9hcc

Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Large ribosomal subunit protein uL2m

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM02_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–246； UniProt 61–306

Large ribosomal subunit protein uL3m

OrganismNot specified

UniProt Q99N95

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM03_MOUSE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–348； UniProt 1–348

Large ribosomal subunit protein uL4m

OrganismNot specified

UniProt Q9DCU6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM04_MOUSE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain F； PDBConstruct 1–294； UniProt 1–294

Large ribosomal subunit protein bL9m

OrganismNot specified

UniProt Q3UK02

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q3UK02_MOUSE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain H； PDBConstruct 1–268； UniProt 1–268

Large ribosomal subunit protein uL10m

OrganismNot specified

UniProt Q3TBW2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM10_MOUSE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain I； PDBConstruct 1–262； UniProt 1–262

Large ribosomal subunit protein uL11m

OrganismNot specified

UniProt Q9CQF0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM11_MOUSE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain J； PDBConstruct 1–192； UniProt 1–192

Large ribosomal subunit protein uL13m

OrganismNot specified

UniProt Q9D1P0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM13_MOUSE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain K； PDBConstruct 1–178； UniProt 1–178

Large ribosomal subunit protein uL14m

OrganismNot specified

UniProt Q9D1I6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM14_MOUSE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain L； PDBConstruct 1–145； UniProt 1–145

Large ribosomal subunit protein uL15m

OrganismNot specified

UniProt Q9CPR5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM15_MOUSE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain M； PDBConstruct 1–295； UniProt 1–295

Large ribosomal subunit protein bL17m

OrganismNot specified

UniProt Q9D8P4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM17_MOUSE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain O； PDBConstruct 1–176； UniProt 1–176

Large ribosomal subunit protein uL18m

OrganismNot specified

UniProt Q9CQL5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM18_MOUSE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain P； PDBConstruct 1–180； UniProt 1–180

Large ribosomal subunit protein bL19m

OrganismNot specified

UniProt Q9D338

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM19_MOUSE
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain Q； PDBConstruct 1–292； UniProt 1–292

Large ribosomal subunit protein bL20m

OrganismNot specified

UniProt Q9CQL4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM20_MOUSE
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain R； PDBConstruct 1–149； UniProt 1–149

Large ribosomal subunit protein bL21m

OrganismNot specified

UniProt Q9D1N9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM21_MOUSE
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain S； PDBConstruct 1–209； UniProt 1–209

Large ribosomal subunit protein uL22m

OrganismNot specified

UniProt Q8BU88

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM22_MOUSE
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain T； PDBConstruct 1–206； UniProt 1–206

Large ribosomal subunit protein uL23m

OrganismNot specified

UniProt O35972

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM23_MOUSE
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain U； PDBConstruct 1–146； UniProt 1–146

Large ribosomal subunit protein uL24m

OrganismNot specified

UniProt Q9CQ06

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM24_MOUSE
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain V； PDBConstruct 1–216； UniProt 1–216

Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m

OrganismNot specified

UniProt Q9D1B9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM28_MOUSE
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain X； PDBConstruct 1–257； UniProt 1–257

Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m

OrganismNot specified

UniProt Q9DCI9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM32_MOUSE
Isoform	—
PDB entities	20, 23
Chains and sequence ranges	Author chain X； PDBConstruct 258–294； UniProt 151–187 Author chain 0； PDBConstruct 1–187； UniProt 1–187

Large ribosomal subunit protein uL29m

OrganismNot specified

UniProt Q8K2Y7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM47_MOUSE
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain Y； PDBConstruct 1–252； UniProt 1–252

Large ribosomal subunit protein uL30m

OrganismNot specified

UniProt Q9D7N6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM30_MOUSE
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain Z； PDBConstruct 1–160； UniProt 1–160

Large ribosomal subunit protein mL37

OrganismNot specified

UniProt Q921S7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM37_MOUSE
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain 5； PDBConstruct 1–423； UniProt 1–423

Large ribosomal subunit protein mL38

OrganismNot specified

UniProt Q8K2M0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM38_MOUSE
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain 6； PDBConstruct 1–380； UniProt 1–380

Large ribosomal subunit protein mL39

OrganismNot specified

UniProt Q9JKF7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM39_MOUSE
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain 7； PDBConstruct 1–336； UniProt 1–336

Large ribosomal subunit protein mL40

OrganismNot specified

UniProt Q9Z2Q5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM40_MOUSE
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain 8； PDBConstruct 1–206； UniProt 1–206

Large ribosomal subunit protein mL41

OrganismNot specified

UniProt Q9CQN7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM41_MOUSE
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain 9； PDBConstruct 1–135； UniProt 1–135

Large ribosomal subunit protein mL42

OrganismNot specified

UniProt Q9CPV3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM42_MOUSE
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain a； PDBConstruct 1–142； UniProt 1–142

Large ribosomal subunit protein mL43

OrganismNot specified

UniProt Q5RL20

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q5RL20_MOUSE
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain b； PDBConstruct 1–159； UniProt 1–159

Large ribosomal subunit protein mL44

OrganismNot specified

UniProt Q9CY73

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM44_MOUSE
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain c； PDBConstruct 1–308； UniProt 26–333

Large ribosomal subunit protein mL45

OrganismNot specified

UniProt Q9D0Q7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM45_MOUSE
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain d； PDBConstruct 1–306； UniProt 1–306

Large ribosomal subunit protein mL46

OrganismNot specified

UniProt Q9EQI8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM46_MOUSE
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain e； PDBConstruct 1–283； UniProt 1–283

Large ribosomal subunit protein mL48

OrganismNot specified

UniProt Q8JZS9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM48_MOUSE
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain f； PDBConstruct 1–211； UniProt 1–211

Large ribosomal subunit protein mL49

OrganismNot specified

UniProt Q9CQ40

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM49_MOUSE
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain g； PDBConstruct 1–166； UniProt 1–166

Large ribosomal subunit protein mL50

OrganismNot specified

UniProt Q8VDT9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM50_MOUSE
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain h； PDBConstruct 1–159； UniProt 1–159

Large ribosomal subunit protein mL51

OrganismNot specified

UniProt Q9CPY1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM51_MOUSE
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain i； PDBConstruct 1–128； UniProt 1–128

Large ribosomal subunit protein mL52

OrganismNot specified

UniProt Q9D0Y8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM52_MOUSE
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain j； PDBConstruct 1–121； UniProt 1–121

Large ribosomal subunit protein mL53

OrganismNot specified

UniProt Q9D1H8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM53_MOUSE
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain k； PDBConstruct 1–118； UniProt 1–118

Large ribosomal subunit protein mL54

OrganismNot specified

UniProt Q9CPW3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM54_MOUSE
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain l； PDBConstruct 1–135； UniProt 1–135

Large ribosomal subunit protein mL63

OrganismNot specified

UniProt Q9CQF8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RT63_MOUSE
Isoform	—
PDB entities	41
Chains and sequence ranges	Author chain o； PDBConstruct 1–102； UniProt 1–102

Large ribosomal subunit protein mL62

OrganismNot specified

UniProt Q8R035

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ICT1_MOUSE
Isoform	—
PDB entities	42
Chains and sequence ranges	Author chain p； PDBConstruct 1–206； UniProt 1–206

Large ribosomal subunit protein mL64

OrganismNot specified

UniProt Q9CR59

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G45IP_MOUSE
Isoform	—
PDB entities	43
Chains and sequence ranges	Author chain q； PDBConstruct 1–222； UniProt 1–222

Large ribosomal subunit protein mL66

OrganismNot specified

UniProt Q99N85

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RT18A_MOUSE
Isoform	—
PDB entities	44
Chains and sequence ranges	Author chain r； PDBConstruct 1–196； UniProt 1–196

Large ribosomal subunit protein mL65

OrganismNot specified

UniProt Q9D0G0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RT30_MOUSE
Isoform	—
PDB entities	45
Chains and sequence ranges	Author chain s； PDBConstruct 1–442； UniProt 1–442

Mitochondrial assembly of ribosomal large subunit protein 1

OrganismNot specified

UniProt Q9CWV0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MASU1_MOUSE
Isoform	—
PDB entities	46
Chains and sequence ranges	Author chain u； PDBConstruct 1–228； UniProt 1–228

Predicted gene, 55359

OrganismNot specified

UniProt A0A2I3BQS8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2I3BQS8_MOUSE
Isoform	—
PDB entities	47
Chains and sequence ranges	Author chain v； PDBConstruct 1–70； UniProt 1–70

Acyl carrier protein, mitochondrial

OrganismNot specified

UniProt Q9CR21

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACPM_MOUSE
Isoform	—
PDB entities	48
Chains and sequence ranges	Author chain w； PDBConstruct 1–156； UniProt 1–156

rRNA methyltransferase 3, mitochondrial

OrganismNot specified

UniProt Q5ND52

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Probable ATP-dependent RNA helicase DDX28 × 1 （Q9CWT6） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MRM3_MOUSE
Isoform	—
PDB entities	49
Chains and sequence ranges	Author chain x； PDBConstruct 1–418； UniProt 1–418 Author chain y； PDBConstruct 1–418； UniProt 1–418

Probable ATP-dependent RNA helicase DDX28

OrganismNot specified

UniProt Q9CWT6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 49 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q3UK02） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） rRNA methyltransferase 3, mitochondrial × 2 （Q5ND52） ZINC ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DDX28_MOUSE
Isoform	—
PDB entities	50
Chains and sequence ranges	Author chain z； PDBConstruct 1–540； UniProt 1–540

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9hcc
Deposition date deposition_date	2024-11-08
Structure title title	Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out)
Keywords keywords	mitochondria, ribosome, large subunit, assembly intermediate; RIBOSOME
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9hcc__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9hcc__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9hcc__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	81.78 Å
Rg (electron density)	84.45 Å
Total Rg	84.11 Å
Atom count	174926
Residues	9559
Excluded volume	1573000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9hcc__assembly_1__model_1`	51-meric （51）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (52)

Entity 1 Entity 1 polymer

Description description	16S rRNA (1584-MER)
Molecular weight formula_weight	508601.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	A
Atom count atom_count	174926

AACUAAUCCUAGCCCUAGCCCUACACAAAUAUAAUUAUACUAUUAUAUAAAUCAAAACAUUUAUCCUACUAAAAGUAUUGGAGAAAGAAAUUCGUACAUCUAGGAGCUAUAGAACUAGUACCGCAAGGGAAAGAUGAAAGACUAAUUAAAAGUAAGAACAAGCAAAGAUUAAACCUUGUACCUUUUGCAUAAUGAACUAACUAGAAAACUUCUAACUAAAAGAAUUACAGCUAGAAACCCCGAAACCAAACGAGCUACCUAAAAACAAUUUUAUGAAUCAACUCGUCUAUGUGGCAAAAUAGUGAGAAGAUUUUUAGGUAGAGGUGAAAAGCCUAACGAGCUUGGUGAUAGCUGGUUACCCAAAAAAUGAAUUUAAGUUCAAUUUUAAACUUGCUAAAAAAACAACAAAAUCAAAAAGUAAGUUUAGAUUAUAGCCAAAAGAGGGACAGCUCUUCUGGAACGGAAAAAACCUUUAAUAGUGAAUAAUUAACAAAACAGCUUUUAACCAUUGUAGGCCUAAAAGCAGCCACCAAUAAAGAAAGCGUUCAAGCUCAACAUAAAAUUUCAAUUAAUUCCAUAAUUUACACCAACUUCCUAAACUUAAAAUUGGGUUAAUCUAUAACUUUAUAGAUGCAACACUGUUAGUAUGAGUAACAAGAAUUCCAAUUCUCCAGGCAUACGCGUAUAACAACUCGGAUAACCAUUGUUAGUUAAUCAGACUAUAGGCAAUAAUCACACUAUAAAUAAUCCACCUAUAACUUCUCUGUUAACCCAACACCGGAAUGCCUAAAGGAAAGAUCCAAAAAGAUAAAAGGAACUCGGCAAACAAGAACCCCGCCUGUUUACCAAAAACAUCACCUCUAGCAUUACAAGUAUUAGAGGCACUGCCUGCCCAGUGACUAAAGUUUAACGGCCGCGGUAUCCUGACCGUGCAAAGGUAGCAUAAUCACUUGUUCCUUAAUUAGGGACUAGCAUGAACGGCUAAACGAGGGUCCAACUGUCUCUUAUCUUUAAUCAGUGAAAUUGACCUUUCAGUGAAGAGGCUGAAAUAUAAUAAUAAGACGAGAAGACCCUAUGGAGCUUAAAUUAUAUAACUUAUCUAUUUAAUUUAUUAAACCUAAUGGCCCAAAAACUAUAGUAUAAGUUUGAAAUUUCGGUUGGGGUGACCUCGGAGAAUAAAAAAUCCUCCGAAUGAUUAUAACCUAGACUUACAAGUCAAAGUAAAAUCAACAUAUCUUAUUGACCCAGAUAUAUUUUGAUCAACGGACCAAGUUACCCUAGGGAUAACAGCGCAAUCCUAUUUAAGAGUUCAUAUCGACAAUUAGGGUUUACGACCUCGAUGUUGGAUCAGGACAUCCCAAUGGUGUAGAAGCUAUUAAUGGUUCGUUUGUUCAACGAUUAAAGUCCUACGUGAUCUGAGUUCAGACCGGAGCAAUCCAGGUCGGUUUCUAUCUAUUUACGAUUUCUCCCAGUACGAAAGGACAAGAGAAAUAGAGCCACCUUACAAAUAAGCGCUCUCAACUUAAUUUAUGAAUAAAAUCUAAAUAAAAUAUAUACGUACACCCUCUAACCUAGAGAAGGUUA

Entity 2 Entity 2 polymer

Description description	tRNA-Phe (68-MER)
Molecular weight formula_weight	21862.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	B

GUUAAUGUAGCUUAAUAACAAAGCAAAGCACUGAAAAUGCUUAGAUGGAUAAUUGUAUCCCAUAAACA

Entity 3 Entity 3 polymer

Description description	Large ribosomal subunit protein uL2m
Molecular weight formula_weight	27168.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

AKFVSWKSRTKYTVKPVKMRKSGGRDHTGRIRVHGIGGGHKQNYRMIDFLRFRPEKEKAPEPFEEKVVVVRYDPCRSADIALVAGGSRKRWIIATENMKAGDTILNSNHIGRMAVAAQEGDAHPLGALPVGTLINNVESEPGRGAQYIRAAGTCGVLLRKVNGTAIIQLPSKRQMQVLESCTATVGRVSNVNHNQRVIGKAGRNRWLGKRPNSGLWQRKGGWAGRKIRPLPPMKSYVKLPSAAAQN

Entity 4 Entity 4 polymer

Description description	Large ribosomal subunit protein uL3m
Molecular weight formula_weight	39170.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MPGWRLLAQAGARVLGCGARGLGADPGLERRKNILFFVRNLHSKSSTWWDEHLSEENLSFVKQLVSDENKTQLTSKLNPLKDEPWPLHPWEPGSFRVGLIALKLGMMPLWTKDGQKHAVTLLQVQDCHVLKYTPKEDHNGKIAALTVGGKTVSRFYKPDSRLEFYRDLGLPPKQIHKIFHVTDNAVIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMKRWGFKGQPASHGQTKTHRRPGAISTGDIARVWPGTKMPGRMGNQNRTVYGLKVWRVNTKHNIIYVNGSVPGHKNCLVKIKDSTLPAYKDSCKNLPFPTYFPDGDEEELPEDLFDESVWQPSEPSITFA

Entity 5 Entity 5 polymer

Description description	Large ribosomal subunit protein uL4m
Molecular weight formula_weight	33120.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MLRLFQAASRASLRLSGSRVIHSLAEGAERPAEISEPRDSAGLLDPVLRKCELRIPVHRRPVQAWVESLRGFEQERIGLAELHPDVFATAPRLDIVHQVAIWQRNFRRISYANTKTRAEVSGGGRKPWQQKGSGRARHGSIRSPLWRGGGVAHGPRGPTSYYYMLPMKVRALGLKVALTVKLMQDDLHIVDSLELPTADPQYLTELAQYRHWGSSVLLVDLTHEEMPKNVVAATSGLNSFNLIPAVGLNVYSMLKHQTLVLTLPSVAFLEDKLLWQDSRYTPLYPFRLPYSDFP

Entity 6 Entity 6 polymer

Description description	Large ribosomal subunit protein bL9m
Molecular weight formula_weight	30896.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MAASVAPGVRTLWWAGAAWLRQGGIRELFRPRIEGSTPGRDFSLSHYQSTVIVERWWKVPLAGEGRKPHLHRRHRVYKLVEDTKHRPKDNLELILTQSVDEIGVRGDLVSVKKSVGRNKLLSQGLAVYASPENRKLFEEEKSLRREGKLEKIQTKAGEATVKFLRSCHLEVGMKNNVKWELNPEIVARHFFKNLGVVVAPHALRLPEEPITRWGEYWCDVTTRGHQGIRNRTITRLKMEANMEADRKKILILCGFQQPQVAKTFTRLE

Entity 7 Entity 7 polymer

Description description	Large ribosomal subunit protein uL10m
Molecular weight formula_weight	29438.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MAAAVAGILRGGLPPRAAWLPTLQTVRHGSKAVTRHWRVMHFQRQKLMAITEYIPPKPAINPRCLPPPPKPPKEESGLVRLLRQDIVAVFRDNRMIAVCQNVALSAEDKLLLRHQLRKHKIFIKVFPSQVLKPFLENSKYRNLLPLFVGHNLLLVSEEPKVKEMVRVLKSVPFLPLLGGCVDDTILSRQGLVDYAKLPSLDQLQGQLVGGLTHLMAQTRYLLQHQPVQLTSLLDQYVKEQNEGDCATSANEKLHPPDPAPDA

Entity 8 Entity 8 polymer

Description description	Large ribosomal subunit protein uL11m
Molecular weight formula_weight	20714.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MSKLSRATRTLKKPEAGGVIRSIVRAGQAIPGPPLGPILGQRGVSINQFCKEFNEKTKDIKEGIPLPTKIFIKPDRTFELKIGQPTVSYFLKAAAGIEKGARHTGKEVAGLVSLKHVYEIACVKAKDDAFAMQDVPLSSVVRSIIGSARSLGIRVVKDLSAEELEAFQKERAVFLAAQKEADLAAQAEAAKK

Entity 9 Entity 9 polymer

Description description	Large ribosomal subunit protein uL13m
Molecular weight formula_weight	20707.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MSSFSRAPQQWATFARMWYLLDGKMQPPGKLAVIASNKLQGLNKPVYHQLSDCGDHVVIINTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHRKDPVAIVKLAIYGMLPKNLHRRTMMQRLHLFPDEDIPEDILKNLVEELPQPRRVPKRLDEYTQEEIEAFPRVWTPPDDFRM

Entity 10 Entity 10 polymer

Description description	Large ribosomal subunit protein uL14m
Molecular weight formula_weight	15900.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MAALTGLWGSFAHVSRAFSQRCFSTSGSLSAVQKMTRVRVVDNSALGSTPYHRPPRCIHVYNKSGVGKVGDQILLAIRGQKKKALIVGHRMPGSRMTPKFDSNNVVLIEDNGNPVGTRIKIPIPTSLRRREGEYSKVLAIAQNFV

Entity 11 Entity 11 polymer

Description description	Large ribosomal subunit protein uL15m
Molecular weight formula_weight	33595.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MAGTARGCGTSLDLLRSLPRVSLANLKPSPNSRKRERRPRDRRRGRKCGRGHKGERQRGTRPRLGFEGGQTPFYIRIPKYGFNEGHSFRHQYQPLSLRRLQYLIDLGRVDPTQPIDLTQLVNGRGVTIQPLKRDYGVQLVEEGADTFQAKINIEVQLASELAIAAIEKNGGVVTTAFYDPRSLEILCKPIPFFLRGQPIPKRMLPPESLVPYYTDAKNRGYLADPAKFPEARLELAMKFGYVLPDITKDELFRMLSARKDPRQIFFGLAPGWVVNMADKKILKPTDENLLKYYSS

Entity 12 Entity 12 polymer

Description description	Large ribosomal subunit protein bL17m
Molecular weight formula_weight	20282.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MRLSLAAAISHGRVYRRLGLGPESRIHLLRNLLTGLVRHERIEATWARADEMRGYAEKLIDYGKLGDTNERAMRMADFWLTEKDLIPKLFKVLAPRFQGQNGNYTRMLQIPNRKEQDRAKMAVIEYKGNYLPPLPLPHRDSNLTLLNQLLLGLQQDLHHNQDASLHSSCTVQTPKT

Entity 13 Entity 13 polymer

Description description	Large ribosomal subunit protein uL18m
Molecular weight formula_weight	20707.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MALRPRFWKCLSVCRKLECGFAALSTSSVPAVQPDVESKENEAVAPEFTNRNPRNLELLGVARKERGWATVWPNREFWHRLRVVKTQHHVEAFVEHLNGQVVVSASTREWAIKKHLYSTRNVVACESIGRVLAQRCLEAGINFMVYQPTPWEASSDSIKRLQNAMTESGVMLREPRRIYE

Entity 14 Entity 14 polymer

Description description	Large ribosomal subunit protein bL19m
Molecular weight formula_weight	33629.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MAASMAESCRASLYLARSVRMARPRLAAFASDACRVCTGPSRFQSTGPSEPGGFKPPPKPVIVDRRRVPEDERRFLSPEFIPPRGRTNPLKFKIERKDMLDRRKVLPIPEFYVGSILRVTTADPYASGKTSQFLGICIKRSGNGLGATFTLRNTIEGQGVEICFELYNPRIQEIQVVKLEKRLDDNLLYLRDALPEYSTFDVNMKPVPQEACQEVPVNKLKVKMKPKPWSKRWERPNFNIKGIRFDLALTEEQMKEAQKWNKPWIEFDMMREYDTSKIEAALWEEIEASKKS

Entity 15 Entity 15 polymer

Description description	Large ribosomal subunit protein bL20m
Molecular weight formula_weight	17631.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MVFLTTRLWLRNRLTDRYWRVQEVLKHAQHFRGRKNRCYRLAVRAVTRAFVKCTKARRLKKRNLRTLWINRITAASQEHGLKYPAFIVNLIKCQVELNRKVLVDLAIYEPKTFKSLAALAKRRQQEGFAAALGDGKEPEGIFSRVVQYH

Entity 16 Entity 16 polymer

Description description	Large ribosomal subunit protein bL21m
Molecular weight formula_weight	23401.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MAAAIAASALPGAFGRLVSVCSRSILASQGSGSASLWSASRRFNSQSASYPQGYVPKTSLSSPPWQEVVLPDPVEETRHHAEVVKRVNELIATGQYGRLFAVVHFASHQWKVTAEDLILIENELDIKCGERIRLEKVLLVGADNFTLLGKPLLRKELVRVEATVIEKTESWPKINMKFRKRKNFRKKKIIVNPQTILRINTIEIAPRLL

Entity 17 Entity 17 polymer

Description description	Large ribosomal subunit protein uL22m
Molecular weight formula_weight	23847.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MAAALLRELGALRVPNLRIWATQTLRVLPPSCIHTSASLDISRKWEKKNKIVYPPQLPGEPRRPAEIYHCRRQIKYSKDKMWYLAKMIRGMSIDQALAQLEFNDKKGAQIIKEVLLEAQDMAVRDHNVEFRSNLHIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPPEVPKTAVDHAKDYIQQLRSRTIIHTL

Entity 18 Entity 18 polymer

Description description	Large ribosomal subunit protein uL23m
Molecular weight formula_weight	17145.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MARNVLYPLYQLGGPQLRVFRTNFFIQLVRPGTAQPEDTVQFRIPMEMTRVDLRNYLEQIYNVPVAAVRTRVQHGSNRRRDHKNVRIKKPDYKVAYVQLAHGQTFTFPDLFPEKDPRSPEPLEEELPQQRQSSDLRCPGIPSWFGL

Entity 19 Entity 19 polymer

Description description	Large ribosomal subunit protein uL24m
Molecular weight formula_weight	24986.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MRLSALLALASKATSSPFYRYGMSRPGSIADKRKNPPWSRRRPVVVEPISDEDWHLFCGDMVEILEGKDAGKQGKVVQVVRQRNWVVLEGLNTHYRYIGRTKDHRGTMIASEAPLLHHQVKLVDPVDRKPTEIQWRFTEAGERVRVSTRSGRIIPKPEFPRADGIVPETWTDGPKDTSVEDALERTYVPRLKTLEEDVMEAMGIQETRRFKKVYWY

Entity 20 Entity 20 polymer

Description description	Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m
Molecular weight formula_weight	34560.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MPLHRYPVHLWQKLRLRQGICARLPAHFLRSLEEERTPTPVHYKPHGTKFKINPKNGQRERVEDVPIPVHYPPESQQGLWGGEGLILGYRYANNDKLSKRVKKVWKPQLFTRELYSEILDKKFTVTVTMRTLDLIDEAYGFDFYILKTPKEDLGSKFGMDLKRGMLLRLARQDPHLHPENPERRAAIYDKYRSFVIPEAEAEWVGLTLEEALEKQRLLEEKDPVPLFKVYVEELVQRLQEQVLSRPAVVQKRAGDHAPSVETMVLYTGEKPSEKDQGKRIVERNIKRPSWFTQN

Entity 21 Entity 21 polymer

Description description	Large ribosomal subunit protein uL29m
Molecular weight formula_weight	29786.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MAATSLVGICRRASAFLKAACSLVNPKDAAHSGCRSSLSLLHKNTPHVTSFLQCKLLHTTLSRKGLEEFFDDPKNWGEEKVKSGASWTCQQLRNKSNEDLHKLWYVLLKERNMLLTLEQEAKRQRLPMPSPERLEKVVDSMDNVDKVVQEREDALRLLQTGQEKPRPGAWRRDIFGRIVWHKFKQWPIPWYLNKRYNRRRFFAMPYVDRFIRLRIEKHARIEARKRSLQKKKEKILHAKFPHLSQERKSSSV

Entity 22 Entity 22 polymer

Description description	Large ribosomal subunit protein uL30m
Molecular weight formula_weight	18380.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MAGVLRSAFPRPPCRLQTVKKGAESLIGTEWIRHKFTKSRIPDKVFQPKPEDHEKYGGDPQNPHKLHIVTRIRSTKRRPYWEKDTIKMLGLQKAHSPQIHKNIPSVNAKLKVVKHLIRIQPLKLPQGLPTEETMSSTCLKSTGELVVQWHLKPVEQEAKS

Entity 23 Entity 23 polymer

Description description	Large ribosomal subunit protein bL32m
Molecular weight formula_weight	21766.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0

MAPSLLLLSLPWPVRPGPLQRCWELLQRQLQQSWSRFVSPPWAPALAVQRPSILTELAHDTCENKENSSFLDSIFWMAAPKNRRTIEVNRCRRRNPQKLIKIKNNIDICPECGHLKQKHVLCGYCYEKVRQETTKIRQQIGAQEGGPFRAPSVETMVLYTGEKPSEKDQGKRIVERNIKRPSWFTQN

Entity 24 Entity 24 polymer

Description description	Large ribosomal subunit protein mL37
Molecular weight formula_weight	48407.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

MALASGPALRALAGSGRLGLGGYGTPKRGAYEWGVRSTRKPEPRPLDRVYEIPGLEPITYEGKKHFVPWLARPIFPPWERGWNDPRFHRAAPIHEQTLYKEEPCYIFHQRCRLLEGMKQALWLTKTKLIEGLPKKVLSLVDDPANHIENQEQRVLDIISHARLWHSTEDIPKRETYCPLIVDSLIQLCKSQILKHPSLARRTSAQNCTLATTWNRESLLLQVRGTSSTILSAKDPLPVIASREEVEATRSHVLETFYPISPTIDLQECHVYEVKDDTGFQEGYPYPHPHTLYFLEKANLRPQRFLPEQLRAKMLLFAFANALAQARLLYGNTAKVLEQPIVVQSVGTDGRVFQFLVLQLNTTDLASSEGVKNLVWTDSDQLLYRHFWCRPVIKKKVVVEPVGPVDFQPETFRKFLALYLHGVV

Entity 25 Entity 25 polymer

Description description	Large ribosomal subunit protein mL38
Molecular weight formula_weight	45099.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MAAPWWRAAFFGIGRCRGFSTSAFLSRRTPPLGPMPNEDIDVSNLERLEKYRSFERYRRRAEQEARAPHWWRTYREHFVKETDPKDKIDIGLPPPRVSRTQKLLERKHFLRELRANVEEERAARLRTASIPLEAVRAEWERTCGPYHKQRLAEYYGLYRDLFHGATFVPWVPLHVAYAVGEEDLIPVYHGNEVTPTEASRAPEVTYEADKDSLWTLLFINLDGHLLEPDAEYVHWLLTNIPSNRVAEGQETCPYLPPFPARGSGFHRFAFLLFKQDKPINFSEDTRPSPCYQLAQRTFRTFDFYKRHQEAMTPAGLAFFQCRWDDSVTHTFHQLLDMREPVFEFVRPPPYHPKQKRFPHEQPLRYLDRYRDSHEPTYGIY

Entity 26 Entity 26 polymer

Description description	Large ribosomal subunit protein mL39
Molecular weight formula_weight	38603.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

MATAVGRLVLRRPGAGGGARWRFIATSPAAELSPTELTEMRNDLFNREKSRQLSLTPRTEKIEVKHVGKTDPGTVFVMNKNISTPYSCAMHLSEWYCSKSILALVDGQPWDMYKPLTKSCEIKFLTFKDPDPKEVNKAYWRSCAMMLGCVIERAFKDDYVVSLVRAPEVPVIAGAFCYDVTLDKRLDEWMPTKENLRSFTKDAHALIYRDLPFETLDVDARVALEIFQHNKYKVDFIEEKASQNPERIVKLHRIGDFIDVSEGPLIPRTSVCFQYEVSAVHNLNPSQPNLIRRFQGLSLPTHLRAQFTIWDKLVERSRKMVTEDEVRQTENTESTQ

Entity 27 Entity 27 polymer

Description description	Large ribosomal subunit protein mL40
Molecular weight formula_weight	24347.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

MATGVMLCAARALRPRSWIPGTCQAHVRHTHQRASLLAFWDLIPMRAEPLRKKKKVDPRKDQAAKDRLKKRIRKLEKASQELIPIEDFITPVRFLDKSRQRPQEEHSPEESERRALLLKRWALFKQQEHEMERDAIRSMLEAQQEALEELKLESAELYAEAIKRDTSLFPFEKEGPHYTPPISNYQAPEGRYNDITKVYTQVEFKR

Entity 28 Entity 28 polymer

Description description	Large ribosomal subunit protein mL41
Molecular weight formula_weight	15284.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	9

MGFLTAVTQGLVRGADRMSKWTSKRGPRTFTKSRGAKKTGIYTSDRKFVQIKEMVPEFVVPDLTGFKLKPYVNYRAPAGIDTPLTAKALFQETVAPAIEKDFKEGTFDANNLEKYGFEPTQEGKLFQLYPKNFPR

Entity 29 Entity 29 polymer

Description description	Large ribosomal subunit protein mL42
Molecular weight formula_weight	16521.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MAAAVKWAISNRTIWKHLLPIQNGALSSACHKSTYSSLPDDYNCQVDLALTADGRTIVCYHPSVDIPYEHTKPIPQPDLLHNNEETHEQILKAKLEVRKSKQLEQGPMIEQLSKVFYTTKHRWYPHGQYHNRRKKLNPPRDR

Entity 30 Entity 30 polymer

Description description	Large ribosomal subunit protein mL43
Molecular weight formula_weight	17905.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MTGRGTSSRFLTSVLHNGLGRYVQQLQRLSLSLSRDAPSSRGAREFVEREVTDFARRNPGVVVYVNPRPCAMPRIVAEYLNGAVREENVNSKSVEEIKSLVQKLADQSGLDVIRIRKPFHTDNPSIQGQWHPFTNKRTALHGLRPRELRDSAPASMQAQ

Entity 31 Entity 31 polymer

Description description	Large ribosomal subunit protein mL44
Molecular weight formula_weight	34912.0 kDa
EC 编号 ec_number	3.1.26.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

PPVRGVKKGFRAAFRFQKELERWRLLRCPPPPVRRSEKPNWDYHAEVQAFGSRLQETFSLDLLKTAFINSCYIKSEEAKRQSLGIEKEAALLNLKDNQELFEQGLSFSHRCLTQFLEDEFPDLPAEGTESLVSFLTGEAVVCHVARNLAVEQLTLSAEFPVPLPVLRQTFFAVIGALLQSSGPERAALFIRDFLITQMTGKELFEMWTVVNPMGLLVEELKKRNISAPESRLTRQSGSTTALPLYFVGLYCDRKLIAEGPGETVLVAEEEAARVALRKLYGFTENRRPWDYSKPKESPKRAEQTSVAS

Entity 32 Entity 32 polymer

Description description	Large ribosomal subunit protein mL45
Molecular weight formula_weight	35463.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MAAPVPRGLSSLYRTLGWWSRQPILVTQSTTVVQVKTKSRFRPPTPEPKYKTEKEFLEYARKAGLVIPQERLERPIHLACTAGIFDPYVPPEGDARMSSLSKEGLTQRTERLRKNAASQLAIRKIREFDANFKTKDFPEKAKDIFIEAHLCLNNSDHDRLHTLVTEHCFPDMVWDLKYKTVRWGFVESLEPAQVVHVRCSGLVNQSNMYGQVTVRLHTRQTLAIYDRFGRLMYGQEDVPKDVLEYVVFERHLMNPYGSWRMHAKIVPAWAPPKQPILKTLMIPGPQLKPWEEYEETQGEAQKPQLA

Entity 33 Entity 33 polymer

Description description	Large ribosomal subunit protein mL46
Molecular weight formula_weight	32175.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

MAAPVGRTLLGLARGWRQLDRFWAGSSRGLSLEAASSSSRSPWRLSGALCLQRPPLITKALTPLQEEMAGLLQQIEVERSLYSDHELRALDEAQRLAKKKADLYDEEQEQGITLAQDLEDMWEQAFLQFRPGARETEADKKNDRTSLHRKLDRNLVLLVREKLGDQDVWMLPQVEWQPGETLRGTAERILATLSENNMEAKFLGNAPCGHYKFKFPKAIQTESDLGVKVFFFKALLLTGDFVQAGKKSRHVWASKEELGDYLQPKYLAQVRRFLLDSDGLSCL

Entity 34 Entity 34 polymer

Description description	Large ribosomal subunit protein mL48
Molecular weight formula_weight	23989.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

MSGTLGKVLGVWTNTVSKQGFSLLRFRSLGENPIFSAGGILWTSRHYKTKPTHGIGRYRHLVKVQEPKKKKAKVELRAINVGTDYEYGVLNIHLTAYDMSLAESYAQYVHRLCNRLSIKVEESYAMPTKTMEVMRLPDQGNKMVLDSVLTTHERVVQISGLSATFAEIFLEVLQSNLPEGVRLSVREHTEEDFKGRFKARPELEELLAKLN

Entity 35 Entity 35 polymer

Description description	Large ribosomal subunit protein mL49
Molecular weight formula_weight	19161.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

MAAAVLRAALQDWRSCLGRSYGRRKLSQTQGPPDNPGFVESVDEYQFVERLLPPTKIPEPPKHKHYPTPSGWQPPRDPLPSLPYFVRRSRMHNIPVYKEITHGNRQMTLIRKVEGDIWALQKDVEEFLSPLLGKTPITQVNEVTGTLRIKGYFDEQLKAWLLEKGF

Entity 36 Entity 36 polymer

Description description	Large ribosomal subunit protein mL50
Molecular weight formula_weight	18241.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

MAALIVSRLARRGWLWKLPLATRREFWSRSRKEKEPVVAETVEEVKKEPVLVCPPLRSRAYTPPSDLQSRLESHIKEVLGSSLPNNWQDISLDDGHMKFRLLAGLADGLGHAVPNSRLHQMCRVRDVLDFYNVPVQDKSKFDELVASNLPPNLKISWSY

Entity 37 Entity 37 polymer

Description description	Large ribosomal subunit protein mL51
Molecular weight formula_weight	15132.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

MAGSVPWAASRRLWGWVPSACRSFSLGVPRLAFVRLTLPPPKVVDRWNEKRALFGVYDNIGILGNFEKHPKELIKGPVWLRGWRGNELQRCVRKKKFVGNRMFIEDLHNLNKRISYLYKHFNRHGKYR

Entity 38 Entity 38 polymer

Description description	Large ribosomal subunit protein mL52
Molecular weight formula_weight	13681.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

MAALGTWLSSVRRLHCSVVARAGGQWRLQQGLAANPSGYGPLTELPDWSFADGRPAPPMKGQLRRKAQREKLARRVVLLTQEMDAGIQAWKLRQQKLQEERKKEHDLKPKGTLLRSPLPNQ

Entity 39 Entity 39 polymer

Description description	Large ribosomal subunit protein mL53
Molecular weight formula_weight	12756.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

MAAALARLGLRPVKLVRVQFCPFEKNVESTRTFLQTVSSEKVRATNLNCSVIADVRHDGSEPCVDVLFGDGYRLIMRGAHLTTQEMLSALASHIRDRNAAAASAPGADKVAPGTSTRR

Entity 40 Entity 40 polymer

Description description	Large ribosomal subunit protein mL54
Molecular weight formula_weight	15450.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l

MAAAHLLRASRVWARWHPRALPVLRRPGGFSIREYAKKPVGKGGKGGVAAEALKDPEVCTDPTQLTTHAMGVNIYKEGQDVALKADSEYPTWLFQVNLGPPKKLEELEPESREYWRLLRKQNIWRHNRLSKNKKL

Entity 41 Entity 41 polymer

Description description	Large ribosomal subunit protein mL63
Molecular weight formula_weight	11974.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o

MFLTAVLLRGRIPGRQWIGKHRRPRTVSFQAKESMIRRLEVEAENHYWLSMPYMTAEQECGHAAERRAQAFEAIKAAATSKFPKHRYIADQLDHLNISKKWS

Entity 42 Entity 42 polymer

Description description	Large ribosomal subunit protein mL62
Molecular weight formula_weight	23519.0 kDa
EC 编号 ec_number	3.1.1.29
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p

MATAWGLRWGLSRTGTLLLAPPARCARRALHRQVDGTTFQSIYSLDKLYPESKGADTAWKVPEHAKQASSYIPLDRLSISYCRSSGPGGQNVNKVNSKAEVRFHLASADWIEEPVRQKIALTHKNKINKAGELVLTSESSRYQFRNLAECLQKIRDMIAEASQVPKEPSKEDARLQRLRIEKMNRERLRQKRLNSALKTSRRMTMD

Entity 43 Entity 43 polymer

Description description	Large ribosomal subunit protein mL64
Molecular weight formula_weight	25865.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q

MAALAMRSGYLLRLSVALGPRSRSYRAPPPPRRRPGPHSPDPENLLTPRWQLTPRYVAKQFGRHGAISGVPPASLWPTPEQLRELEAEEQEWYPSLATMQESLRLQQQALEARRQAREQRIAECMAKMPQMIENWRKQKRERWEKIQADKERRARLQAEAQERLGYHVDPRSARFQELLQDLDKQQRKRLKEERQRQKKEARIAAMASAEAQDSAVSGEPSS

Entity 44 Entity 44 polymer

Description description	Large ribosomal subunit protein mL66
Molecular weight formula_weight	22363.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r

MAALRRLVSGCGRQLQAFLAGPAATGWLWLPARGLREVVKIQEGKTTVIEGRITETPKATPDPPNPSGQCPICRWNLKHKYTYEDVLLLSQFIRPYGGMLPRRVTGLCREEHRKIEECVKMAHRAGLLPNHRPQLPEGCLPKDKPKLNRYLTRWAPKSVKPIYKKGHRWNKVGMAVGSPLLKDNVCYSRRPLKMMH

Entity 45 Entity 45 polymer

Description description	Large ribosomal subunit protein mL65
Molecular weight formula_weight	50005.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s

MAAARYWKLVPRGRGLSQNAAAKASATAPEVRDLEVVATPVARYPPIVASMTADSKAARQRRVQRWQATVHAAPSVDEKIRILTKMQFKKYVVHPQISALNADRWYQSFTKTVFVSGLPPAPALSPPPPSLDLAALRAAVCDCILQEQVYVRRRRPRSLFDRRQALASSILDQVVRTLVNLLAPLNPVLSTAALDCKRSVDFYWLRGEERIPAGHRKGHIDALRYQINDKPHNQIRISKQLPEFVPLDYSIPTEIPVMKCKPDKLPLFRRQYENSIFTGSKTADPCCYGHTQFHLIPDRLKRERLIRQNQAEQVEAVFRANAIASLFAWTGAQAMYQGFWSEADVTRPFVSQAVITDGKYFSFFCYQLNTLALTVQADQNNPRKNLCWGSQSQPLYETVEDNDVKGFDDGTLLQIVHFLLNKPREDGAQLLASQEKELDLGP

Entity 46 Entity 46 polymer

Description description	Mitochondrial assembly of ribosomal large subunit protein 1
Molecular weight formula_weight	26055.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	u

MGPGWSPARRLWPLLWRRAVFQRAGPAMASVPWLPRLAERWLPARPATCLTPSLTRGLHHGPQPEERTAGDARLQPGPADHIGAKFDIDMLVSLLRQENARDICVIQVPPEMRYTDYFVIGSGTSTRHLHAMVHYLVKMYKHLKCRSDPYVKIEGKDADDWLCVDFGSMVIHLMLPETRETYELEKLWTLRSFDDQLAQIAAETLPEDFILGLEDDTSSLTPVEFKCK

Entity 47 Entity 47 polymer

Description description	Predicted gene, 55359
Molecular weight formula_weight	8444.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	v

MAPWSREAVLCLYRALLRQGRELRYTDRDFYFASIRREFRKNQKLENLEAREKQLEKGLVFLHSKLGGLI

Entity 48 Entity 48 polymer

Description description	Acyl carrier protein, mitochondrial
Molecular weight formula_weight	17390.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	w

MASRVLCACVRRLPAAFAPLPRLPTLALARPLSTTLCPEGIRRRPGALQSALALAQVPGTVTHLCRQYSDAPPLTLDGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE

Entity 49 Entity 49 polymer

Description description	rRNA methyltransferase 3, mitochondrial
Molecular weight formula_weight	46868.9 kDa
EC 编号 ec_number	2.1.1.-
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x,y

MAAPAKGMWCSLGSLLRVVQTRDLNARRWVRALRRSPVRVLSPSGQVEERKRAPDQQPRKAVPKASSQGQRQKQPLETSPSQTPHTWEEAGLRYDKAFPGDRRLSSVMTIVKSRPFREKQGKILLEGRRLIADALKAGAVPKAFFFSRLEYVKELPVDKLKDVSLIKVKFEDIKDWSDLVTPQGIMGIFAKPDPVKMTYPETPLHHTLPLVLICDNLRDPGNLGTILRSAAGAGCSKVLLTKGCVDAWEPKVLRAGMGAHFQVPIVNNVEWETVPNHLPPDTRVYVADNCGHYAQVQMSDKTGDRDWACDRRFLKFHKYEEDLDTKTRKDWLPKLEVQSYDLDWTGAPAAVVIGGETHGVSLESLQLAESTGGKRLLIPVVPGVDSLNSAMAASILLFEGKRQLRIKVEDLSRDRSYH

Entity 50 Entity 50 polymer

Description description	Probable ATP-dependent RNA helicase DDX28
Molecular weight formula_weight	59592.8 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	z

MALAGPSRLLALAVRLLLEPRRNLVVRGSDQSLPVVRVPRALQRRQEQRQSGRGSLQRPVLVRPGPLLVSARRPELNQPARLTLGRWERAPLASRGWKHRRSRQDHFSIERVQQEAPALRNLSSRGSFVDLGLEPRVLLALQEAVPEVVQPTSVQSKTIPPLLRGRHLLCAAETGSGKTLSYLLPLFQRLLRGSDLDSRSFTAPRGLVLVPSRELAEQVQAVAQSLGGYLGLQVIELGGGLGMSRLKLQLYRRPAADVLVATPGALWKALKSQLISLQHLNFIVLDEVDTLLDESFLELVDYILEKSPIAESPAELEDPFNPKAQLVLVGATFPEGLNQLLSKVTSPDSLTTITSSKLHCLMPHVRQTFMRLKGADKVTELVQILKQQDKASKTEPSGTVLVFCNSASTVNWLGYILDDHKIQHLRLQGQMPASMRAGIFQSFQKGSQNILVCTDIASRGLDSVHVEVVINYDFPPTLQDYIHRAGRVGRVGSEVPGSVISFVTHPWDVSLVQKIELAARRRRSLPGLASSVGDPLPQKA

Entity 51 Entity 51 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 52 Entity 52 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	5.67 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	6223

Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Large ribosomal subunit protein uL2m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein uL3m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein uL4m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein bL9m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein uL10m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein uL11m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein uL13m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein uL14m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein uL15m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein bL17m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer