9eih

Import stalled PINK1 TOM complex

Method: ELECTRON MICROSCOPY D_max: 226.9 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mitochondrial import receptor subunit TOM20 homolog

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 26 PDB declaration: 26-meric（26） Consistent with protein copy count	Chain C； UniProt 1–145 Chain D； UniProt 1–145	Not recorded	Non-selective voltage-gated ion channel VDAC2 × 2 （P45880） Mitochondrial import receptor subunit TOM40 homolog × 4 （O96008） Mitochondrial import receptor subunit TOM5 homolog × 4 （Q8N4H5） Mitochondrial import receptor subunit TOM7 homolog × 4 （Q9P0U1） Mitochondrial import receptor subunit TOM6 homolog × 4 （Q96B49） Mitochondrial import receptor subunit TOM22 homolog × 4 （Q9NS69） Serine/threonine-protein kinase PINK1, mitochondrial × 2 （Q9BXM7） PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 17	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.10 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9EIH	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4APO AIP TPR domain in complex with human Tomm20 peptide Deposited 2012-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 140–145（6 aa） Fragment：RESIDUES 140-145	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions PEG 3350, AMMONIUM SULFATE, BIS-TRIS PH 5.5	Resolution 1.90 Å R-free 0.234
4APO AIP TPR domain in complex with human Tomm20 peptide Deposited 2012-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 140–145（6 aa） Fragment：RESIDUES 140-145	Not recorded	12P DODECAETHYLENE GLYCOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions PEG 3350, AMMONIUM SULFATE, BIS-TRIS PH 5.5	Resolution 1.90 Å R-free 0.234
7VC9 Tom20 subunits Deposited 2021-09-02	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain M 1–145（145 aa） Chain N 1–145（145 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 13.00 Å
8UY3 Fem1B with FNIP1 and Tom20 fragment Deposited 2023-11-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain J 62–127（66 aa） Fragment：residues 62-127	Not recorded	ZN ZINC ION × 2 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；10 mg/mL protein complex in 50 mM HEPES pH 7.5, 500 mM NaCl, 1 mM TCEP were mixed in a 2:1 ratio with the reservoir solution containing 30% PEG 3350, 0.2M Ammonium Citrate pH 7	Resolution 3.20 Å R-free 0.264
8UY3 Fem1B with FNIP1 and Tom20 fragment Deposited 2023-11-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain K 62–127（66 aa） Fragment：residues 62-127	Not recorded	ZN ZINC ION × 2 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；10 mg/mL protein complex in 50 mM HEPES pH 7.5, 500 mM NaCl, 1 mM TCEP were mixed in a 2:1 ratio with the reservoir solution containing 30% PEG 3350, 0.2M Ammonium Citrate pH 7	Resolution 3.20 Å R-free 0.264
8UY3 Fem1B with FNIP1 and Tom20 fragment Deposited 2023-11-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain M 62–127（66 aa） Fragment：residues 62-127	Not recorded	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；10 mg/mL protein complex in 50 mM HEPES pH 7.5, 500 mM NaCl, 1 mM TCEP were mixed in a 2:1 ratio with the reservoir solution containing 30% PEG 3350, 0.2M Ammonium Citrate pH 7	Resolution 3.20 Å R-free 0.264
8XVA Human TOM complex with whole Tom20 Deposited 2024-01-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: 11-meric	Chain K 1–145（145 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.92 Å
9EII Import stalled PINK1 TOM complex, symmetry expanded Deposited 2024-11-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 13 PDB declaration: 13-meric	Chain D 1–145（145 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；Blot force 10 for 2 s.	Resolution 2.75 Å
9EIJ Import stalled PINK1 TOM complex, extended TOM20 helix class Deposited 2024-11-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: 15-meric	Chain D 1–145（145 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；Blot force 10 for 2 s.	Resolution 3.30 Å
9J79 Cryo-EM structure of CRL2-FEM1B bound with TOM20(tetramer) Deposited 2024-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: 19-meric	Chain B 25–145（121 aa） Chain C 25–145（121 aa） Chain G 25–145（121 aa） Chain S 25–145（121 aa）	Not recorded	ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.08 Å
9J7A local refinement of FEM1B bound with TOM20 (dimer) Deposited 2024-08-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 25–145（121 aa） Chain C 25–145（121 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.13 Å
9J7B local refinement of FEM1B bound with TOM20(tetramer) Deposited 2024-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: 11-meric	Chain B 25–145（121 aa） Chain C 25–145（121 aa） Chain G 25–145（121 aa） Chain Q 25–145（121 aa） Chain S 25–145（121 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.12 Å
9JCE local refinement of FEM1B bound with TOM20 Deposited 2024-08-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 25–145（121 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.59 Å

10 other PDB entries and 13 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TOM20_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain C； PDBConstruct 1–145； UniProt 1–145 Author chain D； PDBConstruct 1–145； UniProt 1–145

Non-selective voltage-gated ion channel VDAC2

OrganismNot specified

UniProt P45880

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 26 PDB declaration: 26-meric（26） Consistent with protein copy count	Chain E； UniProt 1–294 Chain F； UniProt 1–294	Not recorded	Mitochondrial import receptor subunit TOM20 homolog × 2 （Q15388） Mitochondrial import receptor subunit TOM40 homolog × 4 （O96008） Mitochondrial import receptor subunit TOM5 homolog × 4 （Q8N4H5） Mitochondrial import receptor subunit TOM7 homolog × 4 （Q9P0U1） Mitochondrial import receptor subunit TOM6 homolog × 4 （Q96B49） Mitochondrial import receptor subunit TOM22 homolog × 4 （Q9NS69） Serine/threonine-protein kinase PINK1, mitochondrial × 2 （Q9BXM7） PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 17	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.10 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9EIH	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9EII Import stalled PINK1 TOM complex, symmetry expanded Deposited 2024-11-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 13 PDB declaration: 13-meric	Chain F 1–294（294 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；Blot force 10 for 2 s.	Resolution 2.75 Å
9EIJ Import stalled PINK1 TOM complex, extended TOM20 helix class Deposited 2024-11-26	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: 15-meric	Chain E 1–294（294 aa） Chain F 1–294（294 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；Blot force 10 for 2 s.	Resolution 3.30 Å

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	VDAC2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 1–294； UniProt 1–294 Author chain F； PDBConstruct 1–294； UniProt 1–294

Mitochondrial import receptor subunit TOM40 homolog

OrganismNot specified

UniProt O96008

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 26 PDB declaration: 26-meric（26） Consistent with protein copy count	Chain G； UniProt 1–361 Chain H； UniProt 1–361 Chain I； UniProt 1–361 Chain J； UniProt 1–361	Not recorded	Mitochondrial import receptor subunit TOM20 homolog × 2 （Q15388） Non-selective voltage-gated ion channel VDAC2 × 2 （P45880） Mitochondrial import receptor subunit TOM5 homolog × 4 （Q8N4H5） Mitochondrial import receptor subunit TOM7 homolog × 4 （Q9P0U1） Mitochondrial import receptor subunit TOM6 homolog × 4 （Q96B49） Mitochondrial import receptor subunit TOM22 homolog × 4 （Q9NS69） Serine/threonine-protein kinase PINK1, mitochondrial × 2 （Q9BXM7） PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 17	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.10 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9EIH	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7CK6 Protein translocase of mitochondria Deposited 2020-07-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain A 1–361（361 aa） Chain B 1–361（361 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.40 Å
7CP9 Cryo-EM structure of human mitochondrial translocase TOM complex at 3.0 angstrom. Deposited 2020-08-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain I 1–361（361 aa） Chain J 1–361（361 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
7VC4 Tom complex with Tom22 and Tom20 subunits Deposited 2021-09-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain B 1–361（361 aa） Chain I 1–361（361 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.74 Å
7VD2 Human TOM complex without cross-linking Deposited 2021-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain B 1–361（361 aa） Chain I 1–361（361 aa）	Not recorded	UND UNDECANE × 16 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 27	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.53 Å
7VDD Human TOM complex with cross-linking Deposited 2021-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain B 1–361（361 aa） Chain I 1–361（361 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.74 Å
8XDN TOM complex with small molecule Deposited 2023-12-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain A 1–361（361 aa） Chain B 1–361（361 aa）	Not recorded	FUD D-fructose × 1 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.93 Å
8XVA Human TOM complex with whole Tom20 Deposited 2024-01-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: 11-meric	Chain B 1–361（361 aa） Chain I 1–361（361 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.92 Å
9EII Import stalled PINK1 TOM complex, symmetry expanded Deposited 2024-11-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 13 PDB declaration: 13-meric	Chain I 1–361（361 aa） Chain J 1–361（361 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；Blot force 10 for 2 s.	Resolution 2.75 Å
9EIJ Import stalled PINK1 TOM complex, extended TOM20 helix class Deposited 2024-11-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: 15-meric	Chain I 1–361（361 aa） Chain J 1–361（361 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；Blot force 10 for 2 s.	Resolution 3.30 Å
9JXV human translocase of the outer mitochondrial membrane (TOM complex) Deposited 2024-10-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain A 1–361（361 aa） Chain B 1–361（361 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

10 other PDB entries and 10 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TOM40_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain G； PDBConstruct 1–361； UniProt 1–361 Author chain H； PDBConstruct 1–361； UniProt 1–361 Author chain I； PDBConstruct 1–361； UniProt 1–361 Author chain J； PDBConstruct 1–361； UniProt 1–361

Mitochondrial import receptor subunit TOM5 homolog

OrganismNot specified

UniProt Q8N4H5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 26 PDB declaration: 26-meric（26） Consistent with protein copy count	Chain K； UniProt 1–51 Chain L； UniProt 1–51 Chain Y； UniProt 1–51 Chain Z； UniProt 1–51	Not recorded	Mitochondrial import receptor subunit TOM20 homolog × 2 （Q15388） Non-selective voltage-gated ion channel VDAC2 × 2 （P45880） Mitochondrial import receptor subunit TOM40 homolog × 4 （O96008） Mitochondrial import receptor subunit TOM7 homolog × 4 （Q9P0U1） Mitochondrial import receptor subunit TOM6 homolog × 4 （Q96B49） Mitochondrial import receptor subunit TOM22 homolog × 4 （Q9NS69） Serine/threonine-protein kinase PINK1, mitochondrial × 2 （Q9BXM7） PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 17	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.10 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9EIH	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7CK6 Protein translocase of mitochondria Deposited 2020-07-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain I 1–51（51 aa） Chain J 1–51（51 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.40 Å
7CP9 Cryo-EM structure of human mitochondrial translocase TOM complex at 3.0 angstrom. Deposited 2020-08-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain A 1–51（51 aa） Chain B 1–51（51 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
7VBY Tom core complex with Tom20 and Tom22 subunits. Deposited 2021-09-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain D 1–51（51 aa） Chain E 1–51（51 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 11 UND UNDECANE × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.54 Å
7VC4 Tom complex with Tom22 and Tom20 subunits Deposited 2021-09-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain D 1–51（51 aa） Chain E 1–51（51 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.74 Å
7VD2 Human TOM complex without cross-linking Deposited 2021-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain D 1–51（51 aa） Chain E 1–51（51 aa）	Not recorded	UND UNDECANE × 16 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 27	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.53 Å
7VDD Human TOM complex with cross-linking Deposited 2021-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain D 1–51（51 aa） Chain E 1–51（51 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.74 Å
8XDN TOM complex with small molecule Deposited 2023-12-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain I 1–51（51 aa） Chain J 1–51（51 aa）	Not recorded	FUD D-fructose × 1 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.93 Å
8XVA Human TOM complex with whole Tom20 Deposited 2024-01-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: 11-meric	Chain D 1–51（51 aa） Chain E 1–51（51 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.92 Å
9EII Import stalled PINK1 TOM complex, symmetry expanded Deposited 2024-11-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 13 PDB declaration: 13-meric	Chain L 1–51（51 aa） Chain Z 1–51（51 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；Blot force 10 for 2 s.	Resolution 2.75 Å
9EIJ Import stalled PINK1 TOM complex, extended TOM20 helix class Deposited 2024-11-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: 15-meric	Chain K 1–51（51 aa） Chain L 1–51（51 aa） Chain Z 1–51（51 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；Blot force 10 for 2 s.	Resolution 3.30 Å
9JXV human translocase of the outer mitochondrial membrane (TOM complex) Deposited 2024-10-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain I 1–51（51 aa） Chain J 1–51（51 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

11 other PDB entries and 11 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TOM5_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain K； PDBConstruct 1–51； UniProt 1–51 Author chain L； PDBConstruct 1–51； UniProt 1–51 Author chain Y； PDBConstruct 1–51； UniProt 1–51 Author chain Z； PDBConstruct 1–51； UniProt 1–51

Mitochondrial import receptor subunit TOM7 homolog

OrganismNot specified

UniProt Q9P0U1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 26 PDB declaration: 26-meric（26） Consistent with protein copy count	Chain M； UniProt 1–55 Chain N； UniProt 1–55 Chain W； UniProt 1–55 Chain X； UniProt 1–55	Not recorded	Mitochondrial import receptor subunit TOM20 homolog × 2 （Q15388） Non-selective voltage-gated ion channel VDAC2 × 2 （P45880） Mitochondrial import receptor subunit TOM40 homolog × 4 （O96008） Mitochondrial import receptor subunit TOM5 homolog × 4 （Q8N4H5） Mitochondrial import receptor subunit TOM6 homolog × 4 （Q96B49） Mitochondrial import receptor subunit TOM22 homolog × 4 （Q9NS69） Serine/threonine-protein kinase PINK1, mitochondrial × 2 （Q9BXM7） PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 17	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.10 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9EIH	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7CK6 Protein translocase of mitochondria Deposited 2020-07-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain G 1–55（55 aa） Chain H 1–55（55 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.40 Å
7CP9 Cryo-EM structure of human mitochondrial translocase TOM complex at 3.0 angstrom. Deposited 2020-08-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain E 1–55（55 aa） Chain F 1–55（55 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
7VBY Tom core complex with Tom20 and Tom22 subunits. Deposited 2021-09-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain G 1–55（55 aa） Chain J 1–55（55 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 11 UND UNDECANE × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.54 Å
7VC4 Tom complex with Tom22 and Tom20 subunits Deposited 2021-09-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain G 1–55（55 aa） Chain J 1–55（55 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.74 Å
7VD2 Human TOM complex without cross-linking Deposited 2021-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain G 1–55（55 aa） Chain J 1–55（55 aa）	Not recorded	UND UNDECANE × 16 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 27	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.53 Å
7VDD Human TOM complex with cross-linking Deposited 2021-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain G 1–55（55 aa） Chain J 1–55（55 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.74 Å
8XDN TOM complex with small molecule Deposited 2023-12-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain G 1–55（55 aa） Chain H 1–55（55 aa）	Not recorded	FUD D-fructose × 1 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.93 Å
8XVA Human TOM complex with whole Tom20 Deposited 2024-01-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: 11-meric	Chain G 1–55（55 aa） Chain J 1–55（55 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.92 Å
9EII Import stalled PINK1 TOM complex, symmetry expanded Deposited 2024-11-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 13 PDB declaration: 13-meric	Chain N 1–55（55 aa） Chain X 1–55（55 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；Blot force 10 for 2 s.	Resolution 2.75 Å
9EIJ Import stalled PINK1 TOM complex, extended TOM20 helix class Deposited 2024-11-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: 15-meric	Chain N 1–55（55 aa） Chain X 1–55（55 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；Blot force 10 for 2 s.	Resolution 3.30 Å
9JXV human translocase of the outer mitochondrial membrane (TOM complex) Deposited 2024-10-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain G 1–55（55 aa） Chain H 1–55（55 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

11 other PDB entries and 11 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TOM7_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain M； PDBConstruct 1–55； UniProt 1–55 Author chain N； PDBConstruct 1–55； UniProt 1–55 Author chain W； PDBConstruct 1–55； UniProt 1–55 Author chain X； PDBConstruct 1–55； UniProt 1–55

Mitochondrial import receptor subunit TOM6 homolog

OrganismNot specified

UniProt Q96B49

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 26 PDB declaration: 26-meric（26） Consistent with protein copy count	Chain O； UniProt 1–74 Chain P； UniProt 1–74 Chain U； UniProt 1–74 Chain V； UniProt 1–74	Not recorded	Mitochondrial import receptor subunit TOM20 homolog × 2 （Q15388） Non-selective voltage-gated ion channel VDAC2 × 2 （P45880） Mitochondrial import receptor subunit TOM40 homolog × 4 （O96008） Mitochondrial import receptor subunit TOM5 homolog × 4 （Q8N4H5） Mitochondrial import receptor subunit TOM7 homolog × 4 （Q9P0U1） Mitochondrial import receptor subunit TOM22 homolog × 4 （Q9NS69） Serine/threonine-protein kinase PINK1, mitochondrial × 2 （Q9BXM7） PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 17	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.10 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9EIH	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7CK6 Protein translocase of mitochondria Deposited 2020-07-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain E 1–74（74 aa） Chain F 1–74（74 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.40 Å
7CP9 Cryo-EM structure of human mitochondrial translocase TOM complex at 3.0 angstrom. Deposited 2020-08-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain C 1–74（74 aa） Chain D 1–74（74 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
7VBY Tom core complex with Tom20 and Tom22 subunits. Deposited 2021-09-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain A 1–74（74 aa） Chain F 1–74（74 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 11 UND UNDECANE × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.54 Å
7VC4 Tom complex with Tom22 and Tom20 subunits Deposited 2021-09-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain A 1–74（74 aa） Chain F 1–74（74 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.74 Å
7VD2 Human TOM complex without cross-linking Deposited 2021-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain A 1–74（74 aa） Chain F 1–74（74 aa）	Not recorded	UND UNDECANE × 16 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 27	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.53 Å
7VDD Human TOM complex with cross-linking Deposited 2021-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain A 1–74（74 aa） Chain F 1–74（74 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.74 Å
8XDN TOM complex with small molecule Deposited 2023-12-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain E 1–74（74 aa） Chain F 1–74（74 aa）	Not recorded	FUD D-fructose × 1 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.93 Å
8XVA Human TOM complex with whole Tom20 Deposited 2024-01-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: 11-meric	Chain A 1–74（74 aa） Chain F 1–74（74 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.92 Å
9EII Import stalled PINK1 TOM complex, symmetry expanded Deposited 2024-11-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 13 PDB declaration: 13-meric	Chain P 1–74（74 aa） Chain V 1–74（74 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；Blot force 10 for 2 s.	Resolution 2.75 Å
9EIJ Import stalled PINK1 TOM complex, extended TOM20 helix class Deposited 2024-11-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: 15-meric	Chain P 1–74（74 aa） Chain V 1–74（74 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；Blot force 10 for 2 s.	Resolution 3.30 Å
9JXV human translocase of the outer mitochondrial membrane (TOM complex) Deposited 2024-10-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain E 1–74（74 aa） Chain F 1–74（74 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

11 other PDB entries and 11 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TOM6_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain O； PDBConstruct 1–74； UniProt 1–74 Author chain P； PDBConstruct 1–74； UniProt 1–74 Author chain U； PDBConstruct 1–74； UniProt 1–74 Author chain V； PDBConstruct 1–74； UniProt 1–74

Mitochondrial import receptor subunit TOM22 homolog

OrganismNot specified

UniProt Q9NS69

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 26 PDB declaration: 26-meric（26） Consistent with protein copy count	Chain Q； UniProt 1–142 Chain R； UniProt 1–142 Chain S； UniProt 1–142 Chain T； UniProt 1–142	Not recorded	Mitochondrial import receptor subunit TOM20 homolog × 2 （Q15388） Non-selective voltage-gated ion channel VDAC2 × 2 （P45880） Mitochondrial import receptor subunit TOM40 homolog × 4 （O96008） Mitochondrial import receptor subunit TOM5 homolog × 4 （Q8N4H5） Mitochondrial import receptor subunit TOM7 homolog × 4 （Q9P0U1） Mitochondrial import receptor subunit TOM6 homolog × 4 （Q96B49） Serine/threonine-protein kinase PINK1, mitochondrial × 2 （Q9BXM7） PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 17	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.10 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9EIH	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7CK6 Protein translocase of mitochondria Deposited 2020-07-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain C 1–142（142 aa） Chain D 1–142（142 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.40 Å
7CP9 Cryo-EM structure of human mitochondrial translocase TOM complex at 3.0 angstrom. Deposited 2020-08-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain G 1–142（142 aa） Chain H 1–142（142 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 11	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
7VBY Tom core complex with Tom20 and Tom22 subunits. Deposited 2021-09-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain C 1–142（142 aa） Chain H 1–142（142 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 11 UND UNDECANE × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.54 Å
7VC4 Tom complex with Tom22 and Tom20 subunits Deposited 2021-09-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain C 1–142（142 aa） Chain H 1–142（142 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.74 Å
7VD2 Human TOM complex without cross-linking Deposited 2021-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain C 1–142（142 aa） Chain H 1–142（142 aa）	Not recorded	UND UNDECANE × 16 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 27	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.53 Å
7VDD Human TOM complex with cross-linking Deposited 2021-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain C 1–142（142 aa） Chain H 1–142（142 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.74 Å
8XDN TOM complex with small molecule Deposited 2023-12-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain C 1–142（142 aa） Chain D 1–142（142 aa）	Not recorded	FUD D-fructose × 1 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.93 Å
8XVA Human TOM complex with whole Tom20 Deposited 2024-01-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: 11-meric	Chain C 1–142（142 aa） Chain H 1–142（142 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.92 Å
9EII Import stalled PINK1 TOM complex, symmetry expanded Deposited 2024-11-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 13 PDB declaration: 13-meric	Chain R 1–142（142 aa） Chain T 1–142（142 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；Blot force 10 for 2 s.	Resolution 2.75 Å
9EIJ Import stalled PINK1 TOM complex, extended TOM20 helix class Deposited 2024-11-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: 15-meric	Chain R 1–142（142 aa） Chain T 1–142（142 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；Blot force 10 for 2 s.	Resolution 3.30 Å
9JXV human translocase of the outer mitochondrial membrane (TOM complex) Deposited 2024-10-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain C 1–142（142 aa） Chain D 1–142（142 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.89 Å

11 other PDB entries and 11 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TOM22_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain Q； PDBConstruct 1–142； UniProt 1–142 Author chain R； PDBConstruct 1–142； UniProt 1–142 Author chain S； PDBConstruct 1–142； UniProt 1–142 Author chain T； PDBConstruct 1–142； UniProt 1–142

Serine/threonine-protein kinase PINK1, mitochondrial

Homo sapiens

UniProt Q9BXM7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 26 PDB declaration: 26-meric（26） Consistent with protein copy count	Chain A； UniProt 1–581 Chain B； UniProt 1–581	Not recorded	Mitochondrial import receptor subunit TOM20 homolog × 2 （Q15388） Non-selective voltage-gated ion channel VDAC2 × 2 （P45880） Mitochondrial import receptor subunit TOM40 homolog × 4 （O96008） Mitochondrial import receptor subunit TOM5 homolog × 4 （Q8N4H5） Mitochondrial import receptor subunit TOM7 homolog × 4 （Q9P0U1） Mitochondrial import receptor subunit TOM6 homolog × 4 （Q96B49） Mitochondrial import receptor subunit TOM22 homolog × 4 （Q9NS69） PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 17	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.10 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9EIH	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9EII Import stalled PINK1 TOM complex, symmetry expanded Deposited 2024-11-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 13 PDB declaration: 13-meric	Chain B 1–581（581 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；Blot force 10 for 2 s.	Resolution 2.75 Å
9EIJ Import stalled PINK1 TOM complex, extended TOM20 helix class Deposited 2024-11-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: 15-meric	Chain B 1–581（581 aa）	Not recorded	PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；Blot force 10 for 2 s.	Resolution 3.30 Å
9KMR Human Hsp90-PINK1 complex Deposited 2024-11-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–581（581 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.98 Å
9KOX human Hsp90-FKBP51-PINK1 complex Deposited 2024-11-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 110–581（472 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.43 Å
9KQN Hsp90-Cdc37-PINK1 complex Deposited 2024-11-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 110–581（472 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.84 Å

5 other PDB entries and 5 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PINK1_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain A； PDBConstruct 1–581； UniProt 1–581 Author chain B； PDBConstruct 1–581； UniProt 1–581

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9eih
Deposition date deposition_date	2024-11-26
Structure title title	Import stalled PINK1 TOM complex
Keywords keywords	PINK1, TOM complex, VDAC, TRANSLOCASE; TRANSLOCASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	66.51 Å
Radius of gyration Rg (electron density) rg_electron	68.25 Å
Forward intensity I(0) i0	2167470000.00
Molecular weight molecular_weight	410800.0 kDa
Excluded volume excluded_volume	523030 Å³
Envelope volume envelope_volume	903170 Å³
Hydration-shell volume shell_volume	117710 Å³
Envelope diameter envelope_diameter	261.4 Å
Shell Rg shell_rg	61.62 Å
Envelope Rg envelope_rg	68.21 Å
Shape Rg shape_rg	68.27 Å
Total Rg total_rg	68.00 Å
Total atoms total_atoms	28887
Residues n_residues	3584
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	226.9 Å
Rg (real space) rg_real	67.14 Å
Rg uncertainty (real space) rg_real_error	1.97 Å
I(0) (real space) i0_real	2.1620e+09
I(0) uncertainty (real space) i0_real_error	4.9840e+07
Rg (reciprocal space) rg_reciprocal	65.52 Å
I(0) (reciprocal space) i0_reciprocal	2159000000.0000
Solution quality estimate total_estimate	0.8246
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	66.2 Å
Skewness Skewness skewness	0.668
Kurtosis Kurtosis kurtosis	0.021
Angular range angular_range	— – 0.1200 Å⁻¹
Current regularization parameter α current_alpha	0.0264
Highest regularization parameter α highest_alpha	227800000.0000
Real-space data points n_real_points	25
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.724; Stabil: 0.999; Sysdev: 1.000; Positv: 1.000; Valcen: 0.979; Smooth: 0.562

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	Mitochondrial import receptor subunit TOM20 homolog
Molecular weight formula_weight	16319.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D
Atom count atom_count	28887

MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE

Entity 2 Entity 2 polymer

Description description	Non-selective voltage-gated ion channel VDAC2
Molecular weight formula_weight	31600.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F

MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA

Entity 3 Entity 3 polymer

Description description	Mitochondrial import receptor subunit TOM40 homolog
Molecular weight formula_weight	37926.9 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H,I,J

MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG

Entity 4 Entity 4 polymer

Description description	Mitochondrial import receptor subunit TOM5 homolog
Molecular weight formula_weight	6045.3 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,L,Y,Z

MFRIEGLAPKLDPEEMKRKMREDVISSIRNFLIYVALLRVTPFILKKLDSI

Entity 5 Entity 5 polymer

Description description	Mitochondrial import receptor subunit TOM7 homolog
Molecular weight formula_weight	6256.5 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,N,W,X

MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG

Entity 6 Entity 6 polymer

Description description	Mitochondrial import receptor subunit TOM6 homolog
Molecular weight formula_weight	8008.0 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,P,U,V

MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAPQPGV

Entity 7 Entity 7 polymer

Description description	Mitochondrial import receptor subunit TOM22 homolog
Molecular weight formula_weight	15532.5 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q,R,S,T

MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI

Entity 8 Entity 8 polymer

Description description	Serine/threonine-protein kinase PINK1, mitochondrial
Molecular weight formula_weight	65561.6 kDa
EC 编号 ec_number	2.7.11.1
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B

MAVRQALGRGLQLGRALLLRFTGKPGRAYGLGRPGPAAGCVRGERPGWAAGPGAEPRRVGLGLPNRLRFFRQSVAGLAARLQRQFVVRAWGCAGPCGRAVFLAFGLGLGLIEEKQAESRRAVSACQEIQAIFTQKSKPGPDPLDTRRLQGFRLEEYLIGQSIGKGCSAAVYEATMPTLPQNLEVTKSTGLLPGRGPGTSAPGEGQERAPGAPAFPLAIKMMWNISAGSSSEAILNTMSQELVPASRVALAGEYGAVTYRKSKRGPKQLAPHPNIIRVLRAFTSSVPLLPGALVDYPDVLPSRLHPEGLGHGRTLFLVMKNYPCTLRQYLCVNTPSPRLAAMMLLQLLEGVDHLVQQGIAHRDLKSDNILVELDPDGCPWLVIADFGCCLADESIGLQLPFSSWYVDRGGNGCLMAPEVSTARPGPRAVIDYSKADAWAVGAIAYEIFGLVNPFYGQGKAHLESRSYQEAQLPALPESVPPDVRQLVRALLQREASKRPSARVAANVLHLSLWGEHILALKNLKLDKMVGWLLQQSAATLLANRLTEKCCVETKMKMLFLANLECETLCQAALLLCSWRAALDYKDHDGDYKDHDIDYKDDDDK

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 9 Entity 9 non-polymer

Description description	1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
Molecular weight formula_weight	790.1 kDa
Source method src_method	syn
Copy count entity_count	17

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.100 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	3.10 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	347000

fit	/app/data/saxs_computation/ei/9eih/9eih.fit
pddf	/app/data/pr_computation/ei/9eih/9eih.pr.out
profile	/app/data/saxs_computation/ei/9eih/9eih.dat

Import stalled PINK1 TOM complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mitochondrial import receptor subunit TOM20 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Non-selective voltage-gated ion channel VDAC2

State in the Current Structure

Other States of the Same Protein in the Database

Mitochondrial import receptor subunit TOM40 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Mitochondrial import receptor subunit TOM5 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Mitochondrial import receptor subunit TOM7 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Mitochondrial import receptor subunit TOM6 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Mitochondrial import receptor subunit TOM22 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Serine/threonine-protein kinase PINK1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

来源 Source

Entity 9 Entity 9 non-polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)