9hcf

Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU-L0R8F8-mtACP complex with uL16m, State B2 (SAMC knock-out)

Method: ELECTRON MICROSCOPY D_max: 277.1 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Large ribosomal subunit protein uL2m

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain D； UniProt 61–306	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain D 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain D 61–306（246 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain D 61–306（246 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain D 61–306（246 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain D 61–306（246 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain D 61–306（246 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM02_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–246； UniProt 61–306

Large ribosomal subunit protein uL3m

OrganismNot specified

UniProt Q99N95

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain E； UniProt 1–348	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain E 1–348（348 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain E 1–348（348 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain E 1–348（348 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain E 1–348（348 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain E 41–348（308 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain E 1–348（348 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM03_MOUSE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–348； UniProt 1–348

Large ribosomal subunit protein uL4m

OrganismNot specified

UniProt Q9DCU6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain F； UniProt 1–294	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain F 1–294（294 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain F 1–294（294 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain F 1–294（294 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain F 1–294（294 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain F 45–294（250 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain F 1–294（294 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM04_MOUSE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain F； PDBConstruct 1–294； UniProt 1–294

Large ribosomal subunit protein bL9m

OrganismNot specified

UniProt Q99N94

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain H； UniProt 1–265	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain H 1–265（265 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain H 50–144（95 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain H 1–265（265 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM09_MOUSE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain H； PDBConstruct 1–265； UniProt 1–265

Large ribosomal subunit protein uL10m

OrganismNot specified

UniProt Q3TBW2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain I； UniProt 1–262	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain I 1–262（262 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain I 1–262（262 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain I 1–262（262 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain I 1–262（262 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain I 1–262（262 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain I 1–262（262 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM10_MOUSE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain I； PDBConstruct 1–262； UniProt 1–262

Large ribosomal subunit protein uL11m

OrganismNot specified

UniProt Q9CQF0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain J； UniProt 1–192	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain J 1–192（192 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain J 1–192（192 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain J 1–192（192 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain J 1–192（192 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain J 18–192（175 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain J 1–192（192 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM11_MOUSE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain J； PDBConstruct 1–192； UniProt 1–192

Large ribosomal subunit protein uL13m

OrganismNot specified

UniProt Q9D1P0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain K； UniProt 1–178	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain K 1–178（178 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain K 1–178（178 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain K 1–178（178 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain K 1–178（178 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain K 2–178（177 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain K 1–178（178 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM13_MOUSE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain K； PDBConstruct 1–178； UniProt 1–178

Large ribosomal subunit protein uL14m

OrganismNot specified

UniProt Q9D1I6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain L； UniProt 1–145	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain L 1–145（145 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain L 1–145（145 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain L 1–145（145 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain L 1–145（145 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain L 31–145（115 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain L 1–145（145 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM14_MOUSE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain L； PDBConstruct 1–145； UniProt 1–145

Large ribosomal subunit protein uL15m

OrganismNot specified

UniProt Q9CPR5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain M； UniProt 1–295	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain M 1–295（295 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain M 1–295（295 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain M 1–295（295 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain M 1–295（295 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain M 9–295（287 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain M 1–295（295 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM15_MOUSE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain M； PDBConstruct 1–295； UniProt 1–295

Large ribosomal subunit protein uL16m

OrganismNot specified

UniProt Q99N93

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain N； UniProt 1–251	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain N 1–251（251 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain N 30–251（222 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain N 1–251（251 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM16_MOUSE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain N； PDBConstruct 1–251； UniProt 1–251

Large ribosomal subunit protein bL17m

OrganismNot specified

UniProt Q9D8P4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain O； UniProt 1–176	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain O 1–176（176 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain O 1–176（176 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain O 1–176（176 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain O 1–176（176 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain O 9–161（153 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain O 1–176（176 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM17_MOUSE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain O； PDBConstruct 1–176； UniProt 1–176

Large ribosomal subunit protein uL18m

OrganismNot specified

UniProt Q9CQL5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain P； UniProt 1–180	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain P 1–180（180 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain P 1–180（180 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain P 1–180（180 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain P 1–180（180 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain P 39–179（141 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain P 1–180（180 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM18_MOUSE
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain P； PDBConstruct 1–180； UniProt 1–180

Large ribosomal subunit protein bL19m

OrganismNot specified

UniProt Q9D338

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain Q； UniProt 1–292	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain Q 1–292（292 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain Q 1–292（292 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain Q 1–292（292 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain Q 1–292（292 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain Q 74–290（217 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain Q 1–292（292 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM19_MOUSE
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain Q； PDBConstruct 1–292； UniProt 1–292

Large ribosomal subunit protein bL20m

OrganismNot specified

UniProt Q9CQL4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain R； UniProt 1–149	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain R 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain R 1–149（149 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain R 1–149（149 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain R 1–149（149 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain R 10–149（140 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain R 1–149（149 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM20_MOUSE
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain R； PDBConstruct 1–149； UniProt 1–149

Large ribosomal subunit protein bL21m

OrganismNot specified

UniProt Q9D1N9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain S； UniProt 1–209	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain S 1–209（209 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain S 1–209（209 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain S 1–209（209 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain S 1–209（209 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain S 50–208（159 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain S 1–209（209 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM21_MOUSE
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain S； PDBConstruct 1–209； UniProt 1–209

Large ribosomal subunit protein uL22m

OrganismNot specified

UniProt Q8BU88

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain T； UniProt 1–206	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain T 1–206（206 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain T 1–206（206 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain T 1–206（206 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain T 1–206（206 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain T 41–206（166 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain T 1–206（206 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM22_MOUSE
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain T； PDBConstruct 1–206； UniProt 1–206

Large ribosomal subunit protein uL23m

OrganismNot specified

UniProt O35972

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain U； UniProt 1–146	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain U 1–146（146 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain U 1–146（146 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain U 1–146（146 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain U 1–146（146 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain U 2–146（145 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain U 1–146（146 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM23_MOUSE
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain U； PDBConstruct 1–146； UniProt 1–146

Large ribosomal subunit protein uL24m

OrganismNot specified

UniProt Q9CQ06

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain V； UniProt 1–216	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain V 1–216（216 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain V 1–216（216 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain V 1–216（216 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain V 19–216（198 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain V 10–216（207 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain V 1–216（216 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM24_MOUSE
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain V； PDBConstruct 1–216； UniProt 1–216

Large ribosomal subunit protein bL27m

OrganismNot specified

UniProt Q99N92

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain W； UniProt 1–148	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain W 1–148（148 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain W 49–148（100 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain W 1–148（148 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM27_MOUSE
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain W； PDBConstruct 1–148； UniProt 1–148

Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m

OrganismNot specified

UniProt Q9D1B9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain X； UniProt 1–257	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain X 1–257（257 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain X 1–257（257 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain X 1–257（257 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain X 1–257（257 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain X 2–243（242 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain X 1–257（257 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM28_MOUSE
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain X； PDBConstruct 1–257； UniProt 1–257

Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m

OrganismNot specified

UniProt Q9DCI9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain 0； UniProt 1–187 Chain X； UniProt 151–187	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain 0 1–187（187 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain 0 1–187（187 aa） Chain X 151–187（37 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain 0 1–187（187 aa） Chain X 151–187（37 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain 0 1–187（187 aa） Chain X 151–187（37 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain 0 78–185（108 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain 0 1–187（187 aa） Chain X 151–187（37 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM32_MOUSE
Isoform	—
PDB entities	22, 55
Chains and sequence ranges	Author chain X； PDBConstruct 258–294； UniProt 151–187 Author chain 0； PDBConstruct 1–187； UniProt 1–187

Large ribosomal subunit protein uL29m

OrganismNot specified

UniProt Q8K2Y7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain Y； UniProt 1–252	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain Y 1–252（252 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain Y 1–252（252 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain Y 1–252（252 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain Y 1–252（252 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain Y 65–240（176 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain Y 1–252（252 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM47_MOUSE
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain Y； PDBConstruct 1–252； UniProt 1–252

Large ribosomal subunit protein uL30m

OrganismNot specified

UniProt Q9D7N6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain Z； UniProt 1–160	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain Z 1–160（160 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain Z 1–160（160 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain Z 1–160（160 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain Z 1–160（160 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain Z 35–155（121 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain Z 1–160（160 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM30_MOUSE
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain Z； PDBConstruct 1–160； UniProt 1–160

5-cytosine rRNA methyltransferase NSUN4

OrganismNot specified

UniProt Q9CZ57

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain x； UniProt 1–381	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain x 1–381（381 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain x 37–381（345 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different construct Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain x 26–381（356 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NSUN4_MOUSE
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain x； PDBConstruct 1–381； UniProt 1–381

Large ribosomal subunit protein bL33m

OrganismNot specified

UniProt Q9CQP0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain 1； UniProt 1–65	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain 1 1–65（65 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain 1 1–65（65 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain 1 14–65（52 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain 1 1–65（65 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

4 other PDB entries and 4 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM33_MOUSE
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain 1； PDBConstruct 1–65； UniProt 1–65

Large ribosomal subunit protein bL34m

OrganismNot specified

UniProt Q99N91

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain 2； UniProt 1–92	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain 2 1–92（92 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain 2 47–92（46 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain 2 1–92（92 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM34_MOUSE
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain 2； PDBConstruct 1–92； UniProt 1–92

Large ribosomal subunit protein bL35m

OrganismNot specified

UniProt Q9CQL6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain 3； UniProt 1–188	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain 3 1–188（188 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain 3 94–188（95 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain 3 1–188（188 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM35_MOUSE
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain 3； PDBConstruct 1–188； UniProt 1–188

Large ribosomal subunit protein bL36m

OrganismNot specified

UniProt Q99N90

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain 4； UniProt 1–101	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain 4 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain 4 65–101（37 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain 4 1–101（101 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM36_MOUSE
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain 4； PDBConstruct 1–101； UniProt 1–101

Large ribosomal subunit protein mL38

OrganismNot specified

UniProt Q8K2M0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain 6； UniProt 1–380	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain 6 1–380（380 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain 6 1–380（380 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain 6 1–380（380 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain 6 1–380（380 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain 6 46–380（335 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain 6 1–380（380 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM38_MOUSE
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain 6； PDBConstruct 1–380； UniProt 1–380

Large ribosomal subunit protein mL39

OrganismNot specified

UniProt Q9JKF7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain 7； UniProt 1–336	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain 7 1–336（336 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain 7 1–336（336 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain 7 1–336（336 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain 7 1–336（336 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain 7 33–324（292 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain 7 1–336（336 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM39_MOUSE
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain 7； PDBConstruct 1–336； UniProt 1–336

Large ribosomal subunit protein mL43

OrganismNot specified

UniProt Q5RL20

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain b； UniProt 1–159	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain b 1–159（159 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain b 1–159（159 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain b 1–159（159 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain b 1–159（159 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain b 2–149（148 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain b 1–159（159 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q5RL20_MOUSE
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain b； PDBConstruct 1–159； UniProt 1–159

Large ribosomal subunit protein mL48

OrganismNot specified

UniProt Q8JZS9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain f； UniProt 1–211	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain f 1–211（211 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain f 1–211（211 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain f 1–211（211 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain f 1–211（211 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain f 84–211（128 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain f 1–211（211 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM48_MOUSE
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain f； PDBConstruct 1–211； UniProt 1–211

Large ribosomal subunit protein mL50

OrganismNot specified

UniProt Q8VDT9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain h； UniProt 1–159	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain h 1–159（159 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain h 1–159（159 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain h 1–159（159 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain h 1–159（159 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain h 50–159（110 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain h 1–159（159 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM50_MOUSE
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain h； PDBConstruct 1–159； UniProt 1–159

Large ribosomal subunit protein mL51

OrganismNot specified

UniProt Q9CPY1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain i； UniProt 1–128	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain i 1–128（128 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain i 1–128（128 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain i 1–128（128 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain i 1–128（128 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain i 32–128（97 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain i 1–128（128 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM51_MOUSE
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain i； PDBConstruct 1–128； UniProt 1–128

Large ribosomal subunit protein mL52

OrganismNot specified

UniProt Q9D0Y8

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain j； UniProt 1–121	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain j 1–121（121 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain j 1–121（121 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain j 1–121（121 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain j 1–121（121 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain j 1–121（121 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain j 1–121（121 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM52_MOUSE
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain j； PDBConstruct 1–121； UniProt 1–121

Large ribosomal subunit protein mL63

OrganismNot specified

UniProt Q9CQF8

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain o； UniProt 1–102	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain o 1–102（102 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain o 1–102（102 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain o 1–102（102 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain o 1–102（102 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain o 25–102（78 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain o 1–102（102 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RT63_MOUSE
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain o； PDBConstruct 1–102； UniProt 1–102

Large ribosomal subunit protein mL64

OrganismNot specified

UniProt Q9CR59

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain q； UniProt 1–222	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain q 1–222（222 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain q 1–222（222 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain q 1–222（222 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain q 1–222（222 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain q 25–159（135 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain q 1–222（222 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	G45IP_MOUSE
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain q； PDBConstruct 1–222； UniProt 1–222

Large ribosomal subunit protein mL66

OrganismNot specified

UniProt Q99N85

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain r； UniProt 1–196	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain r 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain r 1–196（196 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain r 1–196（196 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain r 1–196（196 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain r 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain r 1–196（196 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RT18A_MOUSE
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain r； PDBConstruct 1–196； UniProt 1–196

Large ribosomal subunit protein mL65

OrganismNot specified

UniProt Q9D0G0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain s； UniProt 1–442	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain s 1–442（442 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain s 1–442（442 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain s 1–442（442 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain s 1–442（442 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain s 41–424（384 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain s 1–442（442 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RT30_MOUSE
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain s； PDBConstruct 1–442； UniProt 1–442

Mitochondrial assembly of ribosomal large subunit protein 1

OrganismNot specified

UniProt Q9CWV0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain u； UniProt 1–228	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain u 1–228（228 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain u 1–228（228 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain u 1–228（228 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain u 1–228（228 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain u 85–209（125 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain u 1–228（228 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	MASU1_MOUSE
Isoform	—
PDB entities	41
Chains and sequence ranges	Author chain u； PDBConstruct 1–228； UniProt 1–228

Predicted gene, 55359

OrganismNot specified

UniProt A0A2I3BQS8

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain v； UniProt 1–70	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain v 1–70（70 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain v 1–70（70 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain v 1–70（70 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain v 1–70（70 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain v 2–70（69 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain v 1–70（70 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A2I3BQS8_MOUSE
Isoform	—
PDB entities	42
Chains and sequence ranges	Author chain v； PDBConstruct 1–70； UniProt 1–70

Large ribosomal subunit protein mL37

OrganismNot specified

UniProt Q921S7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain 5； UniProt 1–423	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain 5 1–423（423 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain 5 1–423（423 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain 5 1–423（423 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain 5 1–423（423 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain 5 30–423（394 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain 5 1–423（423 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM37_MOUSE
Isoform	—
PDB entities	43
Chains and sequence ranges	Author chain 5； PDBConstruct 1–423； UniProt 1–423

Large ribosomal subunit protein mL40

OrganismNot specified

UniProt Q9Z2Q5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain 8； UniProt 1–206	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain 8 1–206（206 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain 8 1–206（206 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain 8 1–206（206 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain 8 1–206（206 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain 8 105–174（70 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain 8 1–206（206 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM40_MOUSE
Isoform	—
PDB entities	44
Chains and sequence ranges	Author chain 8； PDBConstruct 1–206； UniProt 1–206

Large ribosomal subunit protein mL41

OrganismNot specified

UniProt Q9CQN7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain 9； UniProt 1–135	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain 9 1–135（135 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain 9 1–135（135 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain 9 1–135（135 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain 9 1–135（135 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain 9 1–135（135 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain 9 1–135（135 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM41_MOUSE
Isoform	—
PDB entities	45
Chains and sequence ranges	Author chain 9； PDBConstruct 1–135； UniProt 1–135

Large ribosomal subunit protein mL42

OrganismNot specified

UniProt Q9CPV3

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain a； UniProt 1–142	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain a 1–142（142 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain a 1–142（142 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain a 1–142（142 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain a 1–142（142 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain a 1–142（142 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain a 1–142（142 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM42_MOUSE
Isoform	—
PDB entities	46
Chains and sequence ranges	Author chain a； PDBConstruct 1–142； UniProt 1–142

Large ribosomal subunit protein mL55

OrganismNot specified

UniProt Q9CZ83

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain m； UniProt 1–127	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain m 1–127（127 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain m 1–127（127 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain m 1–127（127 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM55_MOUSE
Isoform	—
PDB entities	47
Chains and sequence ranges	Author chain m； PDBConstruct 1–127； UniProt 1–127

Mitochondrial ribosome-associated GTPase 1

OrganismNot specified

UniProt Q8R2R6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain z； UniProt 1–326	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain z 1–326（326 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain z 1–326（326 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain z 1–326（326 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	MTG1_MOUSE
Isoform	—
PDB entities	48
Chains and sequence ranges	Author chain z； PDBConstruct 1–326； UniProt 1–326

Large ribosomal subunit protein mL54

OrganismNot specified

UniProt Q9CPW3

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain l； UniProt 1–135	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain l 1–135（135 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain l 1–135（135 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain l 1–135（135 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain l 1–135（135 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain l 1–135（135 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain l 1–135（135 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM54_MOUSE
Isoform	—
PDB entities	49
Chains and sequence ranges	Author chain l； PDBConstruct 1–135； UniProt 1–135

Transcription termination factor 4, mitochondrial

OrganismNot specified

UniProt Q8BVN4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain y； UniProt 1–346	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain y 1–346（346 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain y 1–346（346 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain y 1–346（346 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	MTEF4_MOUSE
Isoform	—
PDB entities	50
Chains and sequence ranges	Author chain y； PDBConstruct 1–346； UniProt 1–346

Acyl carrier protein, mitochondrial

OrganismNot specified

UniProt Q9CR21

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain w； UniProt 1–156	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6G2J Mouse mitochondrial complex I in the active state Deposited 2018-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain T 1–156（156 aa） Chain U 1–156（156 aa）	Not recorded	3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 12 SF4 IRON/SULFUR CLUSTER × 6 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 CDL CARDIOLIPIN × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.14 cryo-EM vitrification conditions Cryogen ETHANE；8-16s blotting.	Resolution 3.30 Å
6G72 Mouse mitochondrial complex I in the deactive state Deposited 2018-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain T 1–156（156 aa） Chain U 1–156（156 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 2 ACE ACETYL GROUP × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.14 cryo-EM vitrification conditions Cryogen ETHANE；8-16s blotting.	Resolution 3.90 Å
6ZR2 Cryo-EM structure of respiratory complex I in the active state from Mus musculus at 3.1 A Deposited 2020-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain T 1–156（156 aa） Chain U 1–156（156 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 9 CDL CARDIOLIPIN × 7 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.14；pH corrected at room temperature cryo-EM vitrification conditions Cryogen ETHANE；blot for 10 seconds before plunging	Resolution 3.10 Å
6ZTQ Cryo-EM structure of respiratory complex I from Mus musculus inhibited by piericidin A at 3.0 A Deposited 2020-07-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain T 1–156（156 aa） Chain U 1–156（156 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 HQH Piericidin A × 1 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 9 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 CDL CARDIOLIPIN × 7 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.14；pH corrected at room temperature cryo-EM vitrification conditions Cryogen ETHANE；blot for 10 seconds before plunging	Resolution 3.00 Å
7AK5 Cryo-EM structure of respiratory complex I in the deactive state from Mus musculus at 3.2 A Deposited 2020-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain T 1–156（156 aa） Chain U 1–156（156 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 8 CDL CARDIOLIPIN × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；8-16s blotting	Resolution 3.17 Å
7AK6 Cryo-EM structure of ND6-P25L mutant respiratory complex I from Mus musculus at 3.8 A Deposited 2020-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain T 1–156（156 aa） Chain U 1–156（156 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 4 CDL CARDIOLIPIN × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.14 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.82 Å
7B93 Cryo-EM structure of mitochondrial complex I from Mus musculus inhibited by IACS-2858 at 3.0 A Deposited 2020-12-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain T 1–156（156 aa） Chain U 1–156（156 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 9 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 T2Q 1-[[3-(4-methylsulfonylpiperidin-1-yl)phenyl]methyl]-5-[3-[4-(trifluoromethyloxy)phenyl]-1,2,4-oxadiazol-5-yl]pyridin-2-one × 1 CDL CARDIOLIPIN × 7 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.14 cryo-EM vitrification conditions Cryogen ETHANE；blot for 10 seconds before plunging	Resolution 3.04 Å
7PSA The acetogenin-bound complex I of Mus musculus resolved to 3.4 angstroms Deposited 2021-09-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain T 1–156（156 aa） Chain U 1–156（156 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 9 88I (3~{S},5~{S})-5-methyl-3-[(13~{R})-13-oxidanyl-13-[(2~{R},5~{R})-5-[(2~{R},5~{R})-5-[(1~{R})-1-oxidanylundecyl]oxolan-2-yl]oxolan-2-yl]tridecyl]oxolan-2-one × 1 CDL CARDIOLIPIN × 7 ATP ADENOSINE-5'-TRIPHOSPHATE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.55；pH 7.55 at 25 degrees Celsius cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8C2S Cryo-EM structure NDUFS4 knockout complex I from Mus musculus heart (Class 1). Deposited 2022-12-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain T 1–156（156 aa） Chain U 1–156（156 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 7 CDL CARDIOLIPIN × 6 LMT DODECYL-BETA-D-MALTOSIDE × 2 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.14；pH was corrected at room temperature ~22 C cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
8CA3 Cryo-EM structure NDUFS4 knockout complex I from Mus musculus heart (Class 2). Deposited 2023-01-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain T 1–156（156 aa） Chain U 1–156（156 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 UQ9 Ubiquinone-9 × 1 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 7 CDL CARDIOLIPIN × 6 LMT DODECYL-BETA-D-MALTOSIDE × 2 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.14；pH was corrected at room temperature ~22 C cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8CA5 Cryo-EM structure NDUFS4 knockout complex I from Mus musculus heart (Class 3). Deposited 2023-01-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 43 PDB declaration: 43-meric	Chain T 1–156（156 aa） Chain U 1–156（156 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 7 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 UQ9 Ubiquinone-9 × 1 CDL CARDIOLIPIN × 6 LMT DODECYL-BETA-D-MALTOSIDE × 2 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.14；pH was corrected at room temperature ~22 C cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
8IAO Respiratory complex CI:CIII2, type I, Wild type mouse under thermoneutral temperature Deposited 2023-02-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 67 PDB declaration: 67-meric	Chain T 1–156（156 aa） Chain U 1–156（156 aa）	Not recorded	3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 18 CDL CARDIOLIPIN × 12 SF4 IRON/SULFUR CLUSTER × 6 UQ1 UBIQUINONE-1 × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 UQ9 Ubiquinone-9 × 1 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 ADP ADENOSINE-5'-DIPHOSPHATE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 U10 UBIQUINONE-10 × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
8IAP Respiratory complex Peripheral Arm of CI, focus-refined map of type I, Wild type mouse under thermoneutral temperature Deposited 2023-02-09	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain T 1–156（156 aa）	Not recorded	3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 3 SF4 IRON/SULFUR CLUSTER × 6 UQ1 UBIQUINONE-1 × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 UQ9 Ubiquinone-9 × 1 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 1 CDL CARDIOLIPIN × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8IAQ Respiratory complex Membrane domain of CI, focused map of type I, Wild type mouse under thermoneutral temperature Deposited 2023-02-09	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain U 1–156（156 aa）	Not recorded	3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 9 CDL CARDIOLIPIN × 6 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8IB4 Respiratory complex CI:CIII2, type IA, Wild type mouse under cold temperature Deposited 2023-02-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 66 PDB declaration: 66-meric	Chain T 1–156（156 aa） Chain U 1–156（156 aa）	Not recorded	3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 20 SF4 IRON/SULFUR CLUSTER × 6 UQ1 UBIQUINONE-1 × 1 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 3 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 UQ9 Ubiquinone-9 × 1 CDL CARDIOLIPIN × 9 ADP ADENOSINE-5'-DIPHOSPHATE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 U10 UBIQUINONE-10 × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.30 Å
8IB5 Respiratory complex Peripheral Arm of CI, focus-refined map of type IA, Wild type mouse under cold temperature Deposited 2023-02-09	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain T 1–156（156 aa）	Not recorded	3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 3 SF4 IRON/SULFUR CLUSTER × 6 UQ1 UBIQUINONE-1 × 1 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 3 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 UQ9 Ubiquinone-9 × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 1 CDL CARDIOLIPIN × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
8IB6 Respiratory complex Membrane domain of CI, focus-refined of type IA, Wild type mouse under cold temperature Deposited 2023-02-09	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain U 1–156（156 aa）	Not recorded	3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 12 CDL CARDIOLIPIN × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
8IB9 Respiratory complex CI:CIII2, type IB, Wild type mouse under cold temperature Deposited 2023-02-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 66 PDB declaration: 66-meric	Chain T 1–156（156 aa） Chain U 1–156（156 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 UQ1 UBIQUINONE-1 × 1 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 3 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 18 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 UQ9 Ubiquinone-9 × 1 CDL CARDIOLIPIN × 8 ADP ADENOSINE-5'-DIPHOSPHATE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 U10 UBIQUINONE-10 × 2 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.30 Å
8IBA Respiratory complex Peripheral Arm of CI, focus-refined map of type IB, Wild type mouse under cold temperature Deposited 2023-02-10	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain T 1–156（156 aa）	Not recorded	3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 3 SF4 IRON/SULFUR CLUSTER × 6 UQ1 UBIQUINONE-1 × 1 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 UQ9 Ubiquinone-9 × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 1 CDL CARDIOLIPIN × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8IBB Respiratory complex Membrane domain of CI, focus-refined of type IB, Wild type mouse under cold temperature Deposited 2023-02-10	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain U 1–156（156 aa）	Not recorded	3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 13 CDL CARDIOLIPIN × 4 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
8IBD Respiratory complex CI:CIII2, type II, Wild type mouse under cold temperature Deposited 2023-02-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 67 PDB declaration: 67-meric	Chain T 1–156（156 aa） Chain U 1–156（156 aa）	Not recorded	3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 20 SF4 IRON/SULFUR CLUSTER × 6 UQ1 UBIQUINONE-1 × 1 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 UQ9 Ubiquinone-9 × 1 CDL CARDIOLIPIN × 6 ADP ADENOSINE-5'-DIPHOSPHATE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2 U10 UBIQUINONE-10 × 1 3PH 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
8IBE Respiratory complex Peripheral Arm of CI, focus-refined map of type II, Wild type mouse under cold temperature Deposited 2023-02-10	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain T 1–156（156 aa）	Not recorded	3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 3 SF4 IRON/SULFUR CLUSTER × 6 UQ1 UBIQUINONE-1 × 1 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 UQ9 Ubiquinone-9 × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 1 CDL CARDIOLIPIN × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
8IBF Respiratory complex Membrane domain of CI, focus-refined of type II, Wild type mouse under cold temperature Deposited 2023-02-10	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain U 1–156（156 aa）	Not recorded	3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 14 CDL CARDIOLIPIN × 3 ADP ADENOSINE-5'-DIPHOSPHATE × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
8IC2 Respiratory complex CI:CIII2, type I, PERK -/- mouse under cold temperature Deposited 2023-02-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 66 PDB declaration: 66-meric	Chain T 1–156（156 aa） Chain U 1–156（156 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 UQ1 UBIQUINONE-1 × 1 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 14 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 UQ9 Ubiquinone-9 × 1 CDL CARDIOLIPIN × 9 ZN ZINC ION × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 2 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 UQ6 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 HEC HEME C × 2 U10 UBIQUINONE-10 × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.30 Å
8IC3 Respiratory complex Peripheral Arm of CI, focus-refined map of type I, PERK -/- mouse under cold temperature Deposited 2023-02-10	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain T 1–156（156 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 UQ1 UBIQUINONE-1 × 1 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 UQ9 Ubiquinone-9 × 1 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 1 CDL CARDIOLIPIN × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8IC4 Respiratory complex Membrane domain of CI, focus-refined of type I, PERK -/- mouse under cold temperature Deposited 2023-02-10	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain U 1–156（156 aa）	Not recorded	3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 9 CDL CARDIOLIPIN × 5 ZN ZINC ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8OLT Mitochondrial complex I from Mus musculus in the active state bound with piericidin A Deposited 2023-03-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain T 1–156（156 aa） Chain U 1–156（156 aa）	Not recorded	LMT DODECYL-BETA-D-MALTOSIDE × 16 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 3 SF4 IRON/SULFUR CLUSTER × 6 HQH Piericidin A × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 NA SODIUM ION × 1 CDL CARDIOLIPIN × 5 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 14 MG MAGNESIUM ION × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 2 MYR MYRISTIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.14；PH corrected at room temperature cryo-EM vitrification conditions Cryogen ETHANE；blot for 10 to 12 seconds before plunging	Resolution 2.84 Å
8OM1 Mitochondrial complex I from Mus musculus in the active state Deposited 2023-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain T 1–156（156 aa） Chain U 1–156（156 aa）	Not recorded	LMT DODECYL-BETA-D-MALTOSIDE × 16 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 SF4 IRON/SULFUR CLUSTER × 6 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 NA SODIUM ION × 1 CDL CARDIOLIPIN × 6 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 16 MG MAGNESIUM ION × 1 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 2 MYR MYRISTIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.14 cryo-EM vitrification conditions Cryogen ETHANE；blot for 10 seconds before plunging	Resolution 2.39 Å
8PW5 CS respirasome from murine liver Deposited 2023-07-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 92 PDB declaration: 92-meric	Chain T1 1–156（156 aa） Chain U1 1–156（156 aa）	Not recorded	3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 41 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 13 CDL CARDIOLIPIN × 18 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 4 CU COPPER (II) ION × 2 NA SODIUM ION × 2 HEA HEME-A × 4 MG MAGNESIUM ION × 3 CUA DINUCLEAR COPPER ION × 2 ZN ZINC ION × 3 TGL TRISTEAROYLGLYCEROL × 2 SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 K POTASSIUM ION × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZMP S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8PW6 C respirasome from murine liver Deposited 2023-07-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 79 PDB declaration: 79-meric	Chain T1 1–156（156 aa） Chain U1 1–156（156 aa）	Not recorded	3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 CDL CARDIOLIPIN × 16 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 4 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 12 CU COPPER (II) ION × 1 NA SODIUM ION × 1 HEA HEME-A × 2 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 2 TGL TRISTEAROYLGLYCEROL × 1 SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 K POTASSIUM ION × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZMP S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
8PW7 A respirasome from murine liver Deposited 2023-07-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 79 PDB declaration: 79-meric	Chain T1 1–156（156 aa） Chain U1 1–156（156 aa）	Not recorded	CU COPPER (II) ION × 1 NA SODIUM ION × 1 HEA HEME-A × 2 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MG MAGNESIUM ION × 2 CUA DINUCLEAR COPPER ION × 1 ZN ZINC ION × 2 TGL TRISTEAROYLGLYCEROL × 1 CDL CARDIOLIPIN × 16 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 HEC HEME C × 2 FES FE2/S2 (INORGANIC) CLUSTER × 4 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 SF4 IRON/SULFUR CLUSTER × 6 FMN FLAVIN MONONUCLEOTIDE × 1 K POTASSIUM ION × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZMP S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8RGP Closed Complex I from murine brain Deposited 2023-12-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain T 1–156（156 aa） Chain U 1–156（156 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 14 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 UQ Coenzyme Q10, (2Z,6E,10Z,14E,18E,22E,26Z)-isomer × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 K POTASSIUM ION × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 ZMP S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 CDL CARDIOLIPIN × 9 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8RGQ Open Complex I from murine liver Deposited 2023-12-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain T 1–156（156 aa） Chain U 1–156（156 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 17 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 K POTASSIUM ION × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 ZMP S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 CDL CARDIOLIPIN × 6 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8RGR Closed Complex I from murine liver Deposited 2023-12-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain T 1–156（156 aa） Chain U 1–156（156 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 17 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 5 UQ Coenzyme Q10, (2Z,6E,10Z,14E,18E,22E,26Z)-isomer × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 K POTASSIUM ION × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 ZMP S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 CDL CARDIOLIPIN × 10 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
8RGT Open Complex I from murine brain Deposited 2023-12-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain T 1–156（156 aa） Chain U 1–156（156 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 17 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 4 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 K POTASSIUM ION × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 ZMP S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 CDL CARDIOLIPIN × 6 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
8UCA Formation of I2+III2 supercomplex rescues respiratory chain defects Deposited 2023-09-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 111 PDB declaration: 111-meric	Chain AB 1–156（156 aa） Chain AC 1–156（156 aa） Chain ab 1–156（156 aa） Chain ac 1–156（156 aa）	Not recorded	MG MAGNESIUM ION × 2 DGT 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 2 ZN ZINC ION × 2 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 4 HEM PROTOPORPHYRIN IX CONTAINING FE × 4 HEC HEME C × 2 FMN FLAVIN MONONUCLEOTIDE × 2 SF4 IRON/SULFUR CLUSTER × 12 FES FE2/S2 (INORGANIC) CLUSTER × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
8XNL Respiratory complex Peripheral Arm of CI, close form A, focus-refined map of type I, Wild type mouse under thermoneutral temperature Deposited 2023-12-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain T 1–156（156 aa）	Not recorded	3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 3 SF4 IRON/SULFUR CLUSTER × 6 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 UQ9 Ubiquinone-9 × 1 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 3 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 1 CDL CARDIOLIPIN × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
8XNM Respiratory complex Peripheral Arm of CI, close form B, focus-refined map of type I, Wild type mouse under thermoneutral temperature Deposited 2023-12-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain T 1–156（156 aa）	Not recorded	3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 SF4 IRON/SULFUR CLUSTER × 6 UQ9 Ubiquinone-9 × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 3 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 1 CDL CARDIOLIPIN × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8XNN Respiratory complex Peripheral Arm of CI, open form A, focus-refined map of type I, Wild type mouse under thermoneutral temperature Deposited 2023-12-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain T 1–156（156 aa）	Not recorded	3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 3 SF4 IRON/SULFUR CLUSTER × 6 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 UQ9 Ubiquinone-9 × 1 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 1 CDL CARDIOLIPIN × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8XNO Respiratory complex Peripheral Arm of CI, close form A, focus-refined map of type IA, Wild type mouse under Cold Acclimation Deposited 2023-12-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain T 1–156（156 aa）	Not recorded	3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 3 SF4 IRON/SULFUR CLUSTER × 6 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 3 UQ1 UBIQUINONE-1 × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 UQ9 Ubiquinone-9 × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 1 CDL CARDIOLIPIN × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8XNP Respiratory complex Peripheral Arm of CI, close form B, focus-refined map of type IA, Wild type mouse under Cold Acclimation Deposited 2023-12-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain T 1–156（156 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 UQ9 Ubiquinone-9 × 1 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 3 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 1 CDL CARDIOLIPIN × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8XNQ Respiratory complex Peripheral Arm of CI, open form A, focus-refined map of type IA, Wild type mouse under Cold Acclimation Deposited 2023-12-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain T 1–156（156 aa）	Not recorded	3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 3 SF4 IRON/SULFUR CLUSTER × 6 UQ1 UBIQUINONE-1 × 1 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 3 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 UQ9 Ubiquinone-9 × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 1 CDL CARDIOLIPIN × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
8XNR Respiratory complex Peripheral Arm of CI, close form A, focus-refined map of type IB, Wild type mouse under Cold Acclimation Deposited 2023-12-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain T 1–156（156 aa）	Not recorded	3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 3 SF4 IRON/SULFUR CLUSTER × 6 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 UQ1 UBIQUINONE-1 × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 UQ9 Ubiquinone-9 × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
8XNS Respiratory complex Peripheral Arm of CI, close form B, focus-refined map of type IB, Wild type mouse under Cold Acclimation Deposited 2023-12-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain T 1–156（156 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 UQ9 Ubiquinone-9 × 2 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8XNT Respiratory complex Peripheral Arm of CI, close form C, focus-refined map of type IB, Wild type mouse under Cold Acclimation Deposited 2023-12-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain T 1–156（156 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 1 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
8XNU Respiratory complex Peripheral Arm of CI, open form A, focus-refined map of type IB, Wild type mouse under Cold Acclimation Deposited 2023-12-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain T 1–156（156 aa）	Not recorded	3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 SF4 IRON/SULFUR CLUSTER × 6 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 UQ9 Ubiquinone-9 × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8XNV Respiratory complex Peripheral Arm of CI, close form A, focus-refined map of type II, Wild type mouse under Cold Acclimation Deposited 2023-12-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain T 1–156（156 aa）	Not recorded	3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 3 SF4 IRON/SULFUR CLUSTER × 6 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 UQ1 UBIQUINONE-1 × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 UQ9 Ubiquinone-9 × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 1 CDL CARDIOLIPIN × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
8XNW Respiratory complex Peripheral Arm of CI, close form B, focus-refined map of type II, Wild type mouse under Cold Acclimation Deposited 2023-12-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain T 1–156（156 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 UQ9 Ubiquinone-9 × 2 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 1 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 1 CDL CARDIOLIPIN × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8XNX Respiratory complex Peripheral Arm of CI, open form A, focus-refined map of type II, Wild type mouse under Cold Acclimation Deposited 2023-12-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain T 1–156（156 aa）	Not recorded	3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 3 SF4 IRON/SULFUR CLUSTER × 6 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 UQ9 Ubiquinone-9 × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 1 CDL CARDIOLIPIN × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8XNY Respiratory complex Peripheral Arm of CI, open form B, focus-refined map of type II, Wild type mouse under Cold Acclimation Deposited 2023-12-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain T 1–156（156 aa）	Not recorded	3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 SF4 IRON/SULFUR CLUSTER × 6 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
8XNZ Respiratory complex Peripheral Arm of CI, close form A, focus-refined map of type I, PERK -/- mouse under Cold Acclimation Deposited 2023-12-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain T 1–156（156 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 UQ9 Ubiquinone-9 × 2 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 EHZ ~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate × 1 CDL CARDIOLIPIN × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
8XO0 Respiratory complex Peripheral Arm of CI, close form B, focus-refined map of type I, PERK -/- mouse under Cold Acclimation Deposited 2023-12-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 23 PDB declaration: 23-meric	Chain T 1–156（156 aa）	Not recorded	SF4 IRON/SULFUR CLUSTER × 6 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 CDL CARDIOLIPIN × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain w 1–156（156 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain w 1–156（156 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain w 1–156（156 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain w 1–156（156 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain w 74–152（79 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain w 1–156（156 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
9W2U Cryo-EM structure of complex I on the bovine heart submitochondrial particles, open Deposited 2025-07-28	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain T 72–156（85 aa）	Not recorded	FME N-FORMYLMETHIONINE × 6 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 11 SF4 IRON/SULFUR CLUSTER × 6 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 K POTASSIUM ION × 1 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 18 CDL CARDIOLIPIN × 6 CHD CHOLIC ACID × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1 MYR MYRISTIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9W2V Cryo-EM structure of complex I on the bovine heart submitochondrial particles, closed Deposited 2025-07-28	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain T 72–156（85 aa）	Not recorded	FME N-FORMYLMETHIONINE × 4 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 19 PC1 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 12 SF4 IRON/SULFUR CLUSTER × 6 FES FE2/S2 (INORGANIC) CLUSTER × 2 FMN FLAVIN MONONUCLEOTIDE × 1 K POTASSIUM ION × 1 CDL CARDIOLIPIN × 6 MG MAGNESIUM ION × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å

60 other PDB entries and 60 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ACPM_MOUSE
Isoform	—
PDB entities	51
Chains and sequence ranges	Author chain w； PDBConstruct 1–156； UniProt 1–156

Large ribosomal subunit protein mL44

OrganismNot specified

UniProt Q9CY73

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain c； UniProt 26–333	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain c 26–333（308 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain c 26–333（308 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain c 26–333（308 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain c 26–333（308 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain c 31–320（290 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different construct Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain c 31–333（303 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM44_MOUSE
Isoform	—
PDB entities	52
Chains and sequence ranges	Author chain c； PDBConstruct 1–308； UniProt 26–333

Large ribosomal subunit protein mL49

OrganismNot specified

UniProt Q9CQ40

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain g； UniProt 1–166	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain g 1–166（166 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain g 1–166（166 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain g 1–166（166 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain g 1–166（166 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain g 35–166（132 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain g 1–166（166 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM49_MOUSE
Isoform	—
PDB entities	53
Chains and sequence ranges	Author chain g； PDBConstruct 1–166； UniProt 1–166

Large ribosomal subunit protein mL53

OrganismNot specified

UniProt Q9D1H8

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain k； UniProt 1–118	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain k 1–118（118 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain k 1–118（118 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain k 1–118（118 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain k 1–118（118 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain k 1–118（118 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain k 1–118（118 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM53_MOUSE
Isoform	—
PDB entities	54
Chains and sequence ranges	Author chain k； PDBConstruct 1–118； UniProt 1–118

Large ribosomal subunit protein mL45

OrganismNot specified

UniProt Q9D0Q7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain d； UniProt 1–306	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain d 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain d 1–306（306 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain d 1–306（306 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain d 1–306（306 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain d 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain d 1–306（306 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM45_MOUSE
Isoform	—
PDB entities	56
Chains and sequence ranges	Author chain d； PDBConstruct 1–306； UniProt 1–306

Large ribosomal subunit protein mL46

OrganismNot specified

UniProt Q9EQI8

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain e； UniProt 1–283	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL62 × 1 （Q8R035） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain e 1–283（283 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain e 1–283（283 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain e 1–283（283 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain e 1–283（283 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain e 1–283（283 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain e 1–283（283 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

6 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RM46_MOUSE
Isoform	—
PDB entities	57
Chains and sequence ranges	Author chain e； PDBConstruct 1–283； UniProt 1–283

Large ribosomal subunit protein mL62

OrganismNot specified

UniProt Q8R035

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain p； UniProt 1–206	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） GTP-binding protein 10 × 1 （Q8K013） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1J26 Solution structure of a putative peptidyl-tRNA hydrolase domain in a mouse hypothetical protein Deposited 2002-12-25	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 63–161（99 aa） Fragment：peptidyl-tRNA hydrolase domain	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6；298 K；Ionic strength (raw mmCIF value) 120mM；Pressure ambient NMR sample composition 1.7mM peptidyl-tRNA hydrolase domain U-15N, 13C; 20mM phosphate buffer NA; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O \| 90% H2O/10% D2O	Resolution not provided
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain p 1–206（206 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å
9HCC Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, State A1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain p 1–206（206 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.67 Å
9HCD Mouse mitoribosome large subunit assembly intermediate (with uL16m) bound to MRM3-dimer, DDX28 and the MALSU-L0R8F8-mt-ACP complex, state A2 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 50 PDB declaration: 52-meric	Chain p 1–206（206 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.63 Å
9HCE Mouse mitoribosome large subunit assembly intermediate (without uL16m) bound to MRM3 dimer and the MALSU-L0R8F8-mt-ACP complex, State A3 (SAMC knock out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 49 PDB declaration: 51-meric	Chain p 1–206（206 aa）	Not recorded	ZN ZINC ION × 1 FES FE2/S2 (INORGANIC) CLUSTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.31 Å
9HCG Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out) Deposited 2024-11-08	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 57 PDB declaration: 59-meric	Chain p 38–190（153 aa）	Not recorded	MG MAGNESIUM ION × 105 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9HCH Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7 and the MALSU1-L0R8F8-mt-ACP complex, State C1 (SAMC knock-out) Deposited 2024-11-10	Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Heteromer；Protein × 56 PDB declaration: 58-meric	Chain p 1–206（206 aa）	Not recorded	MG MAGNESIUM ION × 99 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ICT1_MOUSE
Isoform	—
PDB entities	58
Chains and sequence ranges	Author chain p； PDBConstruct 1–206； UniProt 1–206

GTP-binding protein 10

OrganismNot specified

UniProt Q8K013

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 57 RNA 2 PDB declaration: 59-meric（59） Consistent with all polymer counts	Chain t； UniProt 1–366	Not recorded	16S rRNA (1432-MER) × 1 RNA (63-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m × 1 （Q9D1B9,Q9DCI9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL62 × 1 （Q8R035） MG MAGNESIUM ION × 99 FES FE2/S2 (INORGANIC) CLUSTER × 1 ZN ZINC ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.85 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9HCF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9E9C Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU1-L0R8F8-mt-ACP complex (without uL16m), State B1 (SAMC knock-out) Deposited 2024-11-08	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–RNA Heteromer；Protein × 56 PDB declaration: 58-meric	Chain t 1–366（366 aa）	Not recorded	MG MAGNESIUM ION × 95 ZN ZINC ION × 2 FES FE2/S2 (INORGANIC) CLUSTER × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	GTPBA_MOUSE
Isoform	—
PDB entities	59
Chains and sequence ranges	Author chain t； PDBConstruct 1–366； UniProt 1–366

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9hcf
Deposition date deposition_date	2024-11-08
Structure title title	Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, GTPBP7, GTPBP10 and the MALSU-L0R8F8-mtACP complex with uL16m, State B2 (SAMC knock-out)
Keywords keywords	mitochondria, ribosome assembly, large subunit, RIBOSOME; RIBOSOME
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	75.23 Å
Radius of gyration Rg (electron density) rg_electron	78.42 Å
Forward intensity I(0) i0	50847700000.00
Molecular weight molecular_weight	1571600.0 kDa
Excluded volume excluded_volume	1822000 Å³
Envelope volume envelope_volume	2996000 Å³
Hydration-shell volume shell_volume	295700 Å³
Envelope diameter envelope_diameter	255.6 Å
Shell Rg shell_rg	89.71 Å
Envelope Rg envelope_rg	77.54 Å
Shape Rg shape_rg	78.59 Å
Total Rg total_rg	78.01 Å
Total atoms total_atoms	202322
Residues n_residues	10909
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	277.1 Å
Rg (real space) rg_real	78.11 Å
Rg uncertainty (real space) rg_real_error	1.39 Å
I(0) (real space) i0_real	5.0850e+10
I(0) uncertainty (real space) i0_real_error	1.0910e+09
Rg (reciprocal space) rg_reciprocal	75.90 Å
I(0) (reciprocal space) i0_reciprocal	50940000000.0000
Solution quality estimate total_estimate	0.8792
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	92.4 Å
Skewness Skewness skewness	0.530
Kurtosis Kurtosis kurtosis	0.312
Angular range angular_range	— – 0.1050 Å⁻¹
Current regularization parameter α current_alpha	0.9109
Highest regularization parameter α highest_alpha	7288000000.0000
Real-space data points n_real_points	22
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.665; Stabil: 0.906; Sysdev: 1.000; Positv: 1.000; Valcen: 0.947; Smooth: 0.856

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (63)

Entity 1 Entity 1 polymer

Description description	16S rRNA (1432-MER)
Molecular weight formula_weight	508610.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	A
Atom count atom_count	202333

AACUAAUCCUAGCCCUAGCCCUACACAAAUAUAAUUAUACUAUUAUAUAAAUCAAAACAUUUAUCCUACUAAAAGUAUUGGAGAAAGAAAUUCGUACAUCUAGGAGCUAUAGAACUAGUACCGCAAGGGAAAGAUGAAAGACUAAUUAAAAGUAAGAACAAGCAAAGAUUAAACCUUGUACCUUUUGCAUAAUGAACUAACUAGAAAACUUCUAACUAAAAGAAUUACAGCUAGAAACCCCGAAACCAAACGAGCUACCUAAAAACAAUUUUAUGAAUCAACUCGUCUAUGUGGCAAAAUAGUGAGAAGAUUUUUAGGUAGAGGUGAAAAGCCUAACGAGCUUGGUGAUAGCUGGUUACCCAAAAAAUGAAUUUAAGUUCAAUUUUAAACUUGCUAAAAAAACAACAAAAUCAAAAAGUAAGUUUAGAUUAUAGCCAAAAGAGGGACAGCUCUUCUGGAACGGAAAAAACCUUUAAUAGUGAAUAAUUAACAAAACAGCUUUUAACCAUUGUAGGCCUAAAAGCAGCCACCAAUAAAGAAAGCGUUCAAGCUCAACAUAAAAUUUCAAUUAAUUCCAUAAUUUACACCAACUUCCUAAACUUAAAAUUGGGUUAAUCUAUAACUUUAUAGAUGCAACACUGUUAGUAUGAGUAACAAGAAUUCCAAUUCUCCAGGCAUACGCGUAUAACAACUCGGAUAACCAUUGUUAGUUAAUCAGACUAUAGGCAAUAAUCACACUAUAAAUAAUCUACCUAUAACUUCUCUGUUAACCCAACACCGGAAUGCCUAAAGGAAAGAUCCAAAAAGAUAAAAGGAACUCGGCAAACAAGAACCCCGCCUGUUUACCAAAAACAUCACCUCUAGCAUUACAAGUAUUAGAGGCACUGCCUGCCCAGUGACUAAAGUUUAACGGCCGCGGUAUCCUGACCGUGCAAAGGUAGCAUAAUCACUUGUUCCUUAAUUAGGGACUAGCAUGAACGGCUAAACGAGGGUCCAACUGUCUCUUAUCUUUAAUCAGUGAAAUUGACCUUUCAGUGAAGAGGCUGAAAUAUAAUAAUAAGACGAGAAGACCCUAUGGAGCUUAAAUUAUAUAACUUAUCUAUUAAAUUUAUUAAACCUAAUGGCCCAAAAACUAUAGUAUAAGUUUGAAAUUUCGGUUGGGGUGACCUCGGAGAAUAAAAAAUCCUCCGAAUGAUUAUAACCUAGACUUACAAGUCAAAGUAAAAUCAACAUAUCUUAUUGACCCAGAUAUAUUUUGAUCAACGGACCAAGUUACCCUAGGGAUAACAGCGCAAUCCUAUUUAAGAGUUCAUAUCGACAAUUAGGGUUUACGACCUCAAUGUUGGAUCAGGACAUCCCAAUGGUGUAGAAGCUAUUAAUGGUUCGUUUGUUCAACGAUUAAAGUCCUACGUGAUCUGAGUUCAGACCGGAGCAAUCCAGGUCGGUUUCUAUCUAUUUACGAUUUCUCCCAGUACGAAAGGACAAGAGAAAUAGAGCCACCUUACAAAUAAGCGCUCUCAACUUAAUUUAUGAAUAAAAUCUAAAUAAAAUAUAUACGUACACCCUCUAACCUAGAGAAGGUUA

Entity 2 Entity 2 polymer

Description description	RNA (63-MER)
Molecular weight formula_weight	21862.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	B

GUUAAUGUAGCUUAAUAACAAAGCAAAGCACUGAAAAUGCUUAGAUGGAUAAUUGUAUCCCAUAAACA

Entity 3 Entity 3 polymer

Description description	Large ribosomal subunit protein uL2m
Molecular weight formula_weight	27168.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

AKFVSWKSRTKYTVKPVKMRKSGGRDHTGRIRVHGIGGGHKQNYRMIDFLRFRPEKEKAPEPFEEKVVVVRYDPCRSADIALVAGGSRKRWIIATENMKAGDTILNSNHIGRMAVAAQEGDAHPLGALPVGTLINNVESEPGRGAQYIRAAGTCGVLLRKVNGTAIIQLPSKRQMQVLESCTATVGRVSNVNHNQRVIGKAGRNRWLGKRPNSGLWQRKGGWAGRKIRPLPPMKSYVKLPSAAAQN

Entity 4 Entity 4 polymer

Description description	Large ribosomal subunit protein uL3m
Molecular weight formula_weight	39170.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MPGWRLLAQAGARVLGCGARGLGADPGLERRKNILFFVRNLHSKSSTWWDEHLSEENLSFVKQLVSDENKTQLTSKLNPLKDEPWPLHPWEPGSFRVGLIALKLGMMPLWTKDGQKHAVTLLQVQDCHVLKYTPKEDHNGKIAALTVGGKTVSRFYKPDSRLEFYRDLGLPPKQIHKIFHVTDNAVIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMKRWGFKGQPASHGQTKTHRRPGAISTGDIARVWPGTKMPGRMGNQNRTVYGLKVWRVNTKHNIIYVNGSVPGHKNCLVKIKDSTLPAYKDSCKNLPFPTYFPDGDEEELPEDLFDESVWQPSEPSITFA

Entity 5 Entity 5 polymer

Description description	Large ribosomal subunit protein uL4m
Molecular weight formula_weight	33120.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MLRLFQAASRASLRLSGSRVIHSLAEGAERPAEISEPRDSAGLLDPVLRKCELRIPVHRRPVQAWVESLRGFEQERIGLAELHPDVFATAPRLDIVHQVAIWQRNFRRISYANTKTRAEVSGGGRKPWQQKGSGRARHGSIRSPLWRGGGVAHGPRGPTSYYYMLPMKVRALGLKVALTVKLMQDDLHIVDSLELPTADPQYLTELAQYRHWGSSVLLVDLTHEEMPKNVVAATSGLNSFNLIPAVGLNVYSMLKHQTLVLTLPSVAFLEDKLLWQDSRYTPLYPFRLPYSDFP

Entity 6 Entity 6 polymer

Description description	Large ribosomal subunit protein bL9m
Molecular weight formula_weight	30298.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MAASVAPGVRTLWWAGAAWLRQGGIRELFRPRIEGSTPGRDFSLSHYQSTVIVERWWKVPLAGEGRKPHLHRRHRVYKLVEDTKHRPKDNLELILTQSVDEIGVRGDLVSVKKSVGRNKLLSQGLAVYASPENRKLFEEEKSLRREGKLEKIQTKAGEATVKFLRSCHLEVGMKNNVKWELNPEIVARHFFKNLGVVVAPHALRLPEEPITRWGEYWCDVTVNGLDTVRVPMSVVLFQKPKTKRYKHWLAQQAAKSVAPTNPQAV

Entity 7 Entity 7 polymer

Description description	Large ribosomal subunit protein uL10m
Molecular weight formula_weight	29438.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MAAAVAGILRGGLPPRAAWLPTLQTVRHGSKAVTRHWRVMHFQRQKLMAITEYIPPKPAINPRCLPPPPKPPKEESGLVRLLRQDIVAVFRDNRMIAVCQNVALSAEDKLLLRHQLRKHKIFIKVFPSQVLKPFLENSKYRNLLPLFVGHNLLLVSEEPKVKEMVRVLKSVPFLPLLGGCVDDTILSRQGLVDYAKLPSLDQLQGQLVGGLTHLMAQTRYLLQHQPVQLTSLLDQYVKEQNEGDCATSANEKLHPPDPAPDA

Entity 8 Entity 8 polymer

Description description	Large ribosomal subunit protein uL11m
Molecular weight formula_weight	20714.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MSKLSRATRTLKKPEAGGVIRSIVRAGQAIPGPPLGPILGQRGVSINQFCKEFNEKTKDIKEGIPLPTKIFIKPDRTFELKIGQPTVSYFLKAAAGIEKGARHTGKEVAGLVSLKHVYEIACVKAKDDAFAMQDVPLSSVVRSIIGSARSLGIRVVKDLSAEELEAFQKERAVFLAAQKEADLAAQAEAAKK

Entity 9 Entity 9 polymer

Description description	Large ribosomal subunit protein uL13m
Molecular weight formula_weight	20707.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MSSFSRAPQQWATFARMWYLLDGKMQPPGKLAVIASNKLQGLNKPVYHQLSDCGDHVVIINTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHRKDPVAIVKLAIYGMLPKNLHRRTMMQRLHLFPDEDIPEDILKNLVEELPQPRRVPKRLDEYTQEEIEAFPRVWTPPDDFRM

Entity 10 Entity 10 polymer

Description description	Large ribosomal subunit protein uL14m
Molecular weight formula_weight	15900.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MAALTGLWGSFAHVSRAFSQRCFSTSGSLSAVQKMTRVRVVDNSALGSTPYHRPPRCIHVYNKSGVGKVGDQILLAIRGQKKKALIVGHRMPGSRMTPKFDSNNVVLIEDNGNPVGTRIKIPIPTSLRRREGEYSKVLAIAQNFV

Entity 11 Entity 11 polymer

Description description	Large ribosomal subunit protein uL15m
Molecular weight formula_weight	33595.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MAGTARGCGTSLDLLRSLPRVSLANLKPSPNSRKRERRPRDRRRGRKCGRGHKGERQRGTRPRLGFEGGQTPFYIRIPKYGFNEGHSFRHQYQPLSLRRLQYLIDLGRVDPTQPIDLTQLVNGRGVTIQPLKRDYGVQLVEEGADTFQAKINIEVQLASELAIAAIEKNGGVVTTAFYDPRSLEILCKPIPFFLRGQPIPKRMLPPESLVPYYTDAKNRGYLADPAKFPEARLELAMKFGYVLPDITKDELFRMLSARKDPRQIFFGLAPGWVVNMADKKILKPTDENLLKYYSS

Entity 12 Entity 12 polymer

Description description	Large ribosomal subunit protein uL16m
Molecular weight formula_weight	28850.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MWRLLTRVPAPLLRMHFSDSWAALPTSAGLKTLLPVPTFENVSIPERSKLKFVERVPLVPKVRREPKNLKDIRGPSTEATDFTEGNFAILALGGGYLHWGHFEMMRLTINRFMDPKNMFAIWRVPAPFKPITRKGVGQRMGGGKGAIDHYVTPVKTGCLVVEMGGRCEFEEVKGILNQVAHKLPFPAKAVSRKTLERMHQNQRERELNNQNPWTFEHIATANMFGIRKFLSPYDLTQKGRYWGKFYMPKRV

Entity 13 Entity 13 polymer

Description description	Large ribosomal subunit protein bL17m
Molecular weight formula_weight	20282.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MRLSLAAAISHGRVYRRLGLGPESRIHLLRNLLTGLVRHERIEATWARADEMRGYAEKLIDYGKLGDTNERAMRMADFWLTEKDLIPKLFKVLAPRFQGQNGNYTRMLQIPNRKEQDRAKMAVIEYKGNYLPPLPLPHRDSNLTLLNQLLLGLQQDLHHNQDASLHSSCTVQTPKT

Entity 14 Entity 14 polymer

Description description	Large ribosomal subunit protein uL18m
Molecular weight formula_weight	20707.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MALRPRFWKCLSVCRKLECGFAALSTSSVPAVQPDVESKENEAVAPEFTNRNPRNLELLGVARKERGWATVWPNREFWHRLRVVKTQHHVEAFVEHLNGQVVVSASTREWAIKKHLYSTRNVVACESIGRVLAQRCLEAGINFMVYQPTPWEASSDSIKRLQNAMTESGVMLREPRRIYE

Entity 15 Entity 15 polymer

Description description	Large ribosomal subunit protein bL19m
Molecular weight formula_weight	33629.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MAASMAESCRASLYLARSVRMARPRLAAFASDACRVCTGPSRFQSTGPSEPGGFKPPPKPVIVDRRRVPEDERRFLSPEFIPPRGRTNPLKFKIERKDMLDRRKVLPIPEFYVGSILRVTTADPYASGKTSQFLGICIKRSGNGLGATFTLRNTIEGQGVEICFELYNPRIQEIQVVKLEKRLDDNLLYLRDALPEYSTFDVNMKPVPQEACQEVPVNKLKVKMKPKPWSKRWERPNFNIKGIRFDLALTEEQMKEAQKWNKPWIEFDMMREYDTSKIEAALWEEIEASKKS

Entity 16 Entity 16 polymer

Description description	Large ribosomal subunit protein bL20m
Molecular weight formula_weight	17631.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MVFLTTRLWLRNRLTDRYWRVQEVLKHAQHFRGRKNRCYRLAVRAVTRAFVKCTKARRLKKRNLRTLWINRITAASQEHGLKYPAFIVNLIKCQVELNRKVLVDLAIYEPKTFKSLAALAKRRQQEGFAAALGDGKEPEGIFSRVVQYH

Entity 17 Entity 17 polymer

Description description	Large ribosomal subunit protein bL21m
Molecular weight formula_weight	23401.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MAAAIAASALPGAFGRLVSVCSRSILASQGSGSASLWSASRRFNSQSASYPQGYVPKTSLSSPPWQEVVLPDPVEETRHHAEVVKRVNELIATGQYGRLFAVVHFASHQWKVTAEDLILIENELDIKCGERIRLEKVLLVGADNFTLLGKPLLRKELVRVEATVIEKTESWPKINMKFRKRKNFRKKKIIVNPQTILRINTIEIAPRLL

Entity 18 Entity 18 polymer

Description description	Large ribosomal subunit protein uL22m
Molecular weight formula_weight	23847.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MAAALLRELGALRVPNLRIWATQTLRVLPPSCIHTSASLDISRKWEKKNKIVYPPQLPGEPRRPAEIYHCRRQIKYSKDKMWYLAKMIRGMSIDQALAQLEFNDKKGAQIIKEVLLEAQDMAVRDHNVEFRSNLHIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPPEVPKTAVDHAKDYIQQLRSRTIIHTL

Entity 19 Entity 19 polymer

Description description	Large ribosomal subunit protein uL23m
Molecular weight formula_weight	17145.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MARNVLYPLYQLGGPQLRVFRTNFFIQLVRPGTAQPEDTVQFRIPMEMTRVDLRNYLEQIYNVPVAAVRTRVQHGSNRRRDHKNVRIKKPDYKVAYVQLAHGQTFTFPDLFPEKDPRSPEPLEEELPQQRQSSDLRCPGIPSWFGL

Entity 20 Entity 20 polymer

Description description	Large ribosomal subunit protein uL24m
Molecular weight formula_weight	24986.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MRLSALLALASKATSSPFYRYGMSRPGSIADKRKNPPWSRRRPVVVEPISDEDWHLFCGDMVEILEGKDAGKQGKVVQVVRQRNWVVLEGLNTHYRYIGRTKDHRGTMIASEAPLLHHQVKLVDPVDRKPTEIQWRFTEAGERVRVSTRSGRIIPKPEFPRADGIVPETWTDGPKDTSVEDALERTYVPRLKTLEEDVMEAMGIQETRRFKKVYWY

Entity 21 Entity 21 polymer

Description description	Large ribosomal subunit protein bL27m
Molecular weight formula_weight	15973.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MAAAALTLRTRAAVTALLSPTAPTALAVRHASKKTGGSSKNLGGKSRGKHYGIKKMEGHYVHAGNILGTQRQFRWHPGAHVGLGRNKCLYALEEGIVRYTKDVYVPNPKNTEAVDLVTSLPKGAVLYKTFVHVVPAKPEGTFKLVDML

Entity 22 Entity 22 polymer

Description description	Large ribosomal subunit protein bL28m,Large ribosomal subunit protein bL32m
Molecular weight formula_weight	34560.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MPLHRYPVHLWQKLRLRQGICARLPAHFLRSLEEERTPTPVHYKPHGTKFKINPKNGQRERVEDVPIPVHYPPESQQGLWGGEGLILGYRYANNDKLSKRVKKVWKPQLFTRELYSEILDKKFTVTVTMRTLDLIDEAYGFDFYILKTPKEDLGSKFGMDLKRGMLLRLARQDPHLHPENPERRAAIYDKYRSFVIPEAEAEWVGLTLEEALEKQRLLEEKDPVPLFKVYVEELVQRLQEQVLSRPAVVQKRAGDHAPSVETMVLYTGEKPSEKDQGKRIVERNIKRPSWFTQN

Entity 23 Entity 23 polymer

Description description	Large ribosomal subunit protein uL29m
Molecular weight formula_weight	29786.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MAATSLVGICRRASAFLKAACSLVNPKDAAHSGCRSSLSLLHKNTPHVTSFLQCKLLHTTLSRKGLEEFFDDPKNWGEEKVKSGASWTCQQLRNKSNEDLHKLWYVLLKERNMLLTLEQEAKRQRLPMPSPERLEKVVDSMDNVDKVVQEREDALRLLQTGQEKPRPGAWRRDIFGRIVWHKFKQWPIPWYLNKRYNRRRFFAMPYVDRFIRLRIEKHARIEARKRSLQKKKEKILHAKFPHLSQERKSSSV

Entity 24 Entity 24 polymer

Description description	Large ribosomal subunit protein uL30m
Molecular weight formula_weight	18380.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MAGVLRSAFPRPPCRLQTVKKGAESLIGTEWIRHKFTKSRIPDKVFQPKPEDHEKYGGDPQNPHKLHIVTRIRSTKRRPYWEKDTIKMLGLQKAHSPQIHKNIPSVNAKLKVVKHLIRIQPLKLPQGLPTEETMSSTCLKSTGELVVQWHLKPVEQEAKS

Entity 25 Entity 25 polymer

Description description	5-cytosine rRNA methyltransferase NSUN4
Molecular weight formula_weight	42904.3 kDa
EC 编号 ec_number	2.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x

MAAPVLRCVRKLLKLVDFTPVPRRYRYKKKWATTEPQFTASRLALQNFDMTYSVQFGDLWPSIRVSLLSEQKYGALVNNFAAWDSVSAKLEQLSAKDFVSEAISHQKLEPESGLSPTPSLDCSPNLRCFTFSRGDVSRFPPARLGSLGLMDYYLMDAASLLPVLALGLQHGDTVLDLCAAPGGKTLALLQTGCCRNLAANDLSTSRTGRLQKVLHSYVPQDIREGNQVRVTSWDGRKWGELEGDTYDRVLVDVPCTTDRHSLHEEENNIFQRSRKKERQMLPMLQVQLLAAGLLATKPGGHVVYSTCSLSHLQNEYVVQGAIELLANQYNIKVQVEDLSHFRKLFMDTFCFFPSCQVGELVIPNLMVNFGPMYFCKLHRLP

Entity 26 Entity 26 polymer

Description description	Large ribosomal subunit protein bL33m
Molecular weight formula_weight	7431.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

MLLSAVSFAKSKSKTILVKLVSQAGTGFSFNHKRSRLREKLSLLHYDPIVNKKVLFVEQKKIRSL

Entity 27 Entity 27 polymer

Description description	Large ribosomal subunit protein bL34m
Molecular weight formula_weight	10552.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MAFLARCFGCQACRSVALLSGRYLQSRVWMGLPDSWPLLSLQQARGRARGNEYQPSNIKRKHKHGWVRRLSTPAGVQVILRRMLKGRKSLSH

Entity 28 Entity 28 polymer

Description description	Large ribosomal subunit protein bL35m
Molecular weight formula_weight	21546.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MAASIFTGAVRAASGIFRPLNVLASSTYRNCARNACLNSSLCTIHFRHIQTSVVSSAPRLVTSVGHLAYGHTTTVLNRVATLVPSVLKPPVRALTYCSTRKGKRKTVKSVVHRFLRLHSGLWLRRKAGYKKKLWKKSTARKKRLREFVFCSKTQSKLLDKMTTSFWKRRNWYAGDPYQMYHDRTNLRV

Entity 29 Entity 29 polymer

Description description	Large ribosomal subunit protein bL36m
Molecular weight formula_weight	11439.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

MAALLVRSVVASVVDPFLHLSRLAVKPRVFSSFLLGTLPRAKPCAEVRSVLCGRPLPTLLPSLGFKTKGVIKKRCKDCYKVKRRGRWFILCKTNPKHKQRQ

Entity 30 Entity 30 polymer

Description description	Large ribosomal subunit protein mL38
Molecular weight formula_weight	45099.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MAAPWWRAAFFGIGRCRGFSTSAFLSRRTPPLGPMPNEDIDVSNLERLEKYRSFERYRRRAEQEARAPHWWRTYREHFVKETDPKDKIDIGLPPPRVSRTQKLLERKHFLRELRANVEEERAARLRTASIPLEAVRAEWERTCGPYHKQRLAEYYGLYRDLFHGATFVPWVPLHVAYAVGEEDLIPVYHGNEVTPTEASRAPEVTYEADKDSLWTLLFINLDGHLLEPDAEYVHWLLTNIPSNRVAEGQETCPYLPPFPARGSGFHRFAFLLFKQDKPINFSEDTRPSPCYQLAQRTFRTFDFYKRHQEAMTPAGLAFFQCRWDDSVTHTFHQLLDMREPVFEFVRPPPYHPKQKRFPHEQPLRYLDRYRDSHEPTYGIY

Entity 31 Entity 31 polymer

Description description	Large ribosomal subunit protein mL39
Molecular weight formula_weight	38603.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

MATAVGRLVLRRPGAGGGARWRFIATSPAAELSPTELTEMRNDLFNREKSRQLSLTPRTEKIEVKHVGKTDPGTVFVMNKNISTPYSCAMHLSEWYCSKSILALVDGQPWDMYKPLTKSCEIKFLTFKDPDPKEVNKAYWRSCAMMLGCVIERAFKDDYVVSLVRAPEVPVIAGAFCYDVTLDKRLDEWMPTKENLRSFTKDAHALIYRDLPFETLDVDARVALEIFQHNKYKVDFIEEKASQNPERIVKLHRIGDFIDVSEGPLIPRTSVCFQYEVSAVHNLNPSQPNLIRRFQGLSLPTHLRAQFTIWDKLVERSRKMVTEDEVRQTENTESTQ

Entity 32 Entity 32 polymer

Description description	Large ribosomal subunit protein mL43
Molecular weight formula_weight	17905.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MTGRGTSSRFLTSVLHNGLGRYVQQLQRLSLSLSRDAPSSRGAREFVEREVTDFARRNPGVVVYVNPRPCAMPRIVAEYLNGAVREENVNSKSVEEIKSLVQKLADQSGLDVIRIRKPFHTDNPSIQGQWHPFTNKRTALHGLRPRELRDSAPASMQAQ

Entity 33 Entity 33 polymer

Description description	Large ribosomal subunit protein mL48
Molecular weight formula_weight	23989.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

MSGTLGKVLGVWTNTVSKQGFSLLRFRSLGENPIFSAGGILWTSRHYKTKPTHGIGRYRHLVKVQEPKKKKAKVELRAINVGTDYEYGVLNIHLTAYDMSLAESYAQYVHRLCNRLSIKVEESYAMPTKTMEVMRLPDQGNKMVLDSVLTTHERVVQISGLSATFAEIFLEVLQSNLPEGVRLSVREHTEEDFKGRFKARPELEELLAKLN

Entity 34 Entity 34 polymer

Description description	Large ribosomal subunit protein mL50
Molecular weight formula_weight	18241.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

MAALIVSRLARRGWLWKLPLATRREFWSRSRKEKEPVVAETVEEVKKEPVLVCPPLRSRAYTPPSDLQSRLESHIKEVLGSSLPNNWQDISLDDGHMKFRLLAGLADGLGHAVPNSRLHQMCRVRDVLDFYNVPVQDKSKFDELVASNLPPNLKISWSY

Entity 35 Entity 35 polymer

Description description	Large ribosomal subunit protein mL51
Molecular weight formula_weight	15132.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

MAGSVPWAASRRLWGWVPSACRSFSLGVPRLAFVRLTLPPPKVVDRWNEKRALFGVYDNIGILGNFEKHPKELIKGPVWLRGWRGNELQRCVRKKKFVGNRMFIEDLHNLNKRISYLYKHFNRHGKYR

Entity 36 Entity 36 polymer

Description description	Large ribosomal subunit protein mL52
Molecular weight formula_weight	13681.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

MAALGTWLSSVRRLHCSVVARAGGQWRLQQGLAANPSGYGPLTELPDWSFADGRPAPPMKGQLRRKAQREKLARRVVLLTQEMDAGIQAWKLRQQKLQEERKKEHDLKPKGTLLRSPLPNQ

Entity 37 Entity 37 polymer

Description description	Large ribosomal subunit protein mL63
Molecular weight formula_weight	11974.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o

MFLTAVLLRGRIPGRQWIGKHRRPRTVSFQAKESMIRRLEVEAENHYWLSMPYMTAEQECGHAAERRAQAFEAIKAAATSKFPKHRYIADQLDHLNISKKWS

Entity 38 Entity 38 polymer

Description description	Large ribosomal subunit protein mL64
Molecular weight formula_weight	25865.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q

MAALAMRSGYLLRLSVALGPRSRSYRAPPPPRRRPGPHSPDPENLLTPRWQLTPRYVAKQFGRHGAISGVPPASLWPTPEQLRELEAEEQEWYPSLATMQESLRLQQQALEARRQAREQRIAECMAKMPQMIENWRKQKRERWEKIQADKERRARLQAEAQERLGYHVDPRSARFQELLQDLDKQQRKRLKEERQRQKKEARIAAMASAEAQDSAVSGEPSS

Entity 39 Entity 39 polymer

Description description	Large ribosomal subunit protein mL66
Molecular weight formula_weight	22363.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r

MAALRRLVSGCGRQLQAFLAGPAATGWLWLPARGLREVVKIQEGKTTVIEGRITETPKATPDPPNPSGQCPICRWNLKHKYTYEDVLLLSQFIRPYGGMLPRRVTGLCREEHRKIEECVKMAHRAGLLPNHRPQLPEGCLPKDKPKLNRYLTRWAPKSVKPIYKKGHRWNKVGMAVGSPLLKDNVCYSRRPLKMMH

Entity 40 Entity 40 polymer

Description description	Large ribosomal subunit protein mL65
Molecular weight formula_weight	50005.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s

MAAARYWKLVPRGRGLSQNAAAKASATAPEVRDLEVVATPVARYPPIVASMTADSKAARQRRVQRWQATVHAAPSVDEKIRILTKMQFKKYVVHPQISALNADRWYQSFTKTVFVSGLPPAPALSPPPPSLDLAALRAAVCDCILQEQVYVRRRRPRSLFDRRQALASSILDQVVRTLVNLLAPLNPVLSTAALDCKRSVDFYWLRGEERIPAGHRKGHIDALRYQINDKPHNQIRISKQLPEFVPLDYSIPTEIPVMKCKPDKLPLFRRQYENSIFTGSKTADPCCYGHTQFHLIPDRLKRERLIRQNQAEQVEAVFRANAIASLFAWTGAQAMYQGFWSEADVTRPFVSQAVITDGKYFSFFCYQLNTLALTVQADQNNPRKNLCWGSQSQPLYETVEDNDVKGFDDGTLLQIVHFLLNKPREDGAQLLASQEKELDLGP

Entity 41 Entity 41 polymer

Description description	Mitochondrial assembly of ribosomal large subunit protein 1
Molecular weight formula_weight	26055.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	u

MGPGWSPARRLWPLLWRRAVFQRAGPAMASVPWLPRLAERWLPARPATCLTPSLTRGLHHGPQPEERTAGDARLQPGPADHIGAKFDIDMLVSLLRQENARDICVIQVPPEMRYTDYFVIGSGTSTRHLHAMVHYLVKMYKHLKCRSDPYVKIEGKDADDWLCVDFGSMVIHLMLPETRETYELEKLWTLRSFDDQLAQIAAETLPEDFILGLEDDTSSLTPVEFKCK

Entity 42 Entity 42 polymer

Description description	Predicted gene, 55359
Molecular weight formula_weight	8444.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	v

MAPWSREAVLCLYRALLRQGRELRYTDRDFYFASIRREFRKNQKLENLEAREKQLEKGLVFLHSKLGGLI

Entity 43 Entity 43 polymer

Description description	Large ribosomal subunit protein mL37
Molecular weight formula_weight	48407.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

MALASGPALRALAGSGRLGLGGYGTPKRGAYEWGVRSTRKPEPRPLDRVYEIPGLEPITYEGKKHFVPWLARPIFPPWERGWNDPRFHRAAPIHEQTLYKEEPCYIFHQRCRLLEGMKQALWLTKTKLIEGLPKKVLSLVDDPANHIENQEQRVLDIISHARLWHSTEDIPKRETYCPLIVDSLIQLCKSQILKHPSLARRTSAQNCTLATTWNRESLLLQVRGTSSTILSAKDPLPVIASREEVEATRSHVLETFYPISPTIDLQECHVYEVKDDTGFQEGYPYPHPHTLYFLEKANLRPQRFLPEQLRAKMLLFAFANALAQARLLYGNTAKVLEQPIVVQSVGTDGRVFQFLVLQLNTTDLASSEGVKNLVWTDSDQLLYRHFWCRPVIKKKVVVEPVGPVDFQPETFRKFLALYLHGVV

Entity 44 Entity 44 polymer

Description description	Large ribosomal subunit protein mL40
Molecular weight formula_weight	24347.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

MATGVMLCAARALRPRSWIPGTCQAHVRHTHQRASLLAFWDLIPMRAEPLRKKKKVDPRKDQAAKDRLKKRIRKLEKASQELIPIEDFITPVRFLDKSRQRPQEEHSPEESERRALLLKRWALFKQQEHEMERDAIRSMLEAQQEALEELKLESAELYAEAIKRDTSLFPFEKEGPHYTPPISNYQAPEGRYNDITKVYTQVEFKR

Entity 45 Entity 45 polymer

Description description	Large ribosomal subunit protein mL41
Molecular weight formula_weight	15284.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	9

MGFLTAVTQGLVRGADRMSKWTSKRGPRTFTKSRGAKKTGIYTSDRKFVQIKEMVPEFVVPDLTGFKLKPYVNYRAPAGIDTPLTAKALFQETVAPAIEKDFKEGTFDANNLEKYGFEPTQEGKLFQLYPKNFPR

Entity 46 Entity 46 polymer

Description description	Large ribosomal subunit protein mL42
Molecular weight formula_weight	16521.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MAAAVKWAISNRTIWKHLLPIQNGALSSACHKSTYSSLPDDYNCQVDLALTADGRTIVCYHPSVDIPYEHTKPIPQPDLLHNNEETHEQILKAKLEVRKSKQLEQGPMIEQLSKVFYTTKHRWYPHGQYHNRRKKLNPPRDR

Entity 47 Entity 47 polymer

Description description	Large ribosomal subunit protein mL55
Molecular weight formula_weight	15152.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m

MPLAILLSLLRHCGVRAALPTPRHLHTSPWRADCSRASLTRLRRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPLDLDALSPEERRARFRKREAQLQQKREEEPEVVDSFDTERYKQFWTKTKK

Entity 48 Entity 48 polymer

Description description	Mitochondrial ribosome-associated GTPase 1
Molecular weight formula_weight	36732.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	z

MRLWPQAWGAVRGAWRECFPLQGHDVARWFPGHMAKGLKKMQSSLKSVDCVIEVHDARIPFSGRNPLFQELLGLKPHLLVLNKMDLADLTEQQKIVQRLEEKGLSNVLFTNCVKDENIKQIVPKVMELIRCSYRYHRAETPEYCIMVVGVPNVGKSSLINSLRRQHLRTGKAARVGGEPGITRAVTSRIQVCERPLVFLLDTPGVLAPRIESVETGLKLALCGTVLDHLVGEETMADYLLYTLNRHGLFGYVQHYALASACDQIEWVLKNVAIKLRKTRKVKVLTGTGNVNVIQPDYAMAARDFLRTFRSGLLGQVMLDRDIIPAC

Entity 49 Entity 49 polymer

Description description	Large ribosomal subunit protein mL54
Molecular weight formula_weight	15450.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l

MAAAHLLRASRVWARWHPRALPVLRRPGGFSIREYAKKPVGKGGKGGVAAEALKDPEVCTDPTQLTTHAMGVNIYKEGQDVALKADSEYPTWLFQVNLGPPKKLEELEPESREYWRLLRKQNIWRHNRLSKNKKL

Entity 50 Entity 50 polymer

Description description	Transcription termination factor 4, mitochondrial
Molecular weight formula_weight	40306.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	y

MASLGRQVPEWHRLLALSWACLVRQTPHLREQKQMSPSLSCKLTTVPGRGSFQEFSSITPQKYMQEPENRTRLVQCLHEEQKPCVDPESLEPEKVIRSLQDMGFAEAHIHSLFSIQPSVHPQQLLGIVSELLLLGLNPEPVFNALKKNPQLLKLSSMQMKRRSSYLRKLGLGEGKLKRVLSVCPEVFTMHQRDIDRVVKVLREKCLFTAQHITDVLHRCPTVLQEDPNELEYKFQYAYFRMGLTHLDIVRTNFLQYSITKIKQRHIYLERLGRYQTPDKKGQTQIPNPSLRNILRVSEAEFLARTACSSVEEFQVFKKLLDQEEEEESESHASEEEEEEEEEEELL

Entity 51 Entity 51 polymer

Description description	Acyl carrier protein, mitochondrial
Molecular weight formula_weight	17390.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	w

MASRVLCACVRRLPAAFAPLPRLPTLALARPLSTTLCPEGIRRRPGALQSALALAQVPGTVTHLCRQYSDAPPLTLDGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE

Entity 52 Entity 52 polymer

Description description	Large ribosomal subunit protein mL44
Molecular weight formula_weight	34912.0 kDa
EC 编号 ec_number	3.1.26.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

PPVRGVKKGFRAAFRFQKELERWRLLRCPPPPVRRSEKPNWDYHAEVQAFGSRLQETFSLDLLKTAFINSCYIKSEEAKRQSLGIEKEAALLNLKDNQELFEQGLSFSHRCLTQFLEDEFPDLPAEGTESLVSFLTGEAVVCHVARNLAVEQLTLSAEFPVPLPVLRQTFFAVIGALLQSSGPERAALFIRDFLITQMTGKELFEMWTVVNPMGLLVEELKKRNISAPESRLTRQSGSTTALPLYFVGLYCDRKLIAEGPGETVLVAEEEAARVALRKLYGFTENRRPWDYSKPKESPKRAEQTSVAS

Entity 53 Entity 53 polymer

Description description	Large ribosomal subunit protein mL49
Molecular weight formula_weight	19161.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

MAAAVLRAALQDWRSCLGRSYGRRKLSQTQGPPDNPGFVESVDEYQFVERLLPPTKIPEPPKHKHYPTPSGWQPPRDPLPSLPYFVRRSRMHNIPVYKEITHGNRQMTLIRKVEGDIWALQKDVEEFLSPLLGKTPITQVNEVTGTLRIKGYFDEQLKAWLLEKGF

Entity 54 Entity 54 polymer

Description description	Large ribosomal subunit protein mL53
Molecular weight formula_weight	12756.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

MAAALARLGLRPVKLVRVQFCPFEKNVESTRTFLQTVSSEKVRATNLNCSVIADVRHDGSEPCVDVLFGDGYRLIMRGAHLTTQEMLSALASHIRDRNAAAASAPGADKVAPGTSTRR

Entity 55 Entity 55 polymer

Description description	Large ribosomal subunit protein bL32m
Molecular weight formula_weight	21766.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0

MAPSLLLLSLPWPVRPGPLQRCWELLQRQLQQSWSRFVSPPWAPALAVQRPSILTELAHDTCENKENSSFLDSIFWMAAPKNRRTIEVNRCRRRNPQKLIKIKNNIDICPECGHLKQKHVLCGYCYEKVRQETTKIRQQIGAQEGGPFRAPSVETMVLYTGEKPSEKDQGKRIVERNIKRPSWFTQN

Entity 56 Entity 56 polymer

Description description	Large ribosomal subunit protein mL45
Molecular weight formula_weight	35463.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MAAPVPRGLSSLYRTLGWWSRQPILVTQSTTVVQVKTKSRFRPPTPEPKYKTEKEFLEYARKAGLVIPQERLERPIHLACTAGIFDPYVPPEGDARMSSLSKEGLTQRTERLRKNAASQLAIRKIREFDANFKTKDFPEKAKDIFIEAHLCLNNSDHDRLHTLVTEHCFPDMVWDLKYKTVRWGFVESLEPAQVVHVRCSGLVNQSNMYGQVTVRLHTRQTLAIYDRFGRLMYGQEDVPKDVLEYVVFERHLMNPYGSWRMHAKIVPAWAPPKQPILKTLMIPGPQLKPWEEYEETQGEAQKPQLA

Entity 57 Entity 57 polymer

Description description	Large ribosomal subunit protein mL46
Molecular weight formula_weight	32175.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

MAAPVGRTLLGLARGWRQLDRFWAGSSRGLSLEAASSSSRSPWRLSGALCLQRPPLITKALTPLQEEMAGLLQQIEVERSLYSDHELRALDEAQRLAKKKADLYDEEQEQGITLAQDLEDMWEQAFLQFRPGARETEADKKNDRTSLHRKLDRNLVLLVREKLGDQDVWMLPQVEWQPGETLRGTAERILATLSENNMEAKFLGNAPCGHYKFKFPKAIQTESDLGVKVFFFKALLLTGDFVQAGKKSRHVWASKEELGDYLQPKYLAQVRRFLLDSDGLSCL

Entity 58 Entity 58 polymer

Description description	Large ribosomal subunit protein mL62
Molecular weight formula_weight	23519.0 kDa
EC 编号 ec_number	3.1.1.29
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p

MATAWGLRWGLSRTGTLLLAPPARCARRALHRQVDGTTFQSIYSLDKLYPESKGADTAWKVPEHAKQASSYIPLDRLSISYCRSSGPGGQNVNKVNSKAEVRFHLASADWIEEPVRQKIALTHKNKINKAGELVLTSESSRYQFRNLAECLQKIRDMIAEASQVPKEPSKEDARLQRLRIEKMNRERLRQKRLNSALKTSRRMTMD

Entity 59 Entity 59 polymer

Description description	GTP-binding protein 10
Molecular weight formula_weight	40200.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	t

MVRCGCALLRKYGNFIDNLRIFTKGGSGGMGYPRLGGEGGRGGDVWVVAHKNMTLKQLKNKYPQKRFVAGGGANSRVSALQGSKGKDCEVPAPVGISVTDENGQVLGELNKEEDRVLVAKGGLGGKLHTNFLPLKGQKRIVHLDLKVIADVGLVGFPNAGKSSLLSRVSHATPVIADYAFTTLRPELGKIMYNDFKQISVADLPGLIEGAHMNKGMGHKFLKHLERTRQLLFVVDISGFQLSSVTPYRTAFETIILLTKELELYKEELQTKPALLAINKMDLPDAQVKLQELMKQLLSPEDFLHLFETKMIPEKALEFQHIVPISTVTGEGIAELKSCIRKALDEQDGKESDAHRSKQLLNLQSSS

Entity 60 Entity 60 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	99

Entity 61 Entity 61 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 62 Entity 62 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 63 Entity 63 non-polymer

Description description	PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
Molecular weight formula_weight	522.2 kDa
Source method src_method	syn
Copy count entity_count	2

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.85 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	55461

fit	/app/data/saxs_computation/hc/9hcf/9hcf.fit
pddf	/app/data/pr_computation/hc/9hcf/9hcf.pr.out
profile	/app/data/saxs_computation/hc/9hcf/9hcf.dat