deposited 2024-07-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain C 26–473（448 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5 s Blot.	Resolution 3.74 Å
9CXA Native human GABAA receptor of beta2-alpha1-beta3-alpha1-gamma2 assembly Deposited 2024-07-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain C 1–473（473 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.04 Å
9CXC Native human GABAA receptor of beta3-alpha1-gamma2-beta2-alpha2 assembly Deposited 2024-07-31	Different construct Different mutation/modification	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 26–473（448 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5 s Blot.	Resolution 3.30 Å
9EQG CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with GABA and puerarin Deposited 2024-03-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 1–473（473 aa） Chain E 1–473（473 aa）	Not recorded	PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 2 D10 DECANE × 11 HEX HEXANE × 10 PT5 [(2R)-1-octadecanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phospho ryl]oxy-propan-2-yl] (8Z)-icosa-5,8,11,14-tetraenoate × 2 R16 HEXADECANE × 5 PLM PALMITIC ACID × 3 CL CHLORIDE ION × 3 ABU GAMMA-AMINO-BUTANOIC ACID × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 A1H6W Puerarin × 1 PX2 1,2-DILAUROYL-SN-GLYCERO-3-PHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 100 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å
9FAJ CryoEM structure of human full-length alpha1beta3gamma2 GABA(A) receptor in complex with GARLH4, the TMD of Neuroligin2, GABA and Megabody38, in a desensitised state (StateD1) Deposited 2024-05-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 32–472（441 aa） Chain E 32–472（441 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 5 D10 DECANE × 12 PX2 1,2-DILAUROYL-SN-GLYCERO-3-PHOSPHATE × 5 ABU GAMMA-AMINO-BUTANOIC ACID × 2 CL CHLORIDE ION × 4 R16 HEXADECANE × 4 HEX HEXANE × 7 PLM PALMITIC ACID × 5 OLC (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate × 1 CLR CHOLESTEROL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9FAK CryoEM structure of human full-length alpha1beta3gamma2 GABA(A) receptor in complex with GARLH4, the TMD of Neuroligin2, GABA and Megabody38 in a desensitised state (StateD2) Deposited 2024-05-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 32–472（441 aa） Chain E 32–472（441 aa）	Not recorded	HEX HEXANE × 6 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 5 PX2 1,2-DILAUROYL-SN-GLYCERO-3-PHOSPHATE × 5 D10 DECANE × 7 PLM PALMITIC ACID × 8 CL CHLORIDE ION × 4 ABU GAMMA-AMINO-BUTANOIC ACID × 2 R16 HEXADECANE × 3 OLC (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate × 1 CLR CHOLESTEROL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9FAM CryoEM structure of human full-length alpha1beta3gamma2 GABA(A)R in complex with GARLH4, the TMD of Neuroligin2, GABA and Megabody38 in a desensitised state (StateD3) Deposited 2024-05-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain B 32–472（441 aa） Chain E 32–472（441 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 CL CHLORIDE ION × 3 HEX HEXANE × 7 D10 DECANE × 1 PLM PALMITIC ACID × 1 CLR CHOLESTEROL × 1 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
9FAP CryoEM structure of human full-length alpha1beta3gamma2 GABA(A)R in complex with GARLH4, the TMD of Neuroligin2 and Megabody38 in a closed state (StateC1) Deposited 2024-05-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain B 34–472（439 aa） Chain E 34–472（439 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 5 PX2 1,2-DILAUROYL-SN-GLYCERO-3-PHOSPHATE × 2 PLM PALMITIC ACID × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CLR CHOLESTEROL × 1 D10 DECANE × 1 HEX HEXANE × 2 CL CHLORIDE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9FAQ CryoEM structure of human full-length alpha1beta3gamma2 GABA(A)R in complex with GARLH4, the TMD of Neuroligin2 and Megabody38 in a closed state (StateC2) Deposited 2024-05-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain B 34–472（439 aa） Chain E 34–472（439 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 5 D10 DECANE × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PLM PALMITIC ACID × 5 CLR CHOLESTEROL × 1 PX2 1,2-DILAUROYL-SN-GLYCERO-3-PHOSPHATE × 1 HEX HEXANE × 2 CL CHLORIDE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9FAS CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with pregnenolone sulfate Deposited 2024-05-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 32–472（441 aa） Chain E 32–472（441 aa）	Not recorded	HEX HEXANE × 8 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 3 D10 DECANE × 17 PLM PALMITIC ACID × 3 CL CHLORIDE ION × 3 PX2 1,2-DILAUROYL-SN-GLYCERO-3-PHOSPHATE × 1 R16 HEXADECANE × 5 A8W Pregnenolone sulfate × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
9FAT CryoEM structure of human full-length alpha1beta3gamma2 GABA(A)R in complex with GARLH4, the TMD of Neuroligin2, Megabody38 and pregnenolone sulfate Deposited 2024-05-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain B 32–472（441 aa） Chain E 32–472（441 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 3 D10 DECANE × 3 CL CHLORIDE ION × 2 R16 HEXADECANE × 1 HEX HEXANE × 3 PLM PALMITIC ACID × 1 CLR CHOLESTEROL × 1 PX2 1,2-DILAUROYL-SN-GLYCERO-3-PHOSPHATE × 1 A8W Pregnenolone sulfate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9FAU CryoEM structure of human full-length beta3gamma2 GABA(A) receptor in complex with GARLH4, the TMD of Neuroligin2 and Megabody25, in a closed state (StateC1) Deposited 2024-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain A 34–472（439 aa） Chain B 34–472（439 aa） Chain D 34–472（439 aa） Chain E 34–472（439 aa）	Not recorded	HEX HEXANE × 6 D10 DECANE × 6 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 2 PX2 1,2-DILAUROYL-SN-GLYCERO-3-PHOSPHATE × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 R16 HEXADECANE × 3 PLM PALMITIC ACID × 2 CLR CHOLESTEROL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9FAV CryoEM structure of human full-length beta3gamma2 GABA(A) receptor in complex with GARLH4, the TMD of Neuroligin2 and Megabody25, in a closed state (StateC2) Deposited 2024-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain A 34–472（439 aa） Chain B 34–472（439 aa） Chain D 34–472（439 aa） Chain E 34–472（439 aa）	Not recorded	HEX HEXANE × 5 D10 DECANE × 4 R16 HEXADECANE × 3 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 1 PX2 1,2-DILAUROYL-SN-GLYCERO-3-PHOSPHATE × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CLR CHOLESTEROL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9FAW CryoEM structure of human full-length beta3gamma2 GABA(A) receptor in complex with GARLH4, the TMD of Neuroligin2, HEPES and Megabody25, in a desensitised state Deposited 2024-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain A 30–472（443 aa） Chain B 30–472（443 aa） Chain D 30–472（443 aa） Chain E 30–472（443 aa）	Not recorded	HEX HEXANE × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 3 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 CLR CHOLESTEROL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9FAX CryoEM structure of human full-length beta3gamma2 GABA(A) receptor in complex with Megabody25, doubly occupied GARLH4 and Neuroligin2 TMD, in a closed state Deposited 2024-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain A 34–472（439 aa） Chain B 34–472（439 aa） Chain D 34–472（439 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 R16 HEXADECANE × 5 PX2 1,2-DILAUROYL-SN-GLYCERO-3-PHOSPHATE × 2 CLR CHOLESTEROL × 2 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 4 HEX HEXANE × 13 D10 DECANE × 5 PLM PALMITIC ACID × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9FEU Cryo-EM structure of the beta3 homomeric GABA(A) receptor in complex with HSM in the long-lived symmetric desensitised state Deposited 2024-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 5 PDB declaration: pentameric	Chain A 26–332（307 aa） Chain A 447–473（27 aa） Chain B 26–332（307 aa） Chain B 447–473（27 aa） Chain C 26–332（307 aa） Chain C 447–473（27 aa） Chain D 26–332（307 aa） Chain D 447–473（27 aa） Chain E 26–332（307 aa） Chain E 447–473（27 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 HSM HISTAMINE × 5 D10 DECANE × 15 CL CHLORIDE ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
9FEV Cryo-EM structure of the beta3 homomeric GABA(A) receptor in the long-lived resting state Deposited 2024-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 5 PDB declaration: pentameric	Chain A 26–332（307 aa） Chain A 447–473（27 aa） Chain B 26–332（307 aa） Chain B 447–473（27 aa） Chain C 26–332（307 aa） Chain C 447–473（27 aa） Chain D 26–332（307 aa） Chain D 447–473（27 aa） Chain E 26–332（307 aa） Chain E 447–473（27 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9FEW Cryo-EM structure of the beta3 homomeric GABA(A) receptor in the long-lived resting state (C1) Deposited 2024-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 5 PDB declaration: pentameric	Chain A 26–332（307 aa） Chain A 447–473（27 aa） Chain B 26–332（307 aa） Chain B 447–473（27 aa） Chain C 26–332（307 aa） Chain C 447–473（27 aa） Chain D 26–332（307 aa） Chain D 447–473（27 aa） Chain E 26–332（307 aa） Chain E 447–473（27 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
9FEX Cryo-EM structure of the beta3 homomeric GABA(A) receptor in complex with HSM in the short-lived symmetric bound-closed state (C5) Deposited 2024-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 5 PDB declaration: pentameric	Chain A 26–332（307 aa） Chain A 447–473（27 aa） Chain B 26–332（307 aa） Chain B 447–473（27 aa） Chain C 26–332（307 aa） Chain C 447–473（27 aa） Chain D 26–332（307 aa） Chain D 447–473（27 aa） Chain E 26–332（307 aa） Chain E 447–473（27 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 HSM HISTAMINE × 5 CL CHLORIDE ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9FEY Cryo-EM structure of the beta3 homomeric GABA(A) receptor in complex with HSM in the short-lived symmetric bound-closed state (C1) Deposited 2024-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 5 PDB declaration: pentameric	Chain A 26–332（307 aa） Chain A 447–473（27 aa） Chain B 26–332（307 aa） Chain B 447–473（27 aa） Chain C 26–332（307 aa） Chain C 447–473（27 aa） Chain D 26–332（307 aa） Chain D 447–473（27 aa） Chain E 26–332（307 aa） Chain E 447–473（27 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 HSM HISTAMINE × 5 CL CHLORIDE ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9FEZ Cryo-EM structure of the beta3 homomeric GABA(A) receptor in complex with HSM in the short-lived asymmetric bound-closed state Deposited 2024-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Other combination Homooligomer；Protein × 5 PDB declaration: pentameric	Chain A 26–332（307 aa） Chain A 447–473（27 aa） Chain B 26–332（307 aa） Chain B 447–473（27 aa） Chain C 26–332（307 aa） Chain C 447–473（27 aa） Chain D 26–332（307 aa） Chain D 447–473（27 aa） Chain E 26–332（307 aa） Chain E 447–473（27 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 HSM HISTAMINE × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9FF0 Cryo-EM structure of the beta3 homomeric GABA(A) receptor in complex with HSM in the short-lived asymmetric open state Deposited 2024-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 5 PDB declaration: pentameric	Chain A 29–332（304 aa） Chain A 447–473（27 aa） Chain B 29–332（304 aa） Chain B 447–473（27 aa） Chain C 29–332（304 aa） Chain C 447–473（27 aa） Chain D 29–332（304 aa） Chain D 447–473（27 aa） Chain E 29–332（304 aa） Chain E 447–473（27 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 HSM HISTAMINE × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9FF1 Cryo-EM structure of the beta3 homomeric GABA(A) receptor in complex with HSM in the short-lived asymmetric desensitised state Deposited 2024-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 5 PDB declaration: pentameric	Chain A 26–332（307 aa） Chain A 447–473（27 aa） Chain B 26–332（307 aa） Chain B 447–473（27 aa） Chain C 26–332（307 aa） Chain C 447–473（27 aa） Chain D 26–332（307 aa） Chain D 447–473（27 aa） Chain E 26–332（307 aa） Chain E 447–473（27 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 HSM HISTAMINE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9FF2 Cryo-EM structure of the beta3 homomeric GABA(A) receptor in complex with HSM in the long-lived symmetric desensitised state (C1) Deposited 2024-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 5 PDB declaration: pentameric	Chain A 26–332（307 aa） Chain A 447–473（27 aa） Chain B 26–332（307 aa） Chain B 447–473（27 aa） Chain C 26–332（307 aa） Chain C 447–473（27 aa） Chain D 26–332（307 aa） Chain D 447–473（27 aa） Chain E 26–332（307 aa） Chain E 447–473（27 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 HSM HISTAMINE × 5 D10 DECANE × 15 CL CHLORIDE ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9FFL Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with GABA and Mb25 in the short-lived symmetric bound-closed state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 26–332（307 aa） Chain B 447–473（27 aa） Chain C 26–332（307 aa） Chain C 447–473（27 aa） Chain E 26–332（307 aa） Chain E 447–473（27 aa）	Not recorded	D10 DECANE × 6 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 2 CL CHLORIDE ION × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 R16 HEXADECANE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9FFM Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with Mb25 in the resting state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 26–332（307 aa） Chain B 447–473（27 aa） Chain C 26–332（307 aa） Chain C 447–473（27 aa） Chain E 26–332（307 aa） Chain E 447–473（27 aa）	Not recorded	D10 DECANE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9FFN Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with GABA and Mb25 in the short-lived asymmetric bound-closed 1 state of branch 1 Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 26–332（307 aa） Chain B 447–473（27 aa） Chain C 26–332（307 aa） Chain C 447–473（27 aa） Chain E 26–332（307 aa） Chain E 447–473（27 aa）	Not recorded	D10 DECANE × 3 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 2 CL CHLORIDE ION × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9FFO Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with GABA and Mb25 in the short-lived asymmetric bound-closed 2 state of branch 1 Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 26–332（307 aa） Chain B 447–473（27 aa） Chain C 26–332（307 aa） Chain C 447–473（27 aa） Chain E 26–332（307 aa） Chain E 447–473（27 aa）	Not recorded	POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 1 ABU GAMMA-AMINO-BUTANOIC ACID × 2 D10 DECANE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9FFP Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with GABA and Mb25 in the short-lived asymmetric open state of branch 1 Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 26–332（307 aa） Chain B 447–473（27 aa） Chain C 26–332（307 aa） Chain C 447–473（27 aa） Chain E 26–332（307 aa） Chain E 447–473（27 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
9FFQ Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with GABA and Mb25 in the short-lived asymmetric desensitised state of branch 1 Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 26–332（307 aa） Chain B 447–473（27 aa） Chain C 26–332（307 aa） Chain C 447–473（27 aa） Chain E 26–332（307 aa） Chain E 447–473（27 aa）	Not recorded	CL CHLORIDE ION × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9FFR Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with GABA and Mb25 in the short-lived asymmetric bound-closed state of branch 2 Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 26–332（307 aa） Chain B 447–473（27 aa） Chain C 26–332（307 aa） Chain C 447–473（27 aa） Chain E 26–332（307 aa） Chain E 447–473（27 aa）	Not recorded	CLR CHOLESTEROL × 1 ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9FFS Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with GABA and Mb25 in the short-lived asymmetric open state of branch 2 Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 26–332（307 aa） Chain B 447–473（27 aa） Chain C 26–332（307 aa） Chain C 447–473（27 aa） Chain E 26–332（307 aa） Chain E 447–473（27 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9FFT Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with GABA and Mb25 in the short-lived asymmetric desensitised state of branch 2 Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 26–332（307 aa） Chain B 447–473（27 aa） Chain C 26–332（307 aa） Chain C 447–473（27 aa） Chain E 26–332（307 aa） Chain E 447–473（27 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9FFU Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with GABA and Mb25 in the long-lived symmetric desensitised state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 26–332（307 aa） Chain B 447–473（27 aa） Chain C 26–332（307 aa） Chain C 447–473（27 aa） Chain E 26–332（307 aa） Chain E 447–473（27 aa）	Not recorded	D10 DECANE × 6 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 2 CL CHLORIDE ION × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 R16 HEXADECANE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
9FFV Cryo-EM structure of the alpha1beta3gamma2 GABA(A) receptor in complex with Nb38 in the long-lived symmetric resting state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 26–332（307 aa） Chain B 447–473（27 aa） Chain E 26–332（307 aa） Chain E 447–473（27 aa）	Not recorded	D10 DECANE × 5 CL CHLORIDE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9FFW Cryo-EM structure of the alpha1beta3gamma2 GABA(A) receptor in complex with GABA and Nb38 in the short-lived symmetric bound-closed state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 26–332（307 aa） Chain B 447–473（27 aa） Chain E 26–332（307 aa） Chain E 447–473（27 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 D10 DECANE × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9FFX Cryo-EM structure of the alpha1beta3gamma2 GABA(A) receptor in complex with GABA and Nb38 in the short-lived asymmetric bound-closed state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 26–332（307 aa） Chain B 447–473（27 aa） Chain E 26–332（307 aa） Chain E 447–473（27 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9FFY Cryo-EM structure of the alpha1beta3gamma2 GABA(A) receptor in complex with GABA and Nb38 in the short-lived asymmetric open1 state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 26–332（307 aa） Chain B 447–473（27 aa） Chain E 26–332（307 aa） Chain E 447–473（27 aa）	Not recorded	D3D (19S,22R,25R)-22,25,26-trihydroxy-16,22-dioxo-17,21,23-trioxa-22lambda~5~-phosphahexacosan-19-yl (9E)-octadec-9-enoate × 1 ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9FFZ Cryo-EM structure of the alpha1beta3gamma2 GABA(A) receptor in complex with GABA and Nb38 in the short-lived asymmetric desensitised 1 state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 26–332（307 aa） Chain B 447–473（27 aa） Chain E 26–332（307 aa） Chain E 447–473（27 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 D3D (19S,22R,25R)-22,25,26-trihydroxy-16,22-dioxo-17,21,23-trioxa-22lambda~5~-phosphahexacosan-19-yl (9E)-octadec-9-enoate × 1 CLR CHOLESTEROL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9FG0 Cryo-EM structure of the alpha1beta3gamma2 GABA(A) receptor in complex with GABA and Nb38 in the short-lived asymmetric open 2 state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 33–332（300 aa） Chain B 447–472（26 aa） Chain E 33–332（300 aa） Chain E 447–472（26 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9FG1 Cryo-EM structure of the alpha1beta3gamma2 GABA(A) receptor in complex with GABA and Nb38 in the short-lived asymmetric desensitised 2 state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain B 26–332（307 aa） Chain B 447–473（27 aa） Chain E 26–332（307 aa） Chain E 447–473（27 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 D3D (19S,22R,25R)-22,25,26-trihydroxy-16,22-dioxo-17,21,23-trioxa-22lambda~5~-phosphahexacosan-19-yl (9E)-octadec-9-enoate × 2 D10 DECANE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9FG2 Cryo-EM structure of the alpha1beta3gamma2 GABA(A) receptor in complex with GABA and Nb38 in the long-lived symmetric desensitised state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 26–332（307 aa） Chain B 447–473（27 aa） Chain E 26–332（307 aa） Chain E 447–473（27 aa）	Not recorded	D3D (19S,22R,25R)-22,25,26-trihydroxy-16,22-dioxo-17,21,23-trioxa-22lambda~5~-phosphahexacosan-19-yl (9E)-octadec-9-enoate × 2 CL CHLORIDE ION × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 D10 DECANE × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9FG3 Cryo-EM structure of the alpha1beta3gamma2 GABA(A) receptor in complex with GABA and Nb38 bound twice in the long-lived symmetric desensitised state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain B 26–332（307 aa） Chain B 447–473（27 aa） Chain E 26–332（307 aa） Chain E 447–473（27 aa）	Not recorded	D10 DECANE × 5 D3D (19S,22R,25R)-22,25,26-trihydroxy-16,22-dioxo-17,21,23-trioxa-22lambda~5~-phosphahexacosan-19-yl (9E)-octadec-9-enoate × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9FG4 Cryo-EM structure of the full-length alpha1beta3 GABA(A) receptor in the long-lived symmetric resting state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 1–473（473 aa） Chain C 1–473（473 aa） Chain E 1–473（473 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9FG5 Cryo-EM structure of the full-length alpha1beta3 GABA(A) receptor in complex with GABA in the short-lived symmetric bound-closed state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 1–473（473 aa） Chain C 1–473（473 aa） Chain E 1–473（473 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9FG6 Cryo-EM structure of the full-length alpha1beta3 GABA(A) receptor in complex with GABA and HSM in the long-lived symmetric desensitised state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 1–473（473 aa） Chain C 1–473（473 aa） Chain E 1–473（473 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 HSM HISTAMINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9FG7 Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in complex with GABA in the short-lived symmetric bound-closed state Deposited 2024-05-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 1–473（473 aa） Chain E 1–473（473 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 D10 DECANE × 3 CL CHLORIDE ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
9FG8 Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in complex with GABA in the long-lived symmetric desensitised state Deposited 2024-05-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 1–473（473 aa） Chain E 1–473（473 aa）	Not recorded	CL CHLORIDE ION × 1 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 D10 DECANE × 5 ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9FG9 Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in complex with GABA and Etomidate in the long-lived symmetric desensitised state Deposited 2024-05-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 1–473（473 aa） Chain E 1–473（473 aa）	Not recorded	CL CHLORIDE ION × 3 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 D10 DECANE × 5 LBN 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine × 2 R16 HEXADECANE × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 V8D Etomidate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
9FGA Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in SMALPs bound to two PIP2 molecules and in complex with Mb38 Deposited 2024-05-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–473（473 aa） Chain E 1–473（473 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 D10 DECANE × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9FGB Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in SMALPs bound to one PIP2 molecule at chain alpha1-A and in complex with Mb38 Deposited 2024-05-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–473（473 aa） Chain E 1–473（473 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
9FGC Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in SMALPs bound to one PIP2 molecule at chain alpha1-D and in complex with Mb38 Deposited 2024-05-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–473（473 aa） Chain E 1–473（473 aa）	Not recorded	D10 DECANE × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9FGD Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in SMALPs without PIP2 and in complex with Mb38 Deposited 2024-05-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–473（473 aa） Chain E 1–473（473 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 D10 DECANE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9FGF Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in Saposin A nanodisc in the long-lived symmetric resting state Deposited 2024-05-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 1–473（473 aa） Chain E 1–473（473 aa）	Not recorded	CL CHLORIDE ION × 3 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 R16 HEXADECANE × 2 D10 DECANE × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9FGG Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in Saposin A nanodisc bound to GABA and Etomidate in the long-lived symmetric desensitised state Deposited 2024-05-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–473（473 aa） Chain E 1–473（473 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 D10 DECANE × 5 CL CHLORIDE ION × 3 ABU GAMMA-AMINO-BUTANOIC ACID × 2 V8D Etomidate × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 R16 HEXADECANE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9FGH Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in large MSP2N2 nanodisc in complex with GABA in the long-lived symmetric desensitised state Deposited 2024-05-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–473（473 aa） Chain E 1–473（473 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 CL CHLORIDE ION × 3 ABU GAMMA-AMINO-BUTANOIC ACID × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9G2D Cryo-EM structure of the beta3 homomeric GABA(A) receptor in the long-lived resting state (C5) sprayed with PBS Deposited 2024-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 5 PDB declaration: pentameric	Chain A 26–332（307 aa） Chain B 26–332（307 aa） Chain C 26–332（307 aa） Chain D 26–332（307 aa） Chain E 26–332（307 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 CL CHLORIDE ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
9G2E Cryo-EM structure of the beta3 homomeric GABA(A) receptor in the long-lived desensitised state (C5) sprayed with PBS Deposited 2024-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 5 PDB declaration: pentameric	Chain A 26–332（307 aa） Chain B 26–332（307 aa） Chain C 26–332（307 aa） Chain D 26–332（307 aa） Chain E 26–332（307 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 D10 DECANE × 10 CL CHLORIDE ION × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
9HAA a5b3 GABAA Receptor resting state Deposited 2024-11-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 1–332（332 aa） Chain B 447–473（27 aa） Chain C 1–332（332 aa） Chain C 447–473（27 aa） Chain E 1–332（332 aa） Chain E 447–473（27 aa）	Not recorded	BUA butanoic acid × 2 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 ZN ZINC ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20 mM HEPES, 100 mM NaCl, 2 mM Fluorinated Fos-choline 8, 0.005% LMNG, 0.0005% CHS cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.14 Å
9HNQ a5b3 GABAA Receptor bound to GABA and Mb25 in desensitized state in detergent micelles Deposited 2024-12-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–332（332 aa） Chain B 447–473（27 aa） Chain C 1–332（332 aa） Chain C 447–473（27 aa） Chain E 1–332（332 aa） Chain E 447–473（27 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；20 mM HEPES, 100 mM NaCl, 0.005% LMNG, 0.0005% CHS cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.81 Å
9HNR a5b3 GABAA Receptor in 1 a5 to 4 b3 stoichiometry in desensitized state Deposited 2024-12-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–332（332 aa） Chain B 447–473（27 aa） Chain C 1–332（332 aa） Chain C 447–473（27 aa） Chain D 1–332（332 aa） Chain D 447–473（27 aa） Chain E 1–332（332 aa） Chain E 447–473（27 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.17 Å
9HNS a5b3 GABAAR bound to GABA and Mb25 in a desensitized state in saposin nanodiscs after long GABA treatment Deposited 2024-12-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–332（332 aa） Chain B 447–473（27 aa） Chain C 1–332（332 aa） Chain C 447–473（27 aa） Chain E 1–332（332 aa） Chain E 447–473（27 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9HNT a5b3 GABAAR bound to Etomidate, GABA, and Mb25 in a desensitized state in saposin nanodiscs Deposited 2024-12-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–332（332 aa） Chain B 447–473（27 aa） Chain C 1–332（332 aa） Chain C 447–473（27 aa） Chain E 1–332（332 aa） Chain E 447–473（27 aa）	Not recorded	V8D Etomidate × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.32 Å
9HUM a5b3 GABAAR bound to GABA and Mb25 in a desensitized state in saposin nanodiscs after short GABA treatment Deposited 2024-12-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–332（332 aa） Chain C 1–332（332 aa） Chain E 1–332（332 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.35 Å
9RL5 a5b3 GABAAR bound to Topiramate, GABA, and Mb25 in a desensitized state in saposin nanodiscs Deposited 2025-06-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–332（332 aa） Chain B 447–473（27 aa） Chain C 1–332（332 aa） Chain C 447–473（27 aa） Chain E 1–332（332 aa） Chain E 447–473（27 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 TOR [(3aS,5aR,8aR,8bS)-2,2,7,7-tetramethyltetrahydro-3aH-bis[1,3]dioxolo[4,5-b:4',5'-d]pyran-3a-yl]methyl sulfamate × 2 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9RPB a5b3 GABAAR bound to GABA, and Mb25 in a desensitized state in saposin nanodiscs, topiramate-free Deposited 2025-06-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–332（332 aa） Chain B 447–473（27 aa） Chain C 1–332（332 aa） Chain C 447–473（27 aa） Chain E 1–332（332 aa） Chain E 447–473（27 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å

94 other PDB entries and 94 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	GBRB3_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–448； UniProt 26–473 Author chain D； PDBConstruct 1–448； UniProt 26–473

Gamma-aminobutyric acid receptor subunit alpha-1

OrganismNot specified

UniProt P14867

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 7 其他Polymer 6 PDB declaration: heptameric（7） Consistent with protein copy count	Chain B； UniProt 28–456	Not recorded	Gamma-aminobutyric acid receptor subunit beta-3 × 2 （P28472） Gamma-aminobutyric acid receptor subunit gamma-2 × 1 （P18507） Gamma-aminobutyric acid receptor subunit alpha-2 × 1 （P47869） IgG2b Fab_1F4 Heavy Chain × 1 Kappa Fab_1F4 Light Chain × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 3 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ;alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 ABU GAMMA-AMINO-BUTANOIC ACID × 2 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE；3.5 s Blot.	Resolution 3.30 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9CX7	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6CDU Crystal structure of a chimeric human alpha1GABAA receptor in complex with alphaxalone Deposited 2018-02-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 5 PDB declaration: pentameric	Chain A 249–340（92 aa） Chain A 415–444（30 aa） Chain B 249–340（92 aa） Chain B 415–444（30 aa） Chain C 249–340（92 aa） Chain C 415–444（30 aa） Chain D 249–340（92 aa） Chain D 415–444（30 aa） Chain E 249–340（92 aa） Chain E 415–444（30 aa）	Not recorded	EY4 (3a,5a)-3-Hydroxypregnane-11,20-dione × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.1；277 K；PEG400, 2-(N-MORPHOLINO)-ETHANESULFONIC ACID, NaSCN	Resolution 3.45 Å R-free 0.286
6CDU Crystal structure of a chimeric human alpha1GABAA receptor in complex with alphaxalone Deposited 2018-02-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 5 PDB declaration: pentameric	Chain F 249–340（92 aa） Chain F 415–444（30 aa） Chain G 249–340（92 aa） Chain G 415–444（30 aa） Chain H 249–340（92 aa） Chain H 415–444（30 aa） Chain I 249–340（92 aa） Chain I 415–444（30 aa） Chain J 249–340（92 aa） Chain J 415–444（30 aa）	Not recorded	EY4 (3a,5a)-3-Hydroxypregnane-11,20-dione × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.1；277 K；PEG400, 2-(N-MORPHOLINO)-ETHANESULFONIC ACID, NaSCN	Resolution 3.45 Å R-free 0.286
6D1S Crystal structure of an apo chimeric human alpha1GABAA receptor Deposited 2018-04-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 5 PDB declaration: pentameric	Chain A 249–340（92 aa） Chain A 415–444（30 aa） Chain B 249–340（92 aa） Chain B 415–444（30 aa） Chain C 249–340（92 aa） Chain C 415–444（30 aa） Chain D 249–340（92 aa） Chain D 415–444（30 aa） Chain E 249–340（92 aa） Chain E 415–444（30 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.1；277.1 K；100 mM 2-(N-morpholino)ethanesulfonic acid, 400mM NaSCN, 21% PEG400	Resolution 3.20 Å R-free 0.269
6D1S Crystal structure of an apo chimeric human alpha1GABAA receptor Deposited 2018-04-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 5 PDB declaration: pentameric	Chain F 249–340（92 aa） Chain F 415–444（30 aa） Chain G 249–340（92 aa） Chain G 415–444（30 aa） Chain H 249–340（92 aa） Chain H 415–444（30 aa） Chain I 249–340（92 aa） Chain I 415–444（30 aa） Chain J 249–340（92 aa） Chain J 415–444（30 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.1；277.1 K；100 mM 2-(N-morpholino)ethanesulfonic acid, 400mM NaSCN, 21% PEG400	Resolution 3.20 Å R-free 0.269
6D6T Human GABA-A receptor alpha1-beta2-gamma2 subtype in complex with GABA and flumazenil, conformation B Deposited 2018-04-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 28–339（312 aa） Chain B 418–456（39 aa） Chain D 28–339（312 aa） Chain D 418–456（39 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 ABU GAMMA-AMINO-BUTANOIC ACID × 2 Y01 CHOLESTEROL HEMISUCCINATE × 12 FYP ethyl 8-fluoro-5-methyl-6-oxo-5,6-dihydro-4H-imidazo[1,5-a][1,4]benzodiazepine-3-carboxylate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；3 seconds blot time	Resolution 3.86 Å
6D6U Human GABA-A receptor alpha1-beta2-gamma2 subtype in complex with GABA and flumazenil, conformation A Deposited 2018-04-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 28–339（312 aa） Chain B 418–456（39 aa） Chain D 28–339（312 aa） Chain D 418–456（39 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 Y01 CHOLESTEROL HEMISUCCINATE × 12 FYP ethyl 8-fluoro-5-methyl-6-oxo-5,6-dihydro-4H-imidazo[1,5-a][1,4]benzodiazepine-3-carboxylate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；3 seconds blot time	Resolution 3.92 Å
6HUJ CryoEM structure of human full-length heteromeric alpha1beta3gamma2L GABA(A)R in complex with picrotoxin, GABA and megabody Mb38. Deposited 2018-10-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 28–456（429 aa） Chain D 28–456（429 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 RI5 (1aR,2aR,3S,6R,6aS,8aS,8bR,9R)-2a-hydroxy-8b-methyl-9-(prop-1-en-2-yl)hexahydro-3,6-methano-1,5,7-trioxacyclopenta[ij]c yclopropa[a]azulene-4,8(3H)-dione × 1 ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.04 Å
6HUK CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with bicuculline and megabody Mb38. Deposited 2018-10-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 28–456（429 aa） Chain D 28–456（429 aa）	Not recorded	H0Z bicuculline methochloride × 2 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.69 Å
6HUO CryoEM structure of human full-length heteromeric alpha1beta3gamma2L GABA(A)R in complex with alprazolam (Xanax), GABA and megabody Mb38. Deposited 2018-10-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 28–456（429 aa） Chain D 28–456（429 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 08H 8-chloro-1-methyl-6-phenyl-4H-[1,2,4]triazolo[4,3-a][1,4]benzodiazepine × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.26 Å
6HUP CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with diazepam (Valium), GABA and megabody Mb38. Deposited 2018-10-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 28–456（429 aa） Chain D 28–456（429 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 DZP 7-CHLORO-1-METHYL-5-PHENYL-1,3-DIHYDRO-2H-1,4-BENZODIAZEPIN-2-ONE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.58 Å
6I53 Cryo-EM structure of the human synaptic alpha1-beta3-gamma2 GABAA receptor in complex with Megabody38 in a lipid nanodisc Deposited 2018-11-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–456（456 aa） Chain D 1–456（456 aa）	Not recorded	POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 3 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6X3S Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with bicuculline methbromide Deposited 2020-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 28–339（312 aa） Chain B 418–456（39 aa） Chain D 28–339（312 aa） Chain D 418–456（39 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 J94 (5S)-6,6-dimethyl-5-[(6R)-8-oxo-6,8-dihydrofuro[3,4-e][1,3]benzodioxol-6-yl]-5,6,7,8-tetrahydro[1,3]dioxolo[4,5-g]isoquinolin-6-ium × 2 MAN alpha-D-mannopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot	Resolution 3.12 Å
6X3T Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus propofol Deposited 2020-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 28–339（312 aa） Chain B 418–456（39 aa） Chain D 28–339（312 aa） Chain D 418–456（39 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 PFL 2,6-BIS(1-METHYLETHYL)PHENOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot	Resolution 2.55 Å
6X3U Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus flumazenil Deposited 2020-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 28–339（312 aa） Chain B 418–456（39 aa） Chain D 28–339（312 aa） Chain D 418–456（39 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 ABU GAMMA-AMINO-BUTANOIC ACID × 2 FYP ethyl 8-fluoro-5-methyl-6-oxo-5,6-dihydro-4H-imidazo[1,5-a][1,4]benzodiazepine-3-carboxylate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot	Resolution 3.50 Å
6X3V Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus etomidate Deposited 2020-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 28–339（312 aa） Chain B 418–456（39 aa） Chain D 28–339（312 aa） Chain D 418–456（39 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 V8D Etomidate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot	Resolution 3.50 Å
6X3W Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus phenobarbital Deposited 2020-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 28–339（312 aa） Chain B 418–456（39 aa） Chain D 28–339（312 aa） Chain D 418–456（39 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 ABU GAMMA-AMINO-BUTANOIC ACID × 2 UQA 5-ethyl-5-phenylpyrimidine-2,4,6(1H,3H,5H)-trione × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot	Resolution 3.30 Å
6X3X Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus diazepam Deposited 2020-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 28–339（312 aa） Chain B 418–456（39 aa） Chain D 28–339（312 aa） Chain D 418–456（39 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 DZP 7-CHLORO-1-METHYL-5-PHENYL-1,3-DIHYDRO-2H-1,4-BENZODIAZEPIN-2-ONE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot	Resolution 2.92 Å
6X3Z Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA Deposited 2020-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 28–339（312 aa） Chain B 418–456（39 aa） Chain D 28–339（312 aa） Chain D 418–456（39 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot	Resolution 3.23 Å
6X40 Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus picrotoxin Deposited 2020-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 28–339（312 aa） Chain B 418–456（39 aa） Chain D 28–339（312 aa） Chain D 418–456（39 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 RI5 (1aR,2aR,3S,6R,6aS,8aS,8bR,9R)-2a-hydroxy-8b-methyl-9-(prop-1-en-2-yl)hexahydro-3,6-methano-1,5,7-trioxacyclopenta[ij]c yclopropa[a]azulene-4,8(3H)-dione × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot	Resolution 2.86 Å
7PBD a1b3 GABA-A receptor + GABA Deposited 2021-08-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 32–339（308 aa） Chain A 418–456（39 aa） Chain D 32–339（308 aa） Chain D 418–456（39 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 HSM HISTAMINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.04 Å
7PBZ a1b3 GABA-A receptor + GABA + Zn2+ Deposited 2021-08-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 32–339（308 aa） Chain A 418–456（39 aa） Chain D 32–339（308 aa） Chain D 418–456（39 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 UND UNDECANE × 2 OCT N-OCTANE × 2 HEX HEXANE × 4 ABU GAMMA-AMINO-BUTANOIC ACID × 2 ZN ZINC ION × 1 HSM HISTAMINE × 1 D10 DECANE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.79 Å
7PC0 GABA-A receptor bound by a-Cobratoxin Deposited 2021-08-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 32–339（308 aa） Chain A 418–456（39 aa） Chain D 32–339（308 aa） Chain D 418–456（39 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 HSM HISTAMINE × 1 ZN ZINC ION × 1 HEX HEXANE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
7T0W Complex of GABA-A synaptic receptor with autoimmune antibody Fab115 Deposited 2021-11-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 28–339（312 aa） Chain B 418–445（28 aa） Chain D 28–339（312 aa） Chain D 418–445（28 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
7T0Z Complex of GABA-A synaptic receptor with autoimmune antibody Fab175 Deposited 2021-11-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain B 28–339（312 aa） Chain B 418–445（28 aa） Chain D 28–339（312 aa） Chain D 418–445（28 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 MAN alpha-D-mannopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8DD2 Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus Zolpidem Deposited 2022-06-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 28–339（312 aa） Chain D 28–339（312 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 R5R Zolpidem × 3 ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot	Resolution 2.90 Å
8DD3 Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus DMCM Deposited 2022-06-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 28–339（312 aa） Chain D 28–339（312 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 R63 methyl 4-ethyl-6,7-dimethoxy-9H-pyrido[3,4-b]indole-3-carboxylate × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot	Resolution 2.90 Å
8PET Cryo-EM structure of the full-length human alpha1beta3 GABA(A) receptor (babba arrangement) in complex with nanobody Nb25, expressed with a 5-fold excess of beta3 over alpha1 Deposited 2023-06-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 37–456（420 aa） Chain C 37–456（420 aa）	Not recorded	R16 HEXADECANE × 2 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 D10 DECANE × 12 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
8SGO Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus pregnenolone sulfate Deposited 2023-04-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 28–339（312 aa） Chain B 418–456（39 aa） Chain D 28–339（312 aa） Chain D 418–456（39 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 PTY PHOSPHATIDYLETHANOLAMINE × 6 Q3G O-[(R)-[(2S)-2-(hexadecanoyloxy)-3-(octadecanoyloxy)propoxy](hydroxy)phosphoryl]-D-serine × 1 A8W Pregnenolone sulfate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.65 Å
8SI9 Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus allopregnanolone Deposited 2023-04-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 28–339（312 aa） Chain B 418–456（39 aa） Chain D 28–339（312 aa） Chain D 418–456（39 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 Y4B allopregnanolone × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.98 Å
8SID Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus dehydroepiandrosterone sulfate Deposited 2023-04-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 28–339（312 aa） Chain B 418–456（39 aa） Chain D 28–339（312 aa） Chain D 418–456（39 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 ZWY 17-oxoandrost-5-en-3beta-yl hydrogen sulfate × 1 PTY PHOSPHATIDYLETHANOLAMINE × 6 Q3G O-[(R)-[(2S)-2-(hexadecanoyloxy)-3-(octadecanoyloxy)propoxy](hydroxy)phosphoryl]-D-serine × 1 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.71 Å
8VQY Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus methaqualone Deposited 2024-01-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 28–339（312 aa） Chain D 28–339（312 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 A1ADG 2-methyl-3-(2-methylphenyl)quinazolin-4(3H)-one × 3 PTY PHOSPHATIDYLETHANOLAMINE × 4 Q3G O-[(R)-[(2S)-2-(hexadecanoyloxy)-3-(octadecanoyloxy)propoxy](hydroxy)phosphoryl]-D-serine × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.82 Å
8VRN Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus PPTQ Deposited 2024-01-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 28–339（312 aa） Chain D 28–339（312 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 A1ADN 3-(4-methylphenyl)-2-phenylquinazolin-4(3H)-one × 2 PTY PHOSPHATIDYLETHANOLAMINE × 5 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 1 Q3G O-[(R)-[(2S)-2-(hexadecanoyloxy)-3-(octadecanoyloxy)propoxy](hydroxy)phosphoryl]-D-serine × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.57 Å
9CRS Native human GABAA receptor of beta2-alpha1-beta2-alpha1-gamma2 assembly Deposited 2024-07-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 28–456（429 aa） Chain D 28–456（429 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5s blot	Resolution 2.90 Å
9CRV Native human GABAA receptor of beta2-alpha1-gamma2-beta2-alpha2 assembly Deposited 2024-07-22	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain B 28–456（429 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5s blot	Resolution 3.18 Å
9CSB Native human GABAA receptor of beta3-alpha1-beta2-alpha2-gamma2 assembly Deposited 2024-07-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain B 28–456（429 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5 s Blot.	Resolution 3.34 Å
9CT0 Native human GABAA receptor of beta2-alpha1-beta2-alpha2-gamma2 assembly Deposited 2024-07-24	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain B 28–456（429 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5 s Blot.	Resolution 3.19 Å
9CTJ Native human GABAA receptor of beta2-alpha1-beta3-alpha2-gamma2 assembly Deposited 2024-07-25	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain B 28–456（429 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5 s Blot.	Resolution 3.74 Å
9CTP Native human GABAA receptor of beta2-alpha1-beta2-alpha3-gamma2 assembly Deposited 2024-07-25	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain B 28–456（429 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5 s Blot.	Resolution 3.62 Å
9CTV Native human GABAA receptor of beta2-alpha1-gamma2-beta1-alpha2 assembly Deposited 2024-07-25	Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain B 28–456（429 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5 s Blot.	Resolution 3.36 Å
9CXA Native human GABAA receptor of beta2-alpha1-beta3-alpha1-gamma2 assembly Deposited 2024-07-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 1–456（456 aa） Chain D 1–456（456 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.04 Å
9CXB Native human GABAA receptor of beta2-alpha1-beta1-alpha2-gamma2 assembly Deposited 2024-07-31	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain B 28–456（429 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5 s Blot.	Resolution 3.33 Å
9CXC Native human GABAA receptor of beta3-alpha1-gamma2-beta2-alpha2 assembly Deposited 2024-07-31	Parsed fields agree	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain B 28–456（429 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5 s Blot.	Resolution 3.30 Å
9CXD Native human GABAA receptor of beta2-alpha1-beta1-beta1-gamma2 assembly Deposited 2024-07-31	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain B 28–456（429 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 1 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5 s Blot.	Resolution 3.36 Å
9DRX Human GABAA receptor of beta2-alpha1-beta2-alpha1-gamma2 subtype in complex with GABA plus Lamotrigine Deposited 2024-09-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 28–339（312 aa） Chain B 418–456（39 aa） Chain D 28–339（312 aa） Chain D 418–456（39 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 IYJ (6M)-6-(2,3-dichlorophenyl)-1,2,4-triazine-3,5-diamine × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5 s Blot.	Resolution 2.95 Å
9EQG CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with GABA and puerarin Deposited 2024-03-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 28–456（429 aa） Chain D 28–456（429 aa）	Not recorded	PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 2 D10 DECANE × 11 HEX HEXANE × 10 PT5 [(2R)-1-octadecanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phospho ryl]oxy-propan-2-yl] (8Z)-icosa-5,8,11,14-tetraenoate × 2 R16 HEXADECANE × 5 PLM PALMITIC ACID × 3 CL CHLORIDE ION × 3 ABU GAMMA-AMINO-BUTANOIC ACID × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 A1H6W Puerarin × 1 PX2 1,2-DILAUROYL-SN-GLYCERO-3-PHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 100 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å
9FAJ CryoEM structure of human full-length alpha1beta3gamma2 GABA(A) receptor in complex with GARLH4, the TMD of Neuroligin2, GABA and Megabody38, in a desensitised state (StateD1) Deposited 2024-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 37–449（413 aa） Chain D 37–449（413 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 5 D10 DECANE × 12 PX2 1,2-DILAUROYL-SN-GLYCERO-3-PHOSPHATE × 5 ABU GAMMA-AMINO-BUTANOIC ACID × 2 CL CHLORIDE ION × 4 R16 HEXADECANE × 4 HEX HEXANE × 7 PLM PALMITIC ACID × 5 OLC (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate × 1 CLR CHOLESTEROL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9FAK CryoEM structure of human full-length alpha1beta3gamma2 GABA(A) receptor in complex with GARLH4, the TMD of Neuroligin2, GABA and Megabody38 in a desensitised state (StateD2) Deposited 2024-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 37–449（413 aa） Chain D 37–449（413 aa）	Not recorded	HEX HEXANE × 6 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 5 PX2 1,2-DILAUROYL-SN-GLYCERO-3-PHOSPHATE × 5 D10 DECANE × 7 PLM PALMITIC ACID × 8 CL CHLORIDE ION × 4 ABU GAMMA-AMINO-BUTANOIC ACID × 2 R16 HEXADECANE × 3 OLC (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate × 1 CLR CHOLESTEROL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9FAM CryoEM structure of human full-length alpha1beta3gamma2 GABA(A)R in complex with GARLH4, the TMD of Neuroligin2, GABA and Megabody38 in a desensitised state (StateD3) Deposited 2024-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 37–449（413 aa） Chain D 37–449（413 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 CL CHLORIDE ION × 3 HEX HEXANE × 7 D10 DECANE × 1 PLM PALMITIC ACID × 1 CLR CHOLESTEROL × 1 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
9FAP CryoEM structure of human full-length alpha1beta3gamma2 GABA(A)R in complex with GARLH4, the TMD of Neuroligin2 and Megabody38 in a closed state (StateC1) Deposited 2024-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 39–443（405 aa） Chain D 39–443（405 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 5 PX2 1,2-DILAUROYL-SN-GLYCERO-3-PHOSPHATE × 2 PLM PALMITIC ACID × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CLR CHOLESTEROL × 1 D10 DECANE × 1 HEX HEXANE × 2 CL CHLORIDE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9FAQ CryoEM structure of human full-length alpha1beta3gamma2 GABA(A)R in complex with GARLH4, the TMD of Neuroligin2 and Megabody38 in a closed state (StateC2) Deposited 2024-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 39–443（405 aa） Chain D 39–443（405 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 5 D10 DECANE × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PLM PALMITIC ACID × 5 CLR CHOLESTEROL × 1 PX2 1,2-DILAUROYL-SN-GLYCERO-3-PHOSPHATE × 1 HEX HEXANE × 2 CL CHLORIDE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9FAS CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with pregnenolone sulfate Deposited 2024-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 37–445（409 aa） Chain D 37–445（409 aa）	Not recorded	HEX HEXANE × 8 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 3 D10 DECANE × 17 PLM PALMITIC ACID × 3 CL CHLORIDE ION × 3 PX2 1,2-DILAUROYL-SN-GLYCERO-3-PHOSPHATE × 1 R16 HEXADECANE × 5 A8W Pregnenolone sulfate × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
9FAT CryoEM structure of human full-length alpha1beta3gamma2 GABA(A)R in complex with GARLH4, the TMD of Neuroligin2, Megabody38 and pregnenolone sulfate Deposited 2024-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 37–449（413 aa） Chain D 37–449（413 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 3 D10 DECANE × 3 CL CHLORIDE ION × 2 R16 HEXADECANE × 1 HEX HEXANE × 3 PLM PALMITIC ACID × 1 CLR CHOLESTEROL × 1 PX2 1,2-DILAUROYL-SN-GLYCERO-3-PHOSPHATE × 1 A8W Pregnenolone sulfate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9FFL Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with GABA and Mb25 in the short-lived symmetric bound-closed state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 32–339（308 aa） Chain A 418–456（39 aa） Chain D 32–339（308 aa） Chain D 418–456（39 aa）	Not recorded	D10 DECANE × 6 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 2 CL CHLORIDE ION × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 R16 HEXADECANE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9FFM Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with Mb25 in the resting state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 32–339（308 aa） Chain A 418–456（39 aa） Chain D 32–339（308 aa） Chain D 418–456（39 aa）	Not recorded	D10 DECANE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9FFN Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with GABA and Mb25 in the short-lived asymmetric bound-closed 1 state of branch 1 Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 32–339（308 aa） Chain A 418–456（39 aa） Chain D 32–339（308 aa） Chain D 418–456（39 aa）	Not recorded	D10 DECANE × 3 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 2 CL CHLORIDE ION × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9FFO Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with GABA and Mb25 in the short-lived asymmetric bound-closed 2 state of branch 1 Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 32–339（308 aa） Chain A 418–456（39 aa） Chain D 32–339（308 aa） Chain D 418–456（39 aa）	Not recorded	POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 1 ABU GAMMA-AMINO-BUTANOIC ACID × 2 D10 DECANE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9FFP Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with GABA and Mb25 in the short-lived asymmetric open state of branch 1 Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 32–339（308 aa） Chain A 418–456（39 aa） Chain D 32–339（308 aa） Chain D 418–456（39 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
9FFQ Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with GABA and Mb25 in the short-lived asymmetric desensitised state of branch 1 Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 32–339（308 aa） Chain A 418–456（39 aa） Chain D 32–339（308 aa） Chain D 418–456（39 aa）	Not recorded	CL CHLORIDE ION × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9FFR Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with GABA and Mb25 in the short-lived asymmetric bound-closed state of branch 2 Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 32–339（308 aa） Chain A 418–456（39 aa） Chain D 32–339（308 aa） Chain D 418–456（39 aa）	Not recorded	CLR CHOLESTEROL × 1 ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9FFS Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with GABA and Mb25 in the short-lived asymmetric open state of branch 2 Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 32–339（308 aa） Chain A 418–456（39 aa） Chain D 32–339（308 aa） Chain D 418–456（39 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9FFT Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with GABA and Mb25 in the short-lived asymmetric desensitised state of branch 2 Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 32–339（308 aa） Chain A 418–456（39 aa） Chain D 32–339（308 aa） Chain D 418–456（39 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9FFU Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with GABA and Mb25 in the long-lived symmetric desensitised state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 32–339（308 aa） Chain A 418–456（39 aa） Chain D 32–339（308 aa） Chain D 418–456（39 aa）	Not recorded	D10 DECANE × 6 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 2 CL CHLORIDE ION × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 R16 HEXADECANE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
9FFV Cryo-EM structure of the alpha1beta3gamma2 GABA(A) receptor in complex with Nb38 in the long-lived symmetric resting state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 32–339（308 aa） Chain A 418–456（39 aa） Chain D 32–339（308 aa） Chain D 418–456（39 aa）	Not recorded	D10 DECANE × 5 CL CHLORIDE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9FFW Cryo-EM structure of the alpha1beta3gamma2 GABA(A) receptor in complex with GABA and Nb38 in the short-lived symmetric bound-closed state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 32–339（308 aa） Chain A 418–456（39 aa） Chain D 32–339（308 aa） Chain D 418–456（39 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 D10 DECANE × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9FFX Cryo-EM structure of the alpha1beta3gamma2 GABA(A) receptor in complex with GABA and Nb38 in the short-lived asymmetric bound-closed state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 32–339（308 aa） Chain A 418–456（39 aa） Chain D 32–339（308 aa） Chain D 418–456（39 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9FFY Cryo-EM structure of the alpha1beta3gamma2 GABA(A) receptor in complex with GABA and Nb38 in the short-lived asymmetric open1 state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 32–339（308 aa） Chain A 418–456（39 aa） Chain D 32–339（308 aa） Chain D 418–456（39 aa）	Not recorded	D3D (19S,22R,25R)-22,25,26-trihydroxy-16,22-dioxo-17,21,23-trioxa-22lambda~5~-phosphahexacosan-19-yl (9E)-octadec-9-enoate × 1 ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9FFZ Cryo-EM structure of the alpha1beta3gamma2 GABA(A) receptor in complex with GABA and Nb38 in the short-lived asymmetric desensitised 1 state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 32–339（308 aa） Chain A 418–456（39 aa） Chain D 32–339（308 aa） Chain D 418–456（39 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 D3D (19S,22R,25R)-22,25,26-trihydroxy-16,22-dioxo-17,21,23-trioxa-22lambda~5~-phosphahexacosan-19-yl (9E)-octadec-9-enoate × 1 CLR CHOLESTEROL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9FG0 Cryo-EM structure of the alpha1beta3gamma2 GABA(A) receptor in complex with GABA and Nb38 in the short-lived asymmetric open 2 state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 37–339（303 aa） Chain A 418–445（28 aa） Chain D 37–339（303 aa） Chain D 418–445（28 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9FG1 Cryo-EM structure of the alpha1beta3gamma2 GABA(A) receptor in complex with GABA and Nb38 in the short-lived asymmetric desensitised 2 state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 32–339（308 aa） Chain A 418–456（39 aa） Chain D 32–339（308 aa） Chain D 418–456（39 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 D3D (19S,22R,25R)-22,25,26-trihydroxy-16,22-dioxo-17,21,23-trioxa-22lambda~5~-phosphahexacosan-19-yl (9E)-octadec-9-enoate × 2 D10 DECANE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9FG2 Cryo-EM structure of the alpha1beta3gamma2 GABA(A) receptor in complex with GABA and Nb38 in the long-lived symmetric desensitised state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 32–339（308 aa） Chain A 418–456（39 aa） Chain D 32–339（308 aa） Chain D 418–456（39 aa）	Not recorded	D3D (19S,22R,25R)-22,25,26-trihydroxy-16,22-dioxo-17,21,23-trioxa-22lambda~5~-phosphahexacosan-19-yl (9E)-octadec-9-enoate × 2 CL CHLORIDE ION × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 D10 DECANE × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9FG3 Cryo-EM structure of the alpha1beta3gamma2 GABA(A) receptor in complex with GABA and Nb38 bound twice in the long-lived symmetric desensitised state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 32–339（308 aa） Chain A 418–456（39 aa） Chain D 32–339（308 aa） Chain D 418–456（39 aa）	Not recorded	D10 DECANE × 5 D3D (19S,22R,25R)-22,25,26-trihydroxy-16,22-dioxo-17,21,23-trioxa-22lambda~5~-phosphahexacosan-19-yl (9E)-octadec-9-enoate × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9FG4 Cryo-EM structure of the full-length alpha1beta3 GABA(A) receptor in the long-lived symmetric resting state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 28–456（429 aa） Chain D 28–456（429 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9FG5 Cryo-EM structure of the full-length alpha1beta3 GABA(A) receptor in complex with GABA in the short-lived symmetric bound-closed state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 28–456（429 aa） Chain D 28–456（429 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9FG6 Cryo-EM structure of the full-length alpha1beta3 GABA(A) receptor in complex with GABA and HSM in the long-lived symmetric desensitised state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 28–456（429 aa） Chain D 28–456（429 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 HSM HISTAMINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9FG7 Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in complex with GABA in the short-lived symmetric bound-closed state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 28–456（429 aa） Chain D 28–456（429 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 D10 DECANE × 3 CL CHLORIDE ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
9FG8 Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in complex with GABA in the long-lived symmetric desensitised state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 28–456（429 aa） Chain D 28–456（429 aa）	Not recorded	CL CHLORIDE ION × 1 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 D10 DECANE × 5 ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9FG9 Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in complex with GABA and Etomidate in the long-lived symmetric desensitised state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 28–456（429 aa） Chain D 28–456（429 aa）	Not recorded	CL CHLORIDE ION × 3 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 D10 DECANE × 5 LBN 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine × 2 R16 HEXADECANE × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 V8D Etomidate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
9FGA Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in SMALPs bound to two PIP2 molecules and in complex with Mb38 Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 28–456（429 aa） Chain D 28–456（429 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 D10 DECANE × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9FGB Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in SMALPs bound to one PIP2 molecule at chain alpha1-A and in complex with Mb38 Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 28–456（429 aa） Chain D 28–456（429 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
9FGC Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in SMALPs bound to one PIP2 molecule at chain alpha1-D and in complex with Mb38 Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 28–456（429 aa） Chain D 28–456（429 aa）	Not recorded	D10 DECANE × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9FGD Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in SMALPs without PIP2 and in complex with Mb38 Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 28–456（429 aa） Chain D 28–456（429 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 D10 DECANE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9FGF Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in Saposin A nanodisc in the long-lived symmetric resting state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 28–456（429 aa） Chain D 28–456（429 aa）	Not recorded	CL CHLORIDE ION × 3 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 R16 HEXADECANE × 2 D10 DECANE × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9FGG Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in Saposin A nanodisc bound to GABA and Etomidate in the long-lived symmetric desensitised state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 28–456（429 aa） Chain D 28–456（429 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 D10 DECANE × 5 CL CHLORIDE ION × 3 ABU GAMMA-AMINO-BUTANOIC ACID × 2 V8D Etomidate × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 R16 HEXADECANE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9FGH Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in large MSP2N2 nanodisc in complex with GABA in the long-lived symmetric desensitised state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 28–456（429 aa） Chain D 28–456（429 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 CL CHLORIDE ION × 3 ABU GAMMA-AMINO-BUTANOIC ACID × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9H9E Cryo-EM structure of the human GABAA receptor alpha1 subunit in complex with the assembly factor NACHO/TMEM35A Deposited 2024-10-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 37–456（420 aa） Chain D 37–456（420 aa）	Not recorded	PX6 1,2-DIPALMITOYL-SN-GLYCERO-3-PHOSPHATE × 2 PC7 (7S)-4-HYDROXY-N,N,N-TRIMETHYL-9-OXO-7-[(PALMITOYLOXY)METHYL]-3,5,8-TRIOXA-4-PHOSPHAHEXACOSAN-1-AMINIUM 4-OXIDE × 2 PGT (1S)-2-{[{[(2R)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 2 CLR CHOLESTEROL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å

83 other PDB entries and 85 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	GBRA1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–429； UniProt 28–456

Gamma-aminobutyric acid receptor subunit gamma-2

OrganismNot specified

UniProt P18507

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 7 其他Polymer 6 PDB declaration: heptameric（7） Consistent with protein copy count	Chain C； UniProt 40–475	Not recorded	Gamma-aminobutyric acid receptor subunit beta-3 × 2 （P28472） Gamma-aminobutyric acid receptor subunit alpha-1 × 1 （P14867） Gamma-aminobutyric acid receptor subunit alpha-2 × 1 （P47869） IgG2b Fab_1F4 Heavy Chain × 1 Kappa Fab_1F4 Light Chain × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 3 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ;alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 ABU GAMMA-AMINO-BUTANOIC ACID × 2 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE；3.5 s Blot.	Resolution 3.30 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9CX7	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6D6U Human GABA-A receptor alpha1-beta2-gamma2 subtype in complex with GABA and flumazenil, conformation A Deposited 2018-04-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain E 40–361（322 aa） Chain E 439–467（29 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 Y01 CHOLESTEROL HEMISUCCINATE × 12 FYP ethyl 8-fluoro-5-methyl-6-oxo-5,6-dihydro-4H-imidazo[1,5-a][1,4]benzodiazepine-3-carboxylate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；3 seconds blot time	Resolution 3.92 Å
6HUG CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with picrotoxin and megabody Mb38. Deposited 2018-10-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–475（475 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 RI5 (1aR,2aR,3S,6R,6aS,8aS,8bR,9R)-2a-hydroxy-8b-methyl-9-(prop-1-en-2-yl)hexahydro-3,6-methano-1,5,7-trioxacyclopenta[ij]c yclopropa[a]azulene-4,8(3H)-dione × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
6HUJ CryoEM structure of human full-length heteromeric alpha1beta3gamma2L GABA(A)R in complex with picrotoxin, GABA and megabody Mb38. Deposited 2018-10-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–475（475 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 RI5 (1aR,2aR,3S,6R,6aS,8aS,8bR,9R)-2a-hydroxy-8b-methyl-9-(prop-1-en-2-yl)hexahydro-3,6-methano-1,5,7-trioxacyclopenta[ij]c yclopropa[a]azulene-4,8(3H)-dione × 1 ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.04 Å
6HUK CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with bicuculline and megabody Mb38. Deposited 2018-10-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–475（475 aa）	Not recorded	H0Z bicuculline methochloride × 2 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.69 Å
6HUO CryoEM structure of human full-length heteromeric alpha1beta3gamma2L GABA(A)R in complex with alprazolam (Xanax), GABA and megabody Mb38. Deposited 2018-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–475（475 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 08H 8-chloro-1-methyl-6-phenyl-4H-[1,2,4]triazolo[4,3-a][1,4]benzodiazepine × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.26 Å
6HUP CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with diazepam (Valium), GABA and megabody Mb38. Deposited 2018-10-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–475（475 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 DZP 7-CHLORO-1-METHYL-5-PHENYL-1,3-DIHYDRO-2H-1,4-BENZODIAZEPIN-2-ONE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.58 Å
6I53 Cryo-EM structure of the human synaptic alpha1-beta3-gamma2 GABAA receptor in complex with Megabody38 in a lipid nanodisc Deposited 2018-11-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–475（475 aa）	Not recorded	POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 3 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6X3S Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with bicuculline methbromide Deposited 2020-05-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain E 42–361（320 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 J94 (5S)-6,6-dimethyl-5-[(6R)-8-oxo-6,8-dihydrofuro[3,4-e][1,3]benzodioxol-6-yl]-5,6,7,8-tetrahydro[1,3]dioxolo[4,5-g]isoquinolin-6-ium × 2 MAN alpha-D-mannopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot	Resolution 3.12 Å
6X3T Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus propofol Deposited 2020-05-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain E 42–361（320 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 PFL 2,6-BIS(1-METHYLETHYL)PHENOL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot	Resolution 2.55 Å
6X3U Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus flumazenil Deposited 2020-05-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain E 42–361（320 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 ABU GAMMA-AMINO-BUTANOIC ACID × 2 FYP ethyl 8-fluoro-5-methyl-6-oxo-5,6-dihydro-4H-imidazo[1,5-a][1,4]benzodiazepine-3-carboxylate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot	Resolution 3.50 Å
6X3V Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus etomidate Deposited 2020-05-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain E 42–361（320 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 V8D Etomidate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot	Resolution 3.50 Å
6X3W Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus phenobarbital Deposited 2020-05-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain E 42–361（320 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 ABU GAMMA-AMINO-BUTANOIC ACID × 2 UQA 5-ethyl-5-phenylpyrimidine-2,4,6(1H,3H,5H)-trione × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot	Resolution 3.30 Å
6X3X Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus diazepam Deposited 2020-05-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain E 42–361（320 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 DZP 7-CHLORO-1-METHYL-5-PHENYL-1,3-DIHYDRO-2H-1,4-BENZODIAZEPIN-2-ONE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot	Resolution 2.92 Å
6X3Z Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA Deposited 2020-05-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain E 42–361（320 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot	Resolution 3.23 Å
6X40 Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus picrotoxin Deposited 2020-05-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain E 42–361（320 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 RI5 (1aR,2aR,3S,6R,6aS,8aS,8bR,9R)-2a-hydroxy-8b-methyl-9-(prop-1-en-2-yl)hexahydro-3,6-methano-1,5,7-trioxacyclopenta[ij]c yclopropa[a]azulene-4,8(3H)-dione × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot	Resolution 2.86 Å
7T0W Complex of GABA-A synaptic receptor with autoimmune antibody Fab115 Deposited 2021-11-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain E 40–361（322 aa） Chain E 440–467（28 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
7T0Z Complex of GABA-A synaptic receptor with autoimmune antibody Fab175 Deposited 2021-11-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain E 40–361（322 aa） Chain E 440–467（28 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 MAN alpha-D-mannopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8BHG GABA-A receptor a5 heteromer - a5V2 - Bretazenil Deposited 2022-10-31	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 40–409（370 aa）	Not recorded	QMU Bretazenil × 5 DMU DECYL-BETA-D-MALTOPYRANOSIDE × 5 NO3 NITRATE ION × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；279 K；22% PEG 400 0.37M potassium nitrate 0.1 M 2-(N-morpholino)ethanesulfonic acid (MES) pH 6.5	Resolution 2.39 Å R-free 0.283
8DD2 Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus Zolpidem Deposited 2022-06-17	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain E 40–361（322 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 R5R Zolpidem × 3 ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot	Resolution 2.90 Å
8DD3 Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus DMCM Deposited 2022-06-17	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain E 40–361（322 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 R63 methyl 4-ethyl-6,7-dimethoxy-9H-pyrido[3,4-b]indole-3-carboxylate × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；3.5 second blot	Resolution 2.90 Å
8SGO Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus pregnenolone sulfate Deposited 2023-04-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain E 40–361（322 aa） Chain E 439–467（29 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 PTY PHOSPHATIDYLETHANOLAMINE × 6 Q3G O-[(R)-[(2S)-2-(hexadecanoyloxy)-3-(octadecanoyloxy)propoxy](hydroxy)phosphoryl]-D-serine × 1 A8W Pregnenolone sulfate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.65 Å
8SI9 Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus allopregnanolone Deposited 2023-04-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain E 40–361（322 aa） Chain E 439–467（29 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 Y4B allopregnanolone × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.98 Å
8SID Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus dehydroepiandrosterone sulfate Deposited 2023-04-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain E 40–361（322 aa） Chain E 439–467（29 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 ZWY 17-oxoandrost-5-en-3beta-yl hydrogen sulfate × 1 PTY PHOSPHATIDYLETHANOLAMINE × 6 Q3G O-[(R)-[(2S)-2-(hexadecanoyloxy)-3-(octadecanoyloxy)propoxy](hydroxy)phosphoryl]-D-serine × 1 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.71 Å
8VQY Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus methaqualone Deposited 2024-01-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain E 40–361（322 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 A1ADG 2-methyl-3-(2-methylphenyl)quinazolin-4(3H)-one × 3 PTY PHOSPHATIDYLETHANOLAMINE × 4 Q3G O-[(R)-[(2S)-2-(hexadecanoyloxy)-3-(octadecanoyloxy)propoxy](hydroxy)phosphoryl]-D-serine × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.82 Å
8VRN Human GABAA receptor alpha1-beta2-gamma2 subtype in complex with GABA plus PPTQ Deposited 2024-01-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain E 40–361（322 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 A1ADN 3-(4-methylphenyl)-2-phenylquinazolin-4(3H)-one × 2 PTY PHOSPHATIDYLETHANOLAMINE × 5 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 1 Q3G O-[(R)-[(2S)-2-(hexadecanoyloxy)-3-(octadecanoyloxy)propoxy](hydroxy)phosphoryl]-D-serine × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.57 Å
9CRS Native human GABAA receptor of beta2-alpha1-beta2-alpha1-gamma2 assembly Deposited 2024-07-22	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain E 40–475（436 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5s blot	Resolution 2.90 Å
9CRV Native human GABAA receptor of beta2-alpha1-gamma2-beta2-alpha2 assembly Deposited 2024-07-22	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain C 40–475（436 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5s blot	Resolution 3.18 Å
9CSB Native human GABAA receptor of beta3-alpha1-beta2-alpha2-gamma2 assembly Deposited 2024-07-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain E 40–475（436 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5 s Blot.	Resolution 3.34 Å
9CT0 Native human GABAA receptor of beta2-alpha1-beta2-alpha2-gamma2 assembly Deposited 2024-07-24	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain E 40–475（436 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5 s Blot.	Resolution 3.19 Å
9CTJ Native human GABAA receptor of beta2-alpha1-beta3-alpha2-gamma2 assembly Deposited 2024-07-25	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain E 40–475（436 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5 s Blot.	Resolution 3.74 Å
9CTP Native human GABAA receptor of beta2-alpha1-beta2-alpha3-gamma2 assembly Deposited 2024-07-25	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain E 40–475（436 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5 s Blot.	Resolution 3.62 Å
9CTV Native human GABAA receptor of beta2-alpha1-gamma2-beta1-alpha2 assembly Deposited 2024-07-25	Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain C 40–475（436 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5 s Blot.	Resolution 3.36 Å
9CXA Native human GABAA receptor of beta2-alpha1-beta3-alpha1-gamma2 assembly Deposited 2024-07-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain E 1–475（475 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.04 Å
9CXB Native human GABAA receptor of beta2-alpha1-beta1-alpha2-gamma2 assembly Deposited 2024-07-31	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain E 40–475（436 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5 s Blot.	Resolution 3.33 Å
9CXC Native human GABAA receptor of beta3-alpha1-gamma2-beta2-alpha2 assembly Deposited 2024-07-31	Parsed fields agree	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain C 40–475（436 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5 s Blot.	Resolution 3.30 Å
9CXD Native human GABAA receptor of beta2-alpha1-beta1-beta1-gamma2 assembly Deposited 2024-07-31	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain E 40–475（436 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 1 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5 s Blot.	Resolution 3.36 Å
9DRX Human GABAA receptor of beta2-alpha1-beta2-alpha1-gamma2 subtype in complex with GABA plus Lamotrigine Deposited 2024-09-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain E 40–361（322 aa） Chain E 448–475（28 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 IYJ (6M)-6-(2,3-dichlorophenyl)-1,2,4-triazine-3,5-diamine × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5 s Blot.	Resolution 2.95 Å
9EQG CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with GABA and puerarin Deposited 2024-03-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–475（475 aa）	Not recorded	PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 2 D10 DECANE × 11 HEX HEXANE × 10 PT5 [(2R)-1-octadecanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phospho ryl]oxy-propan-2-yl] (8Z)-icosa-5,8,11,14-tetraenoate × 2 R16 HEXADECANE × 5 PLM PALMITIC ACID × 3 CL CHLORIDE ION × 3 ABU GAMMA-AMINO-BUTANOIC ACID × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 A1H6W Puerarin × 1 PX2 1,2-DILAUROYL-SN-GLYCERO-3-PHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 100 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å
9FAJ CryoEM structure of human full-length alpha1beta3gamma2 GABA(A) receptor in complex with GARLH4, the TMD of Neuroligin2, GABA and Megabody38, in a desensitised state (StateD1) Deposited 2024-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain C 64–467（404 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 5 D10 DECANE × 12 PX2 1,2-DILAUROYL-SN-GLYCERO-3-PHOSPHATE × 5 ABU GAMMA-AMINO-BUTANOIC ACID × 2 CL CHLORIDE ION × 4 R16 HEXADECANE × 4 HEX HEXANE × 7 PLM PALMITIC ACID × 5 OLC (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate × 1 CLR CHOLESTEROL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9FAK CryoEM structure of human full-length alpha1beta3gamma2 GABA(A) receptor in complex with GARLH4, the TMD of Neuroligin2, GABA and Megabody38 in a desensitised state (StateD2) Deposited 2024-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain C 64–467（404 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	HEX HEXANE × 6 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 5 PX2 1,2-DILAUROYL-SN-GLYCERO-3-PHOSPHATE × 5 D10 DECANE × 7 PLM PALMITIC ACID × 8 CL CHLORIDE ION × 4 ABU GAMMA-AMINO-BUTANOIC ACID × 2 R16 HEXADECANE × 3 OLC (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate × 1 CLR CHOLESTEROL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9FAM CryoEM structure of human full-length alpha1beta3gamma2 GABA(A)R in complex with GARLH4, the TMD of Neuroligin2, GABA and Megabody38 in a desensitised state (StateD3) Deposited 2024-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain C 64–467（404 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 CL CHLORIDE ION × 3 HEX HEXANE × 7 D10 DECANE × 1 PLM PALMITIC ACID × 1 CLR CHOLESTEROL × 1 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
9FAN CryoEM structure of gamma2 subunit of GABA(A)R in complex with GARLH4, the TMD of Neuroligin2 from desensitised state obtained by focused refinement Deposited 2024-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 408–467（60 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	PLM PALMITIC ACID × 1 CLR CHOLESTEROL × 1 D10 DECANE × 1 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 1 CL CHLORIDE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9FAP CryoEM structure of human full-length alpha1beta3gamma2 GABA(A)R in complex with GARLH4, the TMD of Neuroligin2 and Megabody38 in a closed state (StateC1) Deposited 2024-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain C 66–467（402 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 5 PX2 1,2-DILAUROYL-SN-GLYCERO-3-PHOSPHATE × 2 PLM PALMITIC ACID × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CLR CHOLESTEROL × 1 D10 DECANE × 1 HEX HEXANE × 2 CL CHLORIDE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9FAQ CryoEM structure of human full-length alpha1beta3gamma2 GABA(A)R in complex with GARLH4, the TMD of Neuroligin2 and Megabody38 in a closed state (StateC2) Deposited 2024-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain C 66–467（402 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 5 D10 DECANE × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PLM PALMITIC ACID × 5 CLR CHOLESTEROL × 1 PX2 1,2-DILAUROYL-SN-GLYCERO-3-PHOSPHATE × 1 HEX HEXANE × 2 CL CHLORIDE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9FAR CryoEM structure of gamma2 subunit of GABA(A)R in complex with GARLH4, the TMD of Neuroligin2 from a closed state, obtained by focused refinement Deposited 2024-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 408–467（60 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	PLM PALMITIC ACID × 1 CLR CHOLESTEROL × 1 D10 DECANE × 1 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 1 CL CHLORIDE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9FAS CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with pregnenolone sulfate Deposited 2024-05-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 64–475（412 aa）	Not recorded	HEX HEXANE × 8 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 3 D10 DECANE × 17 PLM PALMITIC ACID × 3 CL CHLORIDE ION × 3 PX2 1,2-DILAUROYL-SN-GLYCERO-3-PHOSPHATE × 1 R16 HEXADECANE × 5 A8W Pregnenolone sulfate × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
9FAT CryoEM structure of human full-length alpha1beta3gamma2 GABA(A)R in complex with GARLH4, the TMD of Neuroligin2, Megabody38 and pregnenolone sulfate Deposited 2024-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain C 64–467（404 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 3 D10 DECANE × 3 CL CHLORIDE ION × 2 R16 HEXADECANE × 1 HEX HEXANE × 3 PLM PALMITIC ACID × 1 CLR CHOLESTEROL × 1 PX2 1,2-DILAUROYL-SN-GLYCERO-3-PHOSPHATE × 1 A8W Pregnenolone sulfate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9FAU CryoEM structure of human full-length beta3gamma2 GABA(A) receptor in complex with GARLH4, the TMD of Neuroligin2 and Megabody25, in a closed state (StateC1) Deposited 2024-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain C 65–467（403 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	HEX HEXANE × 6 D10 DECANE × 6 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 2 PX2 1,2-DILAUROYL-SN-GLYCERO-3-PHOSPHATE × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 R16 HEXADECANE × 3 PLM PALMITIC ACID × 2 CLR CHOLESTEROL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9FAV CryoEM structure of human full-length beta3gamma2 GABA(A) receptor in complex with GARLH4, the TMD of Neuroligin2 and Megabody25, in a closed state (StateC2) Deposited 2024-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain C 64–467（404 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	HEX HEXANE × 5 D10 DECANE × 4 R16 HEXADECANE × 3 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 1 PX2 1,2-DILAUROYL-SN-GLYCERO-3-PHOSPHATE × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CLR CHOLESTEROL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9FAW CryoEM structure of human full-length beta3gamma2 GABA(A) receptor in complex with GARLH4, the TMD of Neuroligin2, HEPES and Megabody25, in a desensitised state Deposited 2024-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain C 60–467（408 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	HEX HEXANE × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 3 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 CLR CHOLESTEROL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9FAX CryoEM structure of human full-length beta3gamma2 GABA(A) receptor in complex with Megabody25, doubly occupied GARLH4 and Neuroligin2 TMD, in a closed state Deposited 2024-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain C 64–467（404 aa） Chain E 64–467（404 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 R16 HEXADECANE × 5 PX2 1,2-DILAUROYL-SN-GLYCERO-3-PHOSPHATE × 2 CLR CHOLESTEROL × 2 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 4 HEX HEXANE × 13 D10 DECANE × 5 PLM PALMITIC ACID × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；15 mM Hepes pH 7.4, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9FFV Cryo-EM structure of the alpha1beta3gamma2 GABA(A) receptor in complex with Nb38 in the long-lived symmetric resting state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 40–361（322 aa） Chain C 447–475（29 aa）	Not recorded	D10 DECANE × 5 CL CHLORIDE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9FFW Cryo-EM structure of the alpha1beta3gamma2 GABA(A) receptor in complex with GABA and Nb38 in the short-lived symmetric bound-closed state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 40–361（322 aa） Chain C 447–475（29 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 D10 DECANE × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9FFX Cryo-EM structure of the alpha1beta3gamma2 GABA(A) receptor in complex with GABA and Nb38 in the short-lived asymmetric bound-closed state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 40–361（322 aa） Chain C 447–475（29 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9FFY Cryo-EM structure of the alpha1beta3gamma2 GABA(A) receptor in complex with GABA and Nb38 in the short-lived asymmetric open1 state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 40–361（322 aa） Chain C 447–475（29 aa）	Not recorded	D3D (19S,22R,25R)-22,25,26-trihydroxy-16,22-dioxo-17,21,23-trioxa-22lambda~5~-phosphahexacosan-19-yl (9E)-octadec-9-enoate × 1 ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9FFZ Cryo-EM structure of the alpha1beta3gamma2 GABA(A) receptor in complex with GABA and Nb38 in the short-lived asymmetric desensitised 1 state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 40–361（322 aa） Chain C 447–475（29 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 D3D (19S,22R,25R)-22,25,26-trihydroxy-16,22-dioxo-17,21,23-trioxa-22lambda~5~-phosphahexacosan-19-yl (9E)-octadec-9-enoate × 1 CLR CHOLESTEROL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9FG0 Cryo-EM structure of the alpha1beta3gamma2 GABA(A) receptor in complex with GABA and Nb38 in the short-lived asymmetric open 2 state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 64–361（298 aa） Chain C 447–475（29 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9FG1 Cryo-EM structure of the alpha1beta3gamma2 GABA(A) receptor in complex with GABA and Nb38 in the short-lived asymmetric desensitised 2 state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain C 40–361（322 aa） Chain C 447–475（29 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 D3D (19S,22R,25R)-22,25,26-trihydroxy-16,22-dioxo-17,21,23-trioxa-22lambda~5~-phosphahexacosan-19-yl (9E)-octadec-9-enoate × 2 D10 DECANE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9FG2 Cryo-EM structure of the alpha1beta3gamma2 GABA(A) receptor in complex with GABA and Nb38 in the long-lived symmetric desensitised state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 40–361（322 aa） Chain C 447–475（29 aa）	Not recorded	D3D (19S,22R,25R)-22,25,26-trihydroxy-16,22-dioxo-17,21,23-trioxa-22lambda~5~-phosphahexacosan-19-yl (9E)-octadec-9-enoate × 2 CL CHLORIDE ION × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 D10 DECANE × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9FG3 Cryo-EM structure of the alpha1beta3gamma2 GABA(A) receptor in complex with GABA and Nb38 bound twice in the long-lived symmetric desensitised state Deposited 2024-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain C 40–361（322 aa） Chain C 447–475（29 aa）	Not recorded	D10 DECANE × 5 D3D (19S,22R,25R)-22,25,26-trihydroxy-16,22-dioxo-17,21,23-trioxa-22lambda~5~-phosphahexacosan-19-yl (9E)-octadec-9-enoate × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
9FG7 Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in complex with GABA in the short-lived symmetric bound-closed state Deposited 2024-05-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–475（475 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 D10 DECANE × 3 CL CHLORIDE ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
9FG8 Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in complex with GABA in the long-lived symmetric desensitised state Deposited 2024-05-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–475（475 aa）	Not recorded	CL CHLORIDE ION × 1 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 D10 DECANE × 5 ABU GAMMA-AMINO-BUTANOIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9FG9 Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in complex with GABA and Etomidate in the long-lived symmetric desensitised state Deposited 2024-05-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–475（475 aa）	Not recorded	CL CHLORIDE ION × 3 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 D10 DECANE × 5 LBN 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine × 2 R16 HEXADECANE × 2 ABU GAMMA-AMINO-BUTANOIC ACID × 2 V8D Etomidate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
9FGA Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in SMALPs bound to two PIP2 molecules and in complex with Mb38 Deposited 2024-05-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–475（475 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 D10 DECANE × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9FGB Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in SMALPs bound to one PIP2 molecule at chain alpha1-A and in complex with Mb38 Deposited 2024-05-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–475（475 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
9FGC Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in SMALPs bound to one PIP2 molecule at chain alpha1-D and in complex with Mb38 Deposited 2024-05-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–475（475 aa）	Not recorded	D10 DECANE × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9FGD Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in SMALPs without PIP2 and in complex with Mb38 Deposited 2024-05-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–475（475 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 D10 DECANE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9FGF Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in Saposin A nanodisc in the long-lived symmetric resting state Deposited 2024-05-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 1–475（475 aa）	Not recorded	CL CHLORIDE ION × 3 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 R16 HEXADECANE × 2 D10 DECANE × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9FGG Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in Saposin A nanodisc bound to GABA and Etomidate in the long-lived symmetric desensitised state Deposited 2024-05-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–475（475 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 D10 DECANE × 5 CL CHLORIDE ION × 3 ABU GAMMA-AMINO-BUTANOIC ACID × 2 V8D Etomidate × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 R16 HEXADECANE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9FGH Cryo-EM structure of the full-length alpha1beta3gamma2 GABA(A) receptor in large MSP2N2 nanodisc in complex with GABA in the long-lived symmetric desensitised state Deposited 2024-05-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–475（475 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 CL CHLORIDE ION × 3 ABU GAMMA-AMINO-BUTANOIC ACID × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；137 mM NaCl, 2.7 mM KCl, 4.3 mM Na2HPO cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å

70 other PDB entries and 70 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	GBRG2_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–436； UniProt 40–475

Gamma-aminobutyric acid receptor subunit alpha-2

OrganismNot specified

UniProt P47869

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 7 其他Polymer 6 PDB declaration: heptameric（7） Consistent with protein copy count	Chain E； UniProt 29–451	Not recorded	Gamma-aminobutyric acid receptor subunit beta-3 × 2 （P28472） Gamma-aminobutyric acid receptor subunit alpha-1 × 1 （P14867） Gamma-aminobutyric acid receptor subunit gamma-2 × 1 （P18507） IgG2b Fab_1F4 Heavy Chain × 1 Kappa Fab_1F4 Light Chain × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 3 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ;alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 ABU GAMMA-AMINO-BUTANOIC ACID × 2 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE；3.5 s Blot.	Resolution 3.30 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9CX7	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9CRV Native human GABAA receptor of beta2-alpha1-gamma2-beta2-alpha2 assembly Deposited 2024-07-22	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain E 29–451（423 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5s blot	Resolution 3.18 Å
9CSB Native human GABAA receptor of beta3-alpha1-beta2-alpha2-gamma2 assembly Deposited 2024-07-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain D 29–451（423 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5 s Blot.	Resolution 3.34 Å
9CT0 Native human GABAA receptor of beta2-alpha1-beta2-alpha2-gamma2 assembly Deposited 2024-07-24	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain D 29–451（423 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5 s Blot.	Resolution 3.19 Å
9CTJ Native human GABAA receptor of beta2-alpha1-beta3-alpha2-gamma2 assembly Deposited 2024-07-25	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain D 29–451（423 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5 s Blot.	Resolution 3.74 Å
9CTV Native human GABAA receptor of beta2-alpha1-gamma2-beta1-alpha2 assembly Deposited 2024-07-25	Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain E 29–451（423 aa）	Not recorded	PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5 s Blot.	Resolution 3.36 Å
9CXB Native human GABAA receptor of beta2-alpha1-beta1-alpha2-gamma2 assembly Deposited 2024-07-31	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain D 29–451（423 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5 s Blot.	Resolution 3.33 Å
9CXC Native human GABAA receptor of beta3-alpha1-gamma2-beta2-alpha2 assembly Deposited 2024-07-31	Parsed fields agree	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain E 29–451（423 aa）	Not recorded	ABU GAMMA-AMINO-BUTANOIC ACID × 2 PIO [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3.5 s Blot.	Resolution 3.30 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	GBRA2_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–423； UniProt 29–451

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9cx7
Deposition date deposition_date	2024-07-30
Structure title title	Native human GABAA receptor of beta3-alpha1-gamma2-beta3-alpha2 assembly
Keywords keywords	Ion channels, Heteropentamer, Receptor, Inhibitory., MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	40.63 Å
Radius of gyration Rg (electron density) rg_electron	40.29 Å
Forward intensity I(0) i0	592642000.00
Molecular weight molecular_weight	206940.0 kDa
Excluded volume excluded_volume	261860 Å³
Envelope volume envelope_volume	342860 Å³
Hydration-shell volume shell_volume	70283 Å³
Envelope diameter envelope_diameter	139.7 Å
Shell Rg shell_rg	46.51 Å
Envelope Rg envelope_rg	39.86 Å
Shape Rg shape_rg	40.29 Å
Total Rg total_rg	40.65 Å
Total atoms total_atoms	14573
Residues n_residues	1755
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	131.1 Å
Rg (real space) rg_real	40.54 Å
Rg uncertainty (real space) rg_real_error	0.93 Å
I(0) (real space) i0_real	5.9260e+08
I(0) uncertainty (real space) i0_real_error	9.4150e+06
Rg (reciprocal space) rg_reciprocal	40.63 Å
I(0) (reciprocal space) i0_reciprocal	592700000.0000
Solution quality estimate total_estimate	0.8903
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	47.0 Å
Skewness Skewness skewness	0.262
Kurtosis Kurtosis kurtosis	-0.453
Angular range angular_range	— – 0.1950 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	62780000.0000
Real-space data points n_real_points	40
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.887; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.999; Smooth: 0.909

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (12)

Entity 1 Entity 1 polymer

Description description	Gamma-aminobutyric acid receptor subunit beta-3
Molecular weight formula_weight	51659.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D
Atom count atom_count	14573

QSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSESNRVDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAISFDNSGIQYRKQSMPREGHGRFLGDRSLPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYYVN

Entity 2 Entity 2 polymer

Description description	Gamma-aminobutyric acid receptor subunit alpha-1
Molecular weight formula_weight	48855.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

QPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGLGERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACPLKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDPLIKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKIDRLSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ

Entity 3 Entity 3 polymer

Description description	Gamma-aminobutyric acid receptor subunit gamma-2
Molecular weight formula_weight	50937.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

QKSDDDYEDYASNKTWVLTPKVPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTWYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPLLRMFSFKAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGKDCASFFCCFEDCRTGAWRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYL

Entity 4 Entity 4 polymer

Description description	Gamma-aminobutyric acid receptor subunit alpha-2
Molecular weight formula_weight	48011.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

NIQEDEAKNNITIFTRILDRLLDGYDNRLRPGLGDSITEVFTNIYVTSFGPVSDTDMEYTIDVFFRQKWKDERLKFKGPMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLYTMRLTVQAECPMHLEDFPMDAHSCPLKFGSYAYTTSEVTYIWTYNASDSVQVAPDGSRLNQYDLLGQSIGKETIKSSTGEYTVMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKSVVNDKKKEKASVMIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKPENKPAEAKKTFNSVSKIDRMSRIVFPVLFGTFNLVYWATYLNREPVLGVSP

Entity 5 Entity 5 polymer

Description description	IgG2b Fab_1F4 Heavy Chain
Molecular weight formula_weight	49811.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMYWVKQRPEQGLEWIGRIDPANGDTKYDPKFQGKATITTDTFSNTAYLQLSSLTSEDTAVYYCARKGLRWAMDYWGQGTSVTVSTAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK

来源 Source

来源生物 organism	Mus musculus
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Cricetulus griseus

Entity 6 Entity 6 polymer

Description description	Kappa Fab_1F4 Light Chain
Molecular weight formula_weight	23505.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

NIVMTQSPKSMSMSVGERVTLSCKASEYVGTYVSWYQQKPEQSPKLLIYGASNRYTGVPDRFTGSGSATDFTLTIGSVQAEDLADYHCGQSYSYPTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

来源 Source

来源生物 organism	Mus musculus
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Cricetulus griseus

Entity 7 Entity 7 branched

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	424.4 kDa
Source method src_method	man
Copy count entity_count	3

Entity 8 Entity 8 branched

Description description	beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	586.5 kDa
Source method src_method	man
Copy count entity_count	2

Entity 9 Entity 9 branched

Description description	;alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ;
Molecular weight formula_weight	910.8 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 10 Entity 10 non-polymer

Description description	GAMMA-AMINO-BUTANOIC ACID
Molecular weight formula_weight	103.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 11 Entity 11 non-polymer

Description description	;[(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phosphoryl]oxy-propyl] octanoate ;
Molecular weight formula_weight	746.6 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 12 Entity 12 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	syn
Copy count entity_count	1

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.30 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	29584

fit	/app/data/saxs_computation/cx/9cx7/9cx7.fit
pddf	/app/data/pr_computation/cx/9cx7/9cx7.pr.out
profile	/app/data/saxs_computation/cx/9cx7/9cx7.dat

Native human GABAA receptor of beta3-alpha1-gamma2-beta3-alpha2 assembly

1. Protein Identity and Related Structures Protein Identity & Related Structures

Gamma-aminobutyric acid receptor subunit beta-3

State in the Current Structure

Other States of the Same Protein in the Database

Gamma-aminobutyric acid receptor subunit alpha-1

State in the Current Structure

Other States of the Same Protein in the Database

Gamma-aminobutyric acid receptor subunit gamma-2

State in the Current Structure

Other States of the Same Protein in the Database

Gamma-aminobutyric acid receptor subunit alpha-2

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (12)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

来源 Source

Entity 6 Entity 6 polymer

Polymer Polymer

来源 Source

Entity 7 Entity 7 branched

Entity 8 Entity 8 branched

Entity 9 Entity 9 branched

Entity 10 Entity 10 non-polymer

Entity 11 Entity 11 non-polymer

Entity 12 Entity 12 non-polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)