9e7m

In situ cryoEM structure of bacteriophage Ur-lambda tail tip complex

Method: ELECTRON MICROSCOPY D_max: 231.0 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tape measure protein

Escherichia phage Lambda

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 36 PDB declaration: 36-meric（36） Consistent with protein copy count	Chain Ha； UniProt 818–849 Chain Hb； UniProt 818–849 Chain Hc； UniProt 818–849	Not recorded	Tail tip assembly protein I × 2 （P03730） Tail tip assembly protein I × 1 （P03730） Tip attachment protein J × 3 （P03749） Tail tip protein L × 3 （P03738） Tail fiber protein × 12 （P03764） Tail tip protein M × 6 （P03737） Tail tube protein × 6 （P03733） SF4 IRON/SULFUR CLUSTER × 3	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.37 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9E7M	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8IYK Tail tip conformation 1 of phage lambda tail Deposited 2023-04-05	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 42 PDB declaration: 42-meric	Chain H 1–853（853 aa） Chain O 1–853（853 aa） Chain g 1–853（853 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 2.95 Å
8IYL Tail tip conformation 2 of phage lambda tail Deposited 2023-04-05	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 42 PDB declaration: 42-meric	Chain H 1–853（853 aa） Chain K 1–853（853 aa） Chain e 1–853（853 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.00 Å
8K35 Structure of the bacteriophage lambda tail tip complex Deposited 2023-07-14	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain M 1–853（853 aa） Chain P 1–853（853 aa） Chain S 1–853（853 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.44 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TMP_LAMBD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain Ha； PDBConstruct 1–32； UniProt 818–849 Author chain Hb； PDBConstruct 1–32； UniProt 818–849 Author chain Hc； PDBConstruct 1–32； UniProt 818–849

Tail tip assembly protein I

Escherichia phage Lambda

UniProt P03730

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 36 PDB declaration: 36-meric（36） Consistent with protein copy count	Chain Ia； UniProt 133–222 Chain Ib； UniProt 133–222 Chain Ic； UniProt 133–222	Not recorded	Tape measure protein × 3 （P03736） Tip attachment protein J × 3 （P03749） Tail tip protein L × 3 （P03738） Tail fiber protein × 12 （P03764） Tail tip protein M × 6 （P03737） Tail tube protein × 6 （P03733） SF4 IRON/SULFUR CLUSTER × 3	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.37 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9E7M	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8IYK Tail tip conformation 1 of phage lambda tail Deposited 2023-04-05	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 42 PDB declaration: 42-meric	Chain I 1–223（223 aa） Chain P 1–223（223 aa） Chain h 1–223（223 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 2.95 Å
8IYL Tail tip conformation 2 of phage lambda tail Deposited 2023-04-05	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 42 PDB declaration: 42-meric	Chain I 1–223（223 aa） Chain N 1–223（223 aa） Chain f 1–223（223 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.00 Å
8K35 Structure of the bacteriophage lambda tail tip complex Deposited 2023-07-14	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain K 1–223（223 aa） Chain Q 1–223（223 aa） Chain x 1–223（223 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.44 Å
8XCG Tail tip complex of bacteriophage lambda in the open state Deposited 2023-12-09	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain I 1–223（223 aa） Chain P 1–223（223 aa） Chain h 1–223（223 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.46 Å

4 other PDB entries and 4 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TIPI_LAMBD
Isoform	—
PDB entities	2, 3
Chains and sequence ranges	Author chain Ia； PDBConstruct 1–90； UniProt 133–222 Author chain Ib； PDBConstruct 1–90； UniProt 133–222 Author chain Ic； PDBConstruct 1–90； UniProt 133–222

Tip attachment protein J

Escherichia phage Lambda

UniProt P03749

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 36 PDB declaration: 36-meric（36） Consistent with protein copy count	Chain Ja； UniProt 1–835 Chain Jb； UniProt 1–835 Chain Jc； UniProt 1–835	Not recorded	Tape measure protein × 3 （P03736） Tail tip assembly protein I × 2 （P03730） Tail tip assembly protein I × 1 （P03730） Tail tip protein L × 3 （P03738） Tail fiber protein × 12 （P03764） Tail tip protein M × 6 （P03737） Tail tube protein × 6 （P03733） SF4 IRON/SULFUR CLUSTER × 3	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.37 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9E7M	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8IYK Tail tip conformation 1 of phage lambda tail Deposited 2023-04-05	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 42 PDB declaration: 42-meric	Chain F 1–1132（1132 aa） Chain J 1–1132（1132 aa） Chain Z 1–1132（1132 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 2.95 Å
8IYL Tail tip conformation 2 of phage lambda tail Deposited 2023-04-05	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 42 PDB declaration: 42-meric	Chain E 1–1132（1132 aa） Chain J 1–1132（1132 aa） Chain Y 1–1132（1132 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.00 Å
8JVM AHS-CSF domains of phage lambda tail Deposited 2023-06-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain F 830–995（166 aa） Fragment：AHS-CSF domains Chain J 830–995（166 aa） Fragment：AHS-CSF domains Chain Z 830–995（166 aa） Fragment：AHS-CSF domains	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.86 Å
8K35 Structure of the bacteriophage lambda tail tip complex Deposited 2023-07-14	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain A 1–1132（1132 aa） Chain B 1–1132（1132 aa） Chain I 1–1132（1132 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.44 Å
8XCG Tail tip complex of bacteriophage lambda in the open state Deposited 2023-12-09	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain F 1–1132（1132 aa） Chain J 1–1132（1132 aa） Chain Z 1–1132（1132 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.46 Å
8XCI Open state of central tail fiber of bacteriophage lambda upon binding to LamB Deposited 2023-12-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain F 1–1132（1132 aa） Chain J 1–1132（1132 aa） Chain Z 1–1132（1132 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.57 Å
8XCJ Open State of central tail fiber of bacteriophage lambda upon binding to LamB (gpJ713-LamB complex) Deposited 2023-12-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain F 713–1132（420 aa） Chain J 713–1132（420 aa） Chain Z 713–1132（420 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.98 Å
8XCK Closed state of central tail fiber of bacteriophage lambda Deposited 2023-12-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain F 713–1132（420 aa） Chain J 713–1132（420 aa） Chain Z 713–1132（420 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.75 Å
9OIK Structure of S. Typhimurium 14028 Gifsy-1 prophage HepS bound to bacteriophage lambda J Tail Tip Deposited 2025-05-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain C 902–933（32 aa） Chain D 902–933（32 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；0.2 M Sodium Acetate, 16% PEG 4000, 0.1 M Tris pH 8.5	Resolution 1.86 Å R-free 0.209

9 other PDB entries and 9 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TIPJ_LAMBD
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain Ja； PDBConstruct 1–835； UniProt 1–835 Author chain Jb； PDBConstruct 1–835； UniProt 1–835 Author chain Jc； PDBConstruct 1–835； UniProt 1–835

Tail tip protein L

Escherichia phage Lambda

UniProt P03738

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 36 PDB declaration: 36-meric（36） Consistent with protein copy count	Chain La； UniProt 1–232 Chain Lb； UniProt 1–232 Chain Lc； UniProt 1–232	Not recorded	Tape measure protein × 3 （P03736） Tail tip assembly protein I × 2 （P03730） Tail tip assembly protein I × 1 （P03730） Tip attachment protein J × 3 （P03749） Tail fiber protein × 12 （P03764） Tail tip protein M × 6 （P03737） Tail tube protein × 6 （P03733） SF4 IRON/SULFUR CLUSTER × 3	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.37 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9E7M	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8IYK Tail tip conformation 1 of phage lambda tail Deposited 2023-04-05	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 42 PDB declaration: 42-meric	Chain L 1–232（232 aa） Chain N 1–232（232 aa） Chain f 1–232（232 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 2.95 Å
8IYL Tail tip conformation 2 of phage lambda tail Deposited 2023-04-05	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 42 PDB declaration: 42-meric	Chain G 1–232（232 aa） Chain L 1–232（232 aa） Chain d 1–232（232 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.00 Å
8K35 Structure of the bacteriophage lambda tail tip complex Deposited 2023-07-14	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain G 1–232（232 aa） Chain J 1–232（232 aa） Chain N 1–232（232 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.44 Å
8XCG Tail tip complex of bacteriophage lambda in the open state Deposited 2023-12-09	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain L 1–232（232 aa） Chain N 1–232（232 aa） Chain f 1–232（232 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.46 Å

4 other PDB entries and 4 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TIPL_LAMBD
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain La； PDBConstruct 1–232； UniProt 1–232 Author chain Lb； PDBConstruct 1–232； UniProt 1–232 Author chain Lc； PDBConstruct 1–232； UniProt 1–232

Tail fiber protein

Escherichia phage Lambda

UniProt P03764

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 36 PDB declaration: 36-meric（36） Consistent with protein copy count	Chain Ta； UniProt 1–94 Chain Tb； UniProt 1–94 Chain Tc； UniProt 1–94 Chain Td； UniProt 1–94 Chain Te； UniProt 1–94 Chain Tf； UniProt 1–94 Chain Tg； UniProt 1–94 Chain Th； UniProt 1–94 Chain Ti； UniProt 1–94 Chain Tj； UniProt 1–94 Chain Tk； UniProt 1–94 Chain Tl； UniProt 1–94	Not recorded	Tape measure protein × 3 （P03736） Tail tip assembly protein I × 2 （P03730） Tail tip assembly protein I × 1 （P03730） Tip attachment protein J × 3 （P03749） Tail tip protein L × 3 （P03738） Tail tip protein M × 6 （P03737） Tail tube protein × 6 （P03733） SF4 IRON/SULFUR CLUSTER × 3	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.37 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9E7M	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9MGH In situ cryo-EM structure of bacteriophage Ur-lambda tail side fiber Deposited 2024-12-10	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: 12-meric	Chain Ta 1–94（94 aa） Chain Tb 1–94（94 aa） Chain Tc 1–94（94 aa） Chain Td 1–94（94 aa） Chain Te 1–94（94 aa） Chain Tf 1–94（94 aa） Chain Tg 1–94（94 aa） Chain Th 1–94（94 aa） Chain Ti 1–94（94 aa） Chain Tj 1–94（94 aa） Chain Tk 1–94（94 aa） Chain Tl 1–94（94 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.31 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FIBER_LAMBD
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain Ta； PDBConstruct 1–94； UniProt 1–94 Author chain Tb； PDBConstruct 1–94； UniProt 1–94 Author chain Tc； PDBConstruct 1–94； UniProt 1–94 Author chain Td； PDBConstruct 1–94； UniProt 1–94 Author chain Te； PDBConstruct 1–94； UniProt 1–94 Author chain Tf； PDBConstruct 1–94； UniProt 1–94 Author chain Tg； PDBConstruct 1–94； UniProt 1–94 Author chain Th； PDBConstruct 1–94； UniProt 1–94 Author chain Ti； PDBConstruct 1–94； UniProt 1–94 Author chain Tj； PDBConstruct 1–94； UniProt 1–94 Author chain Tk； PDBConstruct 1–94； UniProt 1–94 Author chain Tl； PDBConstruct 1–94； UniProt 1–94

Tail tip protein M

Escherichia phage Lambda

UniProt P03737

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 36 PDB declaration: 36-meric（36） Consistent with protein copy count	Chain Ma； UniProt 1–109 Chain Mb； UniProt 1–109 Chain Mc； UniProt 1–109 Chain Md； UniProt 1–109 Chain Me； UniProt 1–109 Chain Mf； UniProt 1–109	Not recorded	Tape measure protein × 3 （P03736） Tail tip assembly protein I × 2 （P03730） Tail tip assembly protein I × 1 （P03730） Tip attachment protein J × 3 （P03749） Tail tip protein L × 3 （P03738） Tail fiber protein × 12 （P03764） Tail tube protein × 6 （P03733） SF4 IRON/SULFUR CLUSTER × 3	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.37 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9E7M	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8IYK Tail tip conformation 1 of phage lambda tail Deposited 2023-04-05	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 42 PDB declaration: 42-meric	Chain E 1–109（109 aa） Chain K 1–109（109 aa） Chain M 1–109（109 aa） Chain Y 1–109（109 aa） Chain e 1–109（109 aa） Chain m 1–109（109 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 2.95 Å
8IYL Tail tip conformation 2 of phage lambda tail Deposited 2023-04-05	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 42 PDB declaration: 42-meric	Chain D 1–109（109 aa） Chain F 1–109（109 aa） Chain M 1–109（109 aa） Chain X 1–109（109 aa） Chain Z 1–109（109 aa） Chain m 1–109（109 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.00 Å
8K35 Structure of the bacteriophage lambda tail tip complex Deposited 2023-07-14	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain C 1–109（109 aa） Chain D 1–109（109 aa） Chain E 1–109（109 aa） Chain F 1–109（109 aa） Chain H 1–109（109 aa） Chain O 1–109（109 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.44 Å
8XCG Tail tip complex of bacteriophage lambda in the open state Deposited 2023-12-09	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain E 1–109（109 aa） Chain K 1–109（109 aa） Chain M 1–109（109 aa） Chain Y 1–109（109 aa） Chain e 1–109（109 aa） Chain m 1–109（109 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.46 Å

4 other PDB entries and 4 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TIPM_LAMBD
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain Ma； PDBConstruct 1–109； UniProt 1–109 Author chain Mb； PDBConstruct 1–109； UniProt 1–109 Author chain Mc； PDBConstruct 1–109； UniProt 1–109 Author chain Md； PDBConstruct 1–109； UniProt 1–109 Author chain Me； PDBConstruct 1–109； UniProt 1–109 Author chain Mf； PDBConstruct 1–109； UniProt 1–109

Tail tube protein

Escherichia phage Lambda

UniProt P03733

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 36 PDB declaration: 36-meric（36） Consistent with protein copy count	Chain Va； UniProt 3–157 Chain Vb； UniProt 3–157 Chain Vc； UniProt 3–157 Chain Vd； UniProt 3–157 Chain Ve； UniProt 3–157 Chain Vf； UniProt 3–157	Not recorded	Tape measure protein × 3 （P03736） Tail tip assembly protein I × 2 （P03730） Tail tip assembly protein I × 1 （P03730） Tip attachment protein J × 3 （P03749） Tail tip protein L × 3 （P03738） Tail fiber protein × 12 （P03764） Tail tip protein M × 6 （P03737） SF4 IRON/SULFUR CLUSTER × 3	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.6 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.37 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9E7M	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2K4Q The Solution Structure of gpV, the Major Tail Protein from Bacteriophage Lambda Deposited 2008-06-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–153（153 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.8；293 K；Ionic strength (raw mmCIF value) 200；Pressure ambient NMR sample composition 50 mM sodium phosphate, 0.6 mM DSS, 200 mM sodium chloride, 8-10 % D2O, 0.1% % sodium azide, 1 mM [U-100% 13C; U-100% 15N] gpV protein, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1 mM [U-100% 13C; U-100% 15N] gpV protein, 90-99 % D2O, 0.6 mM DSS, 50 mM sodium phosphate, 200 mM sodium chloride, 0.1 % sodium azide, 90% D2O, 10% H2O \| 90% D2O, 10% H2O	Resolution not provided
2L04 The Solution Structure of the C-terminal Ig-like Domain of the Bacteriophage Lambda Tail Tube Protein Deposited 2010-06-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 160–246（87 aa） Fragment：C-terminal, UNP residues 160-246	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.8；298 K；Ionic strength (raw mmCIF value) .2；Pressure ambient NMR sample composition 50 mM sodium phosphate-1, 200 mM sodium chloride-2, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 50 mM sodium phosphate-3, 200 mM sodium chloride-4, 100% D2O \| 100% D2O	Resolution not provided
6P3E Mobile loops and electrostatic interactions maintain the flexible lambda tail tube Deposited 2019-05-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 18 PDB declaration: octadecameric	Chain A 1–246（246 aa） Chain B 1–246（246 aa） Chain C 1–246（246 aa） Chain D 1–246（246 aa） Chain E 1–246（246 aa） Chain F 1–246（246 aa） Chain G 1–246（246 aa） Chain H 1–246（246 aa） Chain I 1–246（246 aa） Chain J 1–246（246 aa） Chain K 1–246（246 aa） Chain L 1–246（246 aa） Chain M 1–246（246 aa） Chain N 1–246（246 aa） Chain O 1–246（246 aa） Chain P 1–246（246 aa） Chain Q 1–246（246 aa） Chain R 1–246（246 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 5.40 Å
7T2E Structure of bacteriophage lambda tube protein V in C6 Deposited 2021-12-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–157（156 aa） Chain B 2–157（156 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
7T4F Structure of bacteriophage lambda tube protein V in C3 Deposited 2021-12-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 2–246（245 aa） Chain B 2–246（245 aa） Chain C 2–246（245 aa） Chain D 2–246（245 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
8IYD Tail cap of phage lambda tail Deposited 2023-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain A 1–246（246 aa） Chain B 1–246（246 aa） Chain C 1–246（246 aa） Chain D 1–246（246 aa） Chain E 1–246（246 aa） Chain F 1–246（246 aa） Chain H 1–246（246 aa） Chain I 1–246（246 aa） Chain J 1–246（246 aa） Chain L 1–246（246 aa） Chain M 1–246（246 aa） Chain N 1–246（246 aa） Chain O 1–246（246 aa） Chain P 1–246（246 aa） Chain R 1–246（246 aa） Chain S 1–246（246 aa） Chain T 1–246（246 aa） Chain V 1–246（246 aa） Chain X 1–246（246 aa） Chain Y 1–246（246 aa） Chain a 1–246（246 aa） Chain b 1–246（246 aa） Chain c 1–246（246 aa） Chain v 1–246（246 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.10 Å
8IYK Tail tip conformation 1 of phage lambda tail Deposited 2023-04-05	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 42 PDB declaration: 42-meric	Chain A 1–246（246 aa） Chain B 1–246（246 aa） Chain C 1–246（246 aa） Chain D 1–246（246 aa） Chain G 1–246（246 aa） Chain Q 1–246（246 aa） Chain R 1–246（246 aa） Chain S 1–246（246 aa） Chain T 1–246（246 aa） Chain U 1–246（246 aa） Chain V 1–246（246 aa） Chain W 1–246（246 aa） Chain X 1–246（246 aa） Chain a 1–246（246 aa） Chain b 1–246（246 aa） Chain c 1–246（246 aa） Chain d 1–246（246 aa） Chain i 1–246（246 aa） Chain j 1–246（246 aa） Chain k 1–246（246 aa） Chain l 1–246（246 aa） Chain n 1–246（246 aa） Chain o 1–246（246 aa） Chain v 1–246（246 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 2.95 Å
8IYL Tail tip conformation 2 of phage lambda tail Deposited 2023-04-05	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 42 PDB declaration: 42-meric	Chain A 1–246（246 aa） Chain B 1–246（246 aa） Chain C 1–246（246 aa） Chain O 1–246（246 aa） Chain P 1–246（246 aa） Chain Q 1–246（246 aa） Chain R 1–246（246 aa） Chain S 1–246（246 aa） Chain T 1–246（246 aa） Chain U 1–246（246 aa） Chain V 1–246（246 aa） Chain W 1–246（246 aa） Chain a 1–246（246 aa） Chain b 1–246（246 aa） Chain c 1–246（246 aa） Chain g 1–246（246 aa） Chain h 1–246（246 aa） Chain i 1–246（246 aa） Chain j 1–246（246 aa） Chain k 1–246（246 aa） Chain l 1–246（246 aa） Chain n 1–246（246 aa） Chain o 1–246（246 aa） Chain v 1–246（246 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.00 Å
8K35 Structure of the bacteriophage lambda tail tip complex Deposited 2023-07-14	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain L 1–246（246 aa） Chain R 1–246（246 aa） Chain T 1–246（246 aa） Chain U 1–246（246 aa） Chain V 1–246（246 aa） Chain W 1–246（246 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.44 Å
8K36 Structure of the bacteriophage lambda tail tube Deposited 2023-07-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 1–246（246 aa） Chain B 1–246（246 aa） Chain C 1–246（246 aa） Chain D 1–246（246 aa） Chain E 1–246（246 aa） Chain F 1–246（246 aa） Chain G 1–246（246 aa） Chain H 1–246（246 aa） Chain I 1–246（246 aa） Chain J 1–246（246 aa） Chain K 1–246（246 aa） Chain L 1–246（246 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.48 Å
8K37 Structure of the bacteriophage lambda neck Deposited 2023-07-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 18 PDB declaration: octadecameric	Chain G 1–246（246 aa） Chain H 1–246（246 aa） Chain I 1–246（246 aa） Chain J 1–246（246 aa） Chain K 1–246（246 aa） Chain L 1–246（246 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8KGE Dimeric tail tube protein gpVs of bacteriophage lambda Deposited 2023-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain V 1–246（246 aa） Chain v 1–246（246 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.80 Å
8XPM Mature virion portal of phage lambda with DNA Deposited 2024-01-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 66 PDB declaration: 68-meric	Chain O 1–246（246 aa） Chain O1 1–246（246 aa） Chain O2 1–246（246 aa） Chain P 1–246（246 aa） Chain P1 1–246（246 aa） Chain P2 1–246（246 aa） Chain Q 1–246（246 aa） Chain Q1 1–246（246 aa） Chain Q2 1–246（246 aa） Chain R 1–246（246 aa） Chain R1 1–246（246 aa） Chain R2 1–246（246 aa） Chain V 1–246（246 aa） Chain V1 1–246（246 aa） Chain V2 1–246（246 aa） Chain o 1–246（246 aa） Chain o1 1–246（246 aa） Chain o2 1–246（246 aa） Chain p 1–246（246 aa） Chain p1 1–246（246 aa） Chain p2 1–246（246 aa） Chain q 1–246（246 aa） Chain q1 1–246（246 aa） Chain q2 1–246（246 aa） Chain r 1–246（246 aa） Chain r1 1–246（246 aa） Chain r2 1–246（246 aa） Chain v 1–246（246 aa） Chain v1 1–246（246 aa） Chain v2 1–246（246 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.90 Å

13 other PDB entries and 13 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TUBE_LAMBD
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain Va； PDBConstruct 1–152； UniProt 3–157 Author chain Vb； PDBConstruct 1–152； UniProt 3–157 Author chain Vc； PDBConstruct 1–152； UniProt 3–157 Author chain Vd； PDBConstruct 1–152； UniProt 3–157 Author chain Ve； PDBConstruct 1–152； UniProt 3–157 Author chain Vf； PDBConstruct 1–152； UniProt 3–157

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9e7m
Deposition date deposition_date	2024-11-03
Structure title title	In situ cryoEM structure of bacteriophage Ur-lambda tail tip complex
Keywords keywords	bacteriophage, tail tip complex, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	68.64 Å
Radius of gyration Rg (electron density) rg_electron	69.55 Å
Forward intensity I(0) i0	6924270000.00
Molecular weight molecular_weight	686500.0 kDa
Excluded volume excluded_volume	851970 Å³
Envelope volume envelope_volume	1322900 Å³
Hydration-shell volume shell_volume	162410 Å³
Envelope diameter envelope_diameter	269.2 Å
Shell Rg shell_rg	66.91 Å
Envelope Rg envelope_rg	69.01 Å
Shape Rg shape_rg	69.58 Å
Total Rg total_rg	69.38 Å
Total atoms total_atoms	48257
Residues n_residues	6260
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	231.0 Å
Rg (real space) rg_real	68.61 Å
Rg uncertainty (real space) rg_real_error	1.66 Å
I(0) (real space) i0_real	6.9100e+09
I(0) uncertainty (real space) i0_real_error	1.5070e+08
Rg (reciprocal space) rg_reciprocal	67.55 Å
I(0) (reciprocal space) i0_reciprocal	6906000000.0000
Solution quality estimate total_estimate	0.8215
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	70.3 Å
Skewness Skewness skewness	0.639
Kurtosis Kurtosis kurtosis	0.117
Angular range angular_range	— – 0.1150 Å⁻¹
Current regularization parameter α current_alpha	0.0306
Highest regularization parameter α highest_alpha	842800000.0000
Real-space data points n_real_points	24
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.740; Stabil: 0.999; Sysdev: 1.000; Positv: 1.000; Valcen: 1.000; Smooth: 0.453

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	Tape measure protein
Molecular weight formula_weight	3472.0 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ha,Hb,Hc
Atom count atom_count	48257

IGPAALKAVYDMARKGARDEIQTQMRDGGLFS

来源 Source

来源生物 organism	Escherichia phage Lambda
NCBI Class编号 ncbi_taxonomy_id	2681611
宿主生物 host_organism	Escherichia coli K-12

Entity 2 Entity 2 polymer

Description description	Tail tip assembly protein I
Molecular weight formula_weight	9322.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ia,Ib

GGMTGILFSLGASMVLGGVAQMLAPKARTPRIQTTDNGKQNTYFSSLDNMVAQGNVLPVLYGEMRVGSRVVSQEISTADEGDGGQVVVIG

来源 Source

来源生物 organism	Escherichia phage Lambda
NCBI Class编号 ncbi_taxonomy_id	2681611
宿主生物 host_organism	Escherichia coli K-12

Entity 3 Entity 3 polymer

Description description	Tail tip assembly protein I
Molecular weight formula_weight	9308.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ic

GGMTGVLFSLGASMVLGGVAQMLAPKARTPRIQTTDNGKQNTYFSSLDNMVAQGNVLPVLYGEMRVGSRVVSQEISTADEGDGGQVVVIG

来源 Source

来源生物 organism	Escherichia phage Lambda
NCBI Class编号 ncbi_taxonomy_id	2681611
宿主生物 host_organism	Escherichia coli K-12

Entity 4 Entity 4 polymer

Description description	Tip attachment protein J
Molecular weight formula_weight	92362.3 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ja,Jb,Jc

MGKGSSKGHTPREAKDNLKSTQLLSVIDAISEGPIEGPVDGLKSVLLNSTPVLDTEGNTNISGVTVVFRAGEQEQTPPEGFESSGSETVLGTEVKYDTPITRTITSANIDRLRFTFGVQALVETTSKGDRNPSEVRLLVQIQRNGGWVTEKDITIKGKTTSQYLASVVMGNLPPRPFNIRMRRMTPDSTTDQLQNKTLWSSYTEIIDVKQCYPNTALVGVQVDSEQFGSQQVSRNYHLRGRILQVPSNYNPQTRQYSGIWDGTFKPAYSNNMAWCLWDMLTHPRYGMGKRLGAADVDKWALYVIGQYCDQSVPDGFGGTEPRITCNAYLTTQRKAWDVLSDFCSAMRCMPVWNGQTLTFVQDRPSDKTWTYNRSNVVMPDDGAPFRYSFSALKDRHNAVEVNWIDPNNGWETATELVEDTQAIARYGRNVTKMDAFGCTSRGQAHRAGLWLIKTELLETQTVDFSVGAEGLRHVPGDVIEICDDDYAGISTGGRVLAVNSQTRTLTLDREITLPSSGTALISLVDGSGNPVSVEVQSVTDGVKVKVSRVPDGVAEYSVWELKLPTLRQRLFRCVSIRENDDGTYAITAVQHVPEKEAIVDNGAHFDGEQSGTVNGVTPPAVQHLTAEVTADSGEYQVLARWDTPKVVKGVSFLLRLTVTADDGSERLVSTARTTETTYRFTQLALGNYRLTVRAVNAWGQQGDPASVSFRIAAPAAPSRIELTPGYFQITATPHLAVYDPTVQFEFWFSEKQIADIRQVETSTRYLGTALYWIAASINIKPGHDYYFYIRSVNTVGKSAFVEAVGRASDDAEGYLDFFKGKITESHLGKELLEKV

来源 Source

来源生物 organism	Escherichia phage Lambda
NCBI Class编号 ncbi_taxonomy_id	2681611
宿主生物 host_organism	Escherichia coli K-12

Entity 5 Entity 5 polymer

Description description	Tail tip protein L
Molecular weight formula_weight	25730.6 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Lc,Lb,La

MQDIRQETLNECTRAEQSASVVLWEIDLTEVGGERYFFCNEQNEKGEPVTWQGRQYQPYPIQGSGFELNGKGTSTRPTLTVSNLYGMVTGMAEDMQSLVGGTVVRRKVYARFLDAVNFVNGNSYADPEQEVISRWRIEQCSELSAVSASFVLSTPTETDGAVFPGRIMLANTCTWTYRGDECGYSGPAVADEYDQPTSDITKDKCSKCLSGCKFRNNVGNFGGFLSINKLSQ

来源 Source

来源生物 organism	Escherichia phage Lambda
NCBI Class编号 ncbi_taxonomy_id	2681611
宿主生物 host_organism	Escherichia coli K-12

Entity 6 Entity 6 polymer

Description description	Tail fiber protein
Molecular weight formula_weight	10092.3 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ta,Tb,Tc,Td,Te,Tf,Tg,Tl,Th,Ti,Tj,Tk

MAVKISGVLKDGTGKPVQNCTIQLKARRNSTTVVVNTVGSENPDEAGRYSMDVEYGQYSVILQVDGFPPSHAGTITVYEDSQPGTLNDFLCAMT

来源 Source

来源生物 organism	Escherichia phage Lambda
NCBI Class编号 ncbi_taxonomy_id	2681611
宿主生物 host_organism	Escherichia coli K-12

Entity 7 Entity 7 polymer

Description description	Tail tip protein M
Molecular weight formula_weight	12547.4 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ma,Mb,Mc,Md,Me,Mf

MKTFRWKVKPGMDVASVPSVRKVRFGDGYSQRAPAGLNANLKTYSVTLSVPREEATVLESFLEEHGGWKSFLWTPPYEWRQIKVTCAKWSSRVSMLRVEFSAEFEQVVN

来源 Source

来源生物 organism	Escherichia phage Lambda
NCBI Class编号 ncbi_taxonomy_id	2681611
宿主生物 host_organism	Escherichia coli K-12

Entity 8 Entity 8 polymer

Description description	Tail tube protein
Molecular weight formula_weight	16540.2 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Va,Vb,Vc,Vd,Ve,Vf

VPNPTMPVKGAGTTLWVYKGSGDPYANPLSDVDWSRLAKVKDLTPGELTAESYDDSYLDDEDADWTATGQGQKSAGDTSFTLAWMPGEQGQQALLAWFNEGDTRAYKIRFPNGTVDVFRGWVSSIGKAVTVITRTVKVTNVGRPSMAEDRST

来源 Source

来源生物 organism	Escherichia phage Lambda
NCBI Class编号 ncbi_taxonomy_id	2681611
宿主生物 host_organism	Escherichia coli K-12

Entity 9 Entity 9 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.37 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	6517

fit	/app/data/saxs_computation/e7/9e7m/9e7m.fit
pddf	/app/data/pr_computation/e7/9e7m/9e7m.pr.out
profile	/app/data/saxs_computation/e7/9e7m/9e7m.dat

In situ cryoEM structure of bacteriophage Ur-lambda tail tip complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tape measure protein

State in the Current Structure

Other States of the Same Protein in the Database

Tail tip assembly protein I

State in the Current Structure

Other States of the Same Protein in the Database

Tip attachment protein J

State in the Current Structure

Other States of the Same Protein in the Database

Tail tip protein L

State in the Current Structure

Other States of the Same Protein in the Database

Tail fiber protein

State in the Current Structure

Other States of the Same Protein in the Database

Tail tip protein M

State in the Current Structure

Other States of the Same Protein in the Database

Tail tube protein

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 polymer

Polymer Polymer

来源 Source

Entity 5 Entity 5 polymer

Polymer Polymer

来源 Source

Entity 6 Entity 6 polymer

Polymer Polymer

来源 Source

Entity 7 Entity 7 polymer

Polymer Polymer

来源 Source

Entity 8 Entity 8 polymer

Polymer Polymer

来源 Source

Entity 9 Entity 9 non-polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)