9eij

Import stalled PINK1 TOM complex, extended TOM20 helix class

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mitochondrial import receptor subunit TOM20 homolog

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Non-selective voltage-gated ion channel VDAC2 × 2 （P45880） Mitochondrial import receptor subunit TOM40 homolog × 2 （O96008） Mitochondrial import receptor subunit TOM5 homolog × 3 （Q8N4H5） Mitochondrial import receptor subunit TOM7 homolog × 2 （Q9P0U1） Mitochondrial import receptor subunit TOM6 homolog × 2 （Q96B49） Mitochondrial import receptor subunit TOM22 homolog × 2 （Q9NS69） Serine/threonine-protein kinase PINK1, mitochondrial × 1 （Q9BXM7） 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TOM20_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain D； PDBConstruct 1–145； UniProt 1–145

Non-selective voltage-gated ion channel VDAC2

OrganismNot specified

UniProt P45880

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Mitochondrial import receptor subunit TOM20 homolog × 1 （Q15388） Mitochondrial import receptor subunit TOM40 homolog × 2 （O96008） Mitochondrial import receptor subunit TOM5 homolog × 3 （Q8N4H5） Mitochondrial import receptor subunit TOM7 homolog × 2 （Q9P0U1） Mitochondrial import receptor subunit TOM6 homolog × 2 （Q96B49） Mitochondrial import receptor subunit TOM22 homolog × 2 （Q9NS69） Serine/threonine-protein kinase PINK1, mitochondrial × 1 （Q9BXM7） 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VDAC2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 1–294； UniProt 1–294 Author chain F； PDBConstruct 1–294； UniProt 1–294

Mitochondrial import receptor subunit TOM40 homolog

OrganismNot specified

UniProt O96008

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Mitochondrial import receptor subunit TOM20 homolog × 1 （Q15388） Non-selective voltage-gated ion channel VDAC2 × 2 （P45880） Mitochondrial import receptor subunit TOM5 homolog × 3 （Q8N4H5） Mitochondrial import receptor subunit TOM7 homolog × 2 （Q9P0U1） Mitochondrial import receptor subunit TOM6 homolog × 2 （Q96B49） Mitochondrial import receptor subunit TOM22 homolog × 2 （Q9NS69） Serine/threonine-protein kinase PINK1, mitochondrial × 1 （Q9BXM7） 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TOM40_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain I； PDBConstruct 1–361； UniProt 1–361 Author chain J； PDBConstruct 1–361； UniProt 1–361

Mitochondrial import receptor subunit TOM5 homolog

OrganismNot specified

UniProt Q8N4H5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Mitochondrial import receptor subunit TOM20 homolog × 1 （Q15388） Non-selective voltage-gated ion channel VDAC2 × 2 （P45880） Mitochondrial import receptor subunit TOM40 homolog × 2 （O96008） Mitochondrial import receptor subunit TOM7 homolog × 2 （Q9P0U1） Mitochondrial import receptor subunit TOM6 homolog × 2 （Q96B49） Mitochondrial import receptor subunit TOM22 homolog × 2 （Q9NS69） Serine/threonine-protein kinase PINK1, mitochondrial × 1 （Q9BXM7） 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TOM5_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain K； PDBConstruct 1–51； UniProt 1–51 Author chain L； PDBConstruct 1–51； UniProt 1–51 Author chain Z； PDBConstruct 1–51； UniProt 1–51

Mitochondrial import receptor subunit TOM7 homolog

OrganismNot specified

UniProt Q9P0U1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Mitochondrial import receptor subunit TOM20 homolog × 1 （Q15388） Non-selective voltage-gated ion channel VDAC2 × 2 （P45880） Mitochondrial import receptor subunit TOM40 homolog × 2 （O96008） Mitochondrial import receptor subunit TOM5 homolog × 3 （Q8N4H5） Mitochondrial import receptor subunit TOM6 homolog × 2 （Q96B49） Mitochondrial import receptor subunit TOM22 homolog × 2 （Q9NS69） Serine/threonine-protein kinase PINK1, mitochondrial × 1 （Q9BXM7） 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TOM7_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain N； PDBConstruct 1–55； UniProt 1–55 Author chain X； PDBConstruct 1–55； UniProt 1–55

Mitochondrial import receptor subunit TOM6 homolog

OrganismNot specified

UniProt Q96B49

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Mitochondrial import receptor subunit TOM20 homolog × 1 （Q15388） Non-selective voltage-gated ion channel VDAC2 × 2 （P45880） Mitochondrial import receptor subunit TOM40 homolog × 2 （O96008） Mitochondrial import receptor subunit TOM5 homolog × 3 （Q8N4H5） Mitochondrial import receptor subunit TOM7 homolog × 2 （Q9P0U1） Mitochondrial import receptor subunit TOM22 homolog × 2 （Q9NS69） Serine/threonine-protein kinase PINK1, mitochondrial × 1 （Q9BXM7） 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TOM6_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain P； PDBConstruct 1–74； UniProt 1–74 Author chain V； PDBConstruct 1–74； UniProt 1–74

Mitochondrial import receptor subunit TOM22 homolog

OrganismNot specified

UniProt Q9NS69

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Mitochondrial import receptor subunit TOM20 homolog × 1 （Q15388） Non-selective voltage-gated ion channel VDAC2 × 2 （P45880） Mitochondrial import receptor subunit TOM40 homolog × 2 （O96008） Mitochondrial import receptor subunit TOM5 homolog × 3 （Q8N4H5） Mitochondrial import receptor subunit TOM7 homolog × 2 （Q9P0U1） Mitochondrial import receptor subunit TOM6 homolog × 2 （Q96B49） Serine/threonine-protein kinase PINK1, mitochondrial × 1 （Q9BXM7） 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TOM22_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain R； PDBConstruct 1–142； UniProt 1–142 Author chain T； PDBConstruct 1–142； UniProt 1–142

Serine/threonine-protein kinase PINK1, mitochondrial

Homo sapiens

UniProt Q9BXM7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 15	Mitochondrial import receptor subunit TOM20 homolog × 1 （Q15388） Non-selective voltage-gated ion channel VDAC2 × 2 （P45880） Mitochondrial import receptor subunit TOM40 homolog × 2 （O96008） Mitochondrial import receptor subunit TOM5 homolog × 3 （Q8N4H5） Mitochondrial import receptor subunit TOM7 homolog × 2 （Q9P0U1） Mitochondrial import receptor subunit TOM6 homolog × 2 （Q96B49） Mitochondrial import receptor subunit TOM22 homolog × 2 （Q9NS69） 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PINK1_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain B； PDBConstruct 1–581； UniProt 1–581

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9eij
Deposition date deposition_date	2024-11-26
Structure title title	Import stalled PINK1 TOM complex, extended TOM20 helix class
Keywords keywords	PINK1, TOM complex, VDAC, TRANSLOCASE; TRANSLOCASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9eij__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9eij__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9eij__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	49.52 Å
Rg (electron density)	49.35 Å
Total Rg	49.41 Å
Atom count	16970
Residues	2121
Excluded volume	306730 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9eij__assembly_1__model_1`	15-meric （15）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	Mitochondrial import receptor subunit TOM20 homolog
Molecular weight formula_weight	16319.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D
Atom count atom_count	16970

MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE

Entity 2 Entity 2 polymer

Description description	Non-selective voltage-gated ion channel VDAC2
Molecular weight formula_weight	31600.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F

MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA

Entity 3 Entity 3 polymer

Description description	Mitochondrial import receptor subunit TOM40 homolog
Molecular weight formula_weight	37926.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J

MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG

Entity 4 Entity 4 polymer

Description description	Mitochondrial import receptor subunit TOM5 homolog
Molecular weight formula_weight	6045.3 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,L,Z

MFRIEGLAPKLDPEEMKRKMREDVISSIRNFLIYVALLRVTPFILKKLDSI

Entity 5 Entity 5 polymer

Description description	Mitochondrial import receptor subunit TOM7 homolog
Molecular weight formula_weight	6256.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N,X

MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG

Entity 6 Entity 6 polymer

Description description	Mitochondrial import receptor subunit TOM6 homolog
Molecular weight formula_weight	8008.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P,V

MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAPQPGV

Entity 7 Entity 7 polymer

Description description	Mitochondrial import receptor subunit TOM22 homolog
Molecular weight formula_weight	15532.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R,T

MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI

Entity 8 Entity 8 polymer

Description description	Serine/threonine-protein kinase PINK1, mitochondrial
Molecular weight formula_weight	65561.6 kDa
EC 编号 ec_number	2.7.11.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MAVRQALGRGLQLGRALLLRFTGKPGRAYGLGRPGPAAGCVRGERPGWAAGPGAEPRRVGLGLPNRLRFFRQSVAGLAARLQRQFVVRAWGCAGPCGRAVFLAFGLGLGLIEEKQAESRRAVSACQEIQAIFTQKSKPGPDPLDTRRLQGFRLEEYLIGQSIGKGCSAAVYEATMPTLPQNLEVTKSTGLLPGRGPGTSAPGEGQERAPGAPAFPLAIKMMWNISAGSSSEAILNTMSQELVPASRVALAGEYGAVTYRKSKRGPKQLAPHPNIIRVLRAFTSSVPLLPGALVDYPDVLPSRLHPEGLGHGRTLFLVMKNYPCTLRQYLCVNTPSPRLAAMMLLQLLEGVDHLVQQGIAHRDLKSDNILVELDPDGCPWLVIADFGCCLADESIGLQLPFSSWYVDRGGNGCLMAPEVSTARPGPRAVIDYSKADAWAVGAIAYEIFGLVNPFYGQGKAHLESRSYQEAQLPALPESVPPDVRQLVRALLQREASKRPSARVAANVLHLSLWGEHILALKNLKLDKMVGWLLQQSAATLLANRLTEKCCVETKMKMLFLANLECETLCQAALLLCSWRAALDYKDHDGDYKDHDIDYKDDDDK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 9 Entity 9 non-polymer

Description description	1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
Molecular weight formula_weight	790.1 kDa
Source method src_method	syn
Copy count entity_count	9

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.300 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	3.30 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	165000

Import stalled PINK1 TOM complex, extended TOM20 helix class

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mitochondrial import receptor subunit TOM20 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Non-selective voltage-gated ion channel VDAC2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial import receptor subunit TOM40 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial import receptor subunit TOM5 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial import receptor subunit TOM7 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial import receptor subunit TOM6 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial import receptor subunit TOM22 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Serine/threonine-protein kinase PINK1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9eij__assembly_1__model_1

9eij__assembly_1__model_1 | I(q)

9eij__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer