9hcg

Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Large ribosomal subunit protein uL2m

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM02_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–246； UniProt 61–306

Large ribosomal subunit protein uL3m

OrganismNot specified

UniProt Q99N95

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM03_MOUSE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–308； UniProt 41–348

Large ribosomal subunit protein uL4m

OrganismNot specified

UniProt Q9DCU6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM04_MOUSE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain F； PDBConstruct 1–250； UniProt 45–294

Large ribosomal subunit protein bL9m

OrganismNot specified

UniProt Q99N94

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM09_MOUSE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain H； PDBConstruct 1–95； UniProt 50–144

Large ribosomal subunit protein uL10m

OrganismNot specified

UniProt Q3TBW2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM10_MOUSE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain I； PDBConstruct 1–262； UniProt 1–262

Large ribosomal subunit protein uL11m

OrganismNot specified

UniProt Q9CQF0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM11_MOUSE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain J； PDBConstruct 1–175； UniProt 18–192

Large ribosomal subunit protein uL13m

OrganismNot specified

UniProt Q9D1P0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM13_MOUSE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain K； PDBConstruct 1–177； UniProt 2–178

Large ribosomal subunit protein uL14m

OrganismNot specified

UniProt Q9D1I6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM14_MOUSE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain L； PDBConstruct 1–115； UniProt 31–145

Large ribosomal subunit protein uL15m

OrganismNot specified

UniProt Q9CPR5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM15_MOUSE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain M； PDBConstruct 1–287； UniProt 9–295

Large ribosomal subunit protein uL16m

OrganismNot specified

UniProt Q99N93

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM16_MOUSE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain N； PDBConstruct 1–222； UniProt 30–251

Large ribosomal subunit protein bL17m

OrganismNot specified

UniProt Q9D8P4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM17_MOUSE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain O； PDBConstruct 1–153； UniProt 9–161

Large ribosomal subunit protein uL18m

OrganismNot specified

UniProt Q9CQL5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM18_MOUSE
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain P； PDBConstruct 1–141； UniProt 39–179

Large ribosomal subunit protein bL19m

OrganismNot specified

UniProt Q9D338

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM19_MOUSE
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain Q； PDBConstruct 1–217； UniProt 74–290

Large ribosomal subunit protein bL20m

OrganismNot specified

UniProt Q9CQL4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM20_MOUSE
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain R； PDBConstruct 1–140； UniProt 10–149

Large ribosomal subunit protein bL21m

OrganismNot specified

UniProt Q9D1N9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM21_MOUSE
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain S； PDBConstruct 1–159； UniProt 50–208

Large ribosomal subunit protein uL22m

OrganismNot specified

UniProt Q8BU88

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM22_MOUSE
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain T； PDBConstruct 1–166； UniProt 41–206

Large ribosomal subunit protein uL23m

OrganismNot specified

UniProt O35972

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM23_MOUSE
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain U； PDBConstruct 1–145； UniProt 2–146

Large ribosomal subunit protein uL24m

OrganismNot specified

UniProt Q9CQ06

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM24_MOUSE
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain V； PDBConstruct 1–207； UniProt 10–216

Large ribosomal subunit protein bL27m

OrganismNot specified

UniProt Q99N92

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM27_MOUSE
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain W； PDBConstruct 1–100； UniProt 49–148

Large ribosomal subunit protein bL28m

OrganismNot specified

UniProt Q9D1B9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM28_MOUSE
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain X； PDBConstruct 1–242； UniProt 2–243

Large ribosomal subunit protein uL29m

OrganismNot specified

UniProt Q8K2Y7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM47_MOUSE
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain Y； PDBConstruct 1–176； UniProt 65–240

Large ribosomal subunit protein uL30m

OrganismNot specified

UniProt Q9D7N6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM30_MOUSE
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain Z； PDBConstruct 1–121； UniProt 35–155

5-cytosine rRNA methyltransferase NSUN4

OrganismNot specified

UniProt Q9CZ57

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NSUN4_MOUSE
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain x； PDBConstruct 1–345； UniProt 37–381

Large ribosomal subunit protein bL32m

OrganismNot specified

UniProt Q9DCI9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM32_MOUSE
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain 0； PDBConstruct 1–108； UniProt 78–185

Large ribosomal subunit protein bL33m

OrganismNot specified

UniProt Q9CQP0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM33_MOUSE
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain 1； PDBConstruct 1–52； UniProt 14–65

Large ribosomal subunit protein bL34m

OrganismNot specified

UniProt Q99N91

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM34_MOUSE
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain 2； PDBConstruct 1–46； UniProt 47–92

Large ribosomal subunit protein bL35m

OrganismNot specified

UniProt Q9CQL6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM35_MOUSE
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain 3； PDBConstruct 1–95； UniProt 94–188

Large ribosomal subunit protein bL36m

OrganismNot specified

UniProt Q99N90

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM36_MOUSE
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain 4； PDBConstruct 1–37； UniProt 65–101

Large ribosomal subunit protein mL38

OrganismNot specified

UniProt Q8K2M0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM38_MOUSE
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain 6； PDBConstruct 1–335； UniProt 46–380

Large ribosomal subunit protein mL39

OrganismNot specified

UniProt Q9JKF7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM39_MOUSE
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain 7； PDBConstruct 1–292； UniProt 33–324

Large ribosomal subunit protein mL43

OrganismNot specified

UniProt Q5RL20

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q5RL20_MOUSE
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain b； PDBConstruct 1–148； UniProt 2–149

Large ribosomal subunit protein mL44

OrganismNot specified

UniProt Q9CY73

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM44_MOUSE
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain c； PDBConstruct 1–290； UniProt 31–320

Large ribosomal subunit protein mL45

OrganismNot specified

UniProt Q9D0Q7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM45_MOUSE
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain d； PDBConstruct 1–306； UniProt 1–306

Large ribosomal subunit protein mL46

OrganismNot specified

UniProt Q9EQI8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM46_MOUSE
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain e； PDBConstruct 1–283； UniProt 1–283

Large ribosomal subunit protein mL48

OrganismNot specified

UniProt Q8JZS9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM48_MOUSE
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain f； PDBConstruct 1–128； UniProt 84–211

Large ribosomal subunit protein mL49

OrganismNot specified

UniProt Q9CQ40

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM49_MOUSE
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain g； PDBConstruct 1–132； UniProt 35–166

Large ribosomal subunit protein mL50

OrganismNot specified

UniProt Q8VDT9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM50_MOUSE
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain h； PDBConstruct 1–110； UniProt 50–159

Large ribosomal subunit protein mL51

OrganismNot specified

UniProt Q9CPY1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM51_MOUSE
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain i； PDBConstruct 1–97； UniProt 32–128

Large ribosomal subunit protein mL52

OrganismNot specified

UniProt Q9D0Y8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM52_MOUSE
Isoform	—
PDB entities	41
Chains and sequence ranges	Author chain j； PDBConstruct 1–121； UniProt 1–121

Large ribosomal subunit protein mL53

OrganismNot specified

UniProt Q9D1H8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM53_MOUSE
Isoform	—
PDB entities	42
Chains and sequence ranges	Author chain k； PDBConstruct 1–118； UniProt 1–118

Large ribosomal subunit protein mL63

OrganismNot specified

UniProt Q9CQF8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RT63_MOUSE
Isoform	—
PDB entities	43
Chains and sequence ranges	Author chain o； PDBConstruct 1–78； UniProt 25–102

Large ribosomal subunit protein mL62

OrganismNot specified

UniProt Q8R035

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ICT1_MOUSE
Isoform	—
PDB entities	44
Chains and sequence ranges	Author chain p； PDBConstruct 1–153； UniProt 38–190

Large ribosomal subunit protein mL64

OrganismNot specified

UniProt Q9CR59

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G45IP_MOUSE
Isoform	—
PDB entities	45
Chains and sequence ranges	Author chain q； PDBConstruct 1–135； UniProt 25–159

Large ribosomal subunit protein mL66

OrganismNot specified

UniProt Q99N85

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RT18A_MOUSE
Isoform	—
PDB entities	46
Chains and sequence ranges	Author chain r； PDBConstruct 1–196； UniProt 1–196

Large ribosomal subunit protein mL65

OrganismNot specified

UniProt Q9D0G0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RT30_MOUSE
Isoform	—
PDB entities	47
Chains and sequence ranges	Author chain s； PDBConstruct 1–384； UniProt 41–424

Mitochondrial assembly of ribosomal large subunit protein 1

OrganismNot specified

UniProt Q9CWV0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MASU1_MOUSE
Isoform	—
PDB entities	48
Chains and sequence ranges	Author chain u； PDBConstruct 1–125； UniProt 85–209

Predicted gene, 55359

OrganismNot specified

UniProt A0A2I3BQS8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2I3BQS8_MOUSE
Isoform	—
PDB entities	49
Chains and sequence ranges	Author chain v； PDBConstruct 1–69； UniProt 2–70

Acyl carrier protein, mitochondrial

OrganismNot specified

UniProt Q9CR21

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACPM_MOUSE
Isoform	—
PDB entities	50
Chains and sequence ranges	Author chain w； PDBConstruct 1–79； UniProt 74–152

Large ribosomal subunit protein mL37

OrganismNot specified

UniProt Q921S7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM37_MOUSE
Isoform	—
PDB entities	51
Chains and sequence ranges	Author chain 5； PDBConstruct 1–394； UniProt 30–423

Large ribosomal subunit protein mL40

OrganismNot specified

UniProt Q9Z2Q5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM40_MOUSE
Isoform	—
PDB entities	52
Chains and sequence ranges	Author chain 8； PDBConstruct 1–70； UniProt 105–174

Large ribosomal subunit protein mL41

OrganismNot specified

UniProt Q9CQN7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM41_MOUSE
Isoform	—
PDB entities	53
Chains and sequence ranges	Author chain 9； PDBConstruct 1–135； UniProt 1–135

Large ribosomal subunit protein mL42

OrganismNot specified

UniProt Q9CPV3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM42_MOUSE
Isoform	—
PDB entities	54
Chains and sequence ranges	Author chain a； PDBConstruct 1–142； UniProt 1–142

Large ribosomal subunit protein mL55

OrganismNot specified

UniProt Q9CZ83

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM55_MOUSE
Isoform	—
PDB entities	55
Chains and sequence ranges	Author chain m； PDBConstruct 1–127； UniProt 1–127

Mitochondrial ribosome-associated GTPase 1

OrganismNot specified

UniProt Q8R2R6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MTG1_MOUSE
Isoform	—
PDB entities	56
Chains and sequence ranges	Author chain z； PDBConstruct 1–326； UniProt 1–326

Large ribosomal subunit protein mL54

OrganismNot specified

UniProt Q9CPW3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RM54_MOUSE
Isoform	—
PDB entities	57
Chains and sequence ranges	Author chain l； PDBConstruct 1–135； UniProt 1–135

rRNA methyltransferase 2, mitochondrial

OrganismNot specified

UniProt Q9CPY0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） Transcription termination factor 4, mitochondrial × 1 （Q8BVN4） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MRM2_MOUSE
Isoform	—
PDB entities	58
Chains and sequence ranges	Author chain t； PDBConstruct 1–246； UniProt 1–246

Transcription termination factor 4, mitochondrial

OrganismNot specified

UniProt Q8BVN4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 57 RNA 2	16S rRNA (1584-MER) × 1 tRNA-Phe (68-MER) × 1 Large ribosomal subunit protein uL2m × 1 （Q9D773） Large ribosomal subunit protein uL3m × 1 （Q99N95） Large ribosomal subunit protein uL4m × 1 （Q9DCU6） Large ribosomal subunit protein bL9m × 1 （Q99N94） Large ribosomal subunit protein uL10m × 1 （Q3TBW2） Large ribosomal subunit protein uL11m × 1 （Q9CQF0） Large ribosomal subunit protein uL13m × 1 （Q9D1P0） Large ribosomal subunit protein uL14m × 1 （Q9D1I6） Large ribosomal subunit protein uL15m × 1 （Q9CPR5） Large ribosomal subunit protein uL16m × 1 （Q99N93） Large ribosomal subunit protein bL17m × 1 （Q9D8P4） Large ribosomal subunit protein uL18m × 1 （Q9CQL5） Large ribosomal subunit protein bL19m × 1 （Q9D338） Large ribosomal subunit protein bL20m × 1 （Q9CQL4） Large ribosomal subunit protein bL21m × 1 （Q9D1N9） Large ribosomal subunit protein uL22m × 1 （Q8BU88） Large ribosomal subunit protein uL23m × 1 （O35972） Large ribosomal subunit protein uL24m × 1 （Q9CQ06） Large ribosomal subunit protein bL27m × 1 （Q99N92） Large ribosomal subunit protein bL28m × 1 （Q9D1B9） Large ribosomal subunit protein uL29m × 1 （Q8K2Y7） Large ribosomal subunit protein uL30m × 1 （Q9D7N6） 5-cytosine rRNA methyltransferase NSUN4 × 1 （Q9CZ57） Large ribosomal subunit protein bL32m × 1 （Q9DCI9） Large ribosomal subunit protein bL33m × 1 （Q9CQP0） Large ribosomal subunit protein bL34m × 1 （Q99N91） Large ribosomal subunit protein bL35m × 1 （Q9CQL6） Large ribosomal subunit protein bL36m × 1 （Q99N90） Large ribosomal subunit protein mL38 × 1 （Q8K2M0） Large ribosomal subunit protein mL39 × 1 （Q9JKF7） Large ribosomal subunit protein mL43 × 1 （Q5RL20） Large ribosomal subunit protein mL44 × 1 （Q9CY73） Large ribosomal subunit protein mL45 × 1 （Q9D0Q7） Large ribosomal subunit protein mL46 × 1 （Q9EQI8） Large ribosomal subunit protein mL48 × 1 （Q8JZS9） Large ribosomal subunit protein mL49 × 1 （Q9CQ40） Large ribosomal subunit protein mL50 × 1 （Q8VDT9） Large ribosomal subunit protein mL51 × 1 （Q9CPY1） Large ribosomal subunit protein mL52 × 1 （Q9D0Y8） Large ribosomal subunit protein mL53 × 1 （Q9D1H8） Large ribosomal subunit protein mL63 × 1 （Q9CQF8） Large ribosomal subunit protein mL62 × 1 （Q8R035） Large ribosomal subunit protein mL64 × 1 （Q9CR59） Large ribosomal subunit protein mL66 × 1 （Q99N85） Large ribosomal subunit protein mL65 × 1 （Q9D0G0） Mitochondrial assembly of ribosomal large subunit protein 1 × 1 （Q9CWV0） Predicted gene, 55359 × 1 （A0A2I3BQS8） Acyl carrier protein, mitochondrial × 1 （Q9CR21） Large ribosomal subunit protein mL37 × 1 （Q921S7） Large ribosomal subunit protein mL40 × 1 （Q9Z2Q5） Large ribosomal subunit protein mL41 × 1 （Q9CQN7） Large ribosomal subunit protein mL42 × 1 （Q9CPV3） Large ribosomal subunit protein mL55 × 1 （Q9CZ83） Mitochondrial ribosome-associated GTPase 1 × 1 （Q8R2R6） Large ribosomal subunit protein mL54 × 1 （Q9CPW3） rRNA methyltransferase 2, mitochondrial × 1 （Q9CPY0） MAGNESIUM ION × 105 ZINC ION × 2 FE2/S2 (INORGANIC) CLUSTER × 1 S-ADENOSYL-L-HOMOCYSTEINE × 1 water × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MTEF4_MOUSE
Isoform	—
PDB entities	59
Chains and sequence ranges	Author chain y； PDBConstruct 1–346； UniProt 1–346

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9hcg
Deposition date deposition_date	2024-11-08
Structure title title	Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out)
Keywords keywords	mitochondria, ribosome, large subunit, assembly intermediate; RIBOSOME
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9hcg__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9hcg__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9hcg__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	76.71 Å
Rg (electron density)	79.97 Å
Total Rg	79.56 Å
Atom count	198342
Residues	10644
Excluded volume	1787000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9hcg__assembly_1__model_1`	59-meric （59）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (64)

Entity 1 Entity 1 polymer

Description description	16S rRNA (1584-MER)
Molecular weight formula_weight	508601.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	A
Atom count atom_count	198354

AACUAAUCCUAGCCCUAGCCCUACACAAAUAUAAUUAUACUAUUAUAUAAAUCAAAACAUUUAUCCUACUAAAAGUAUUGGAGAAAGAAAUUCGUACAUCUAGGAGCUAUAGAACUAGUACCGCAAGGGAAAGAUGAAAGACUAAUUAAAAGUAAGAACAAGCAAAGAUUAAACCUUGUACCUUUUGCAUAAUGAACUAACUAGAAAACUUCUAACUAAAAGAAUUACAGCUAGAAACCCCGAAACCAAACGAGCUACCUAAAAACAAUUUUAUGAAUCAACUCGUCUAUGUGGCAAAAUAGUGAGAAGAUUUUUAGGUAGAGGUGAAAAGCCUAACGAGCUUGGUGAUAGCUGGUUACCCAAAAAAUGAAUUUAAGUUCAAUUUUAAACUUGCUAAAAAAACAACAAAAUCAAAAAGUAAGUUUAGAUUAUAGCCAAAAGAGGGACAGCUCUUCUGGAACGGAAAAAACCUUUAAUAGUGAAUAAUUAACAAAACAGCUUUUAACCAUUGUAGGCCUAAAAGCAGCCACCAAUAAAGAAAGCGUUCAAGCUCAACAUAAAAUUUCAAUUAAUUCCAUAAUUUACACCAACUUCCUAAACUUAAAAUUGGGUUAAUCUAUAACUUUAUAGAUGCAACACUGUUAGUAUGAGUAACAAGAAUUCCAAUUCUCCAGGCAUACGCGUAUAACAACUCGGAUAACCAUUGUUAGUUAAUCAGACUAUAGGCAAUAAUCACACUAUAAAUAAUCCACCUAUAACUUCUCUGUUAACCCAACACCGGAAUGCCUAAAGGAAAGAUCCAAAAAGAUAAAAGGAACUCGGCAAACAAGAACCCCGCCUGUUUACCAAAAACAUCACCUCUAGCAUUACAAGUAUUAGAGGCACUGCCUGCCCAGUGACUAAAGUUUAACGGCCGCGGUAUCCUGACCGUGCAAAGGUAGCAUAAUCACUUGUUCCUUAAUUAGGGACUAGCAUGAACGGCUAAACGAGGGUCCAACUGUCUCUUAUCUUUAAUCAGUGAAAUUGACCUUUCAGUGAAGAGGCUGAAAUAUAAUAAUAAGACGAGAAGACCCUAUGGAGCUUAAAUUAUAUAACUUAUCUAUUUAAUUUAUUAAACCUAAUGGCCCAAAAACUAUAGUAUAAGUUUGAAAUUUCGGUUGGGGUGACCUCGGAGAAUAAAAAAUCCUCCGAAUGAUUAUAACCUAGACUUACAAGUCAAAGUAAAAUCAACAUAUCUUAUUGACCCAGAUAUAUUUUGAUCAACGGACCAAGUUACCCUAGGGAUAACAGCGCAAUCCUAUUUAAGAGUUCAUAUCGACAAUUAGGGUUUACGACCUCGAUGUUGGAUCAGGACAUCCCAAUGGUGUAGAAGCUAUUAAUGGUUCGUUUGUUCAACGAUUAAAGUCCUACGUGAUCUGAGUUCAGACCGGAGCAAUCCAGGUCGGUUUCUAUCUAUUUACGAUUUCUCCCAGUACGAAAGGACAAGAGAAAUAGAGCCACCUUACAAAUAAGCGCUCUCAACUUAAUUUAUGAAUAAAAUCUAAAUAAAAUAUAUACGUACACCCUCUAACCUAGAGAAGGUUA

Entity 2 Entity 2 polymer

Description description	tRNA-Phe (68-MER)
Molecular weight formula_weight	21862.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	B

GUUAAUGUAGCUUAAUAACAAAGCAAAGCACUGAAAAUGCUUAGAUGGAUAAUUGUAUCCCAUAAACA

Entity 3 Entity 3 polymer

Description description	Large ribosomal subunit protein uL2m
Molecular weight formula_weight	27168.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

AKFVSWKSRTKYTVKPVKMRKSGGRDHTGRIRVHGIGGGHKQNYRMIDFLRFRPEKEKAPEPFEEKVVVVRYDPCRSADIALVAGGSRKRWIIATENMKAGDTILNSNHIGRMAVAAQEGDAHPLGALPVGTLINNVESEPGRGAQYIRAAGTCGVLLRKVNGTAIIQLPSKRQMQVLESCTATVGRVSNVNHNQRVIGKAGRNRWLGKRPNSGLWQRKGGWAGRKIRPLPPMKSYVKLPSAAAQN

Entity 4 Entity 4 polymer

Description description	Large ribosomal subunit protein uL3m
Molecular weight formula_weight	34843.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

LHSKSSTWWDEHLSEENLSFVKQLVSDENKTQLTSKLNPLKDEPWPLHPWEPGSFRVGLIALKLGMMPLWTKDGQKHAVTLLQVQDCHVLKYTPKEDHNGKIAALTVGGKTVSRFYKPDSRLEFYRDLGLPPKQIHKIFHVTDNAVIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMKRWGFKGQPASHGQTKTHRRPGAISTGDIARVWPGTKMPGRMGNQNRTVYGLKVWRVNTKHNIIYVNGSVPGHKNCLVKIKDSTLPAYKDSCKNLPFPTYFPDGDEEELPEDLFDESVWQPSEPSITFA

Entity 5 Entity 5 polymer

Description description	Large ribosomal subunit protein uL4m
Molecular weight formula_weight	28410.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

DPVLRKCELRIPVHRRPVQAWVESLRGFEQERIGLAELHPDVFATAPRLDIVHQVAIWQRNFRRISYANTKTRAEVSGGGRKPWQQKGSGRARHGSIRSPLWRGGGVAHGPRGPTSYYYMLPMKVRALGLKVALTVKLMQDDLHIVDSLELPTADPQYLTELAQYRHWGSSVLLVDLTHEEMPKNVVAATSGLNSFNLIPAVGLNVYSMLKHQTLVLTLPSVAFLEDKLLWQDSRYTPLYPFRLPYSDFP

Entity 6 Entity 6 polymer

Description description	Large ribosomal subunit protein bL9m
Molecular weight formula_weight	11058.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

TVIVERWWKVPLAGEGRKPHLHRRHRVYKLVEDTKHRPKDNLELILTQSVDEIGVRGDLVSVKKSVGRNKLLSQGLAVYASPENRKLFEEEKSLR

Entity 7 Entity 7 polymer

Description description	Large ribosomal subunit protein uL10m
Molecular weight formula_weight	29438.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MAAAVAGILRGGLPPRAAWLPTLQTVRHGSKAVTRHWRVMHFQRQKLMAITEYIPPKPAINPRCLPPPPKPPKEESGLVRLLRQDIVAVFRDNRMIAVCQNVALSAEDKLLLRHQLRKHKIFIKVFPSQVLKPFLENSKYRNLLPLFVGHNLLLVSEEPKVKEMVRVLKSVPFLPLLGGCVDDTILSRQGLVDYAKLPSLDQLQGQLVGGLTHLMAQTRYLLQHQPVQLTSLLDQYVKEQNEGDCATSANEKLHPPDPAPDA

Entity 8 Entity 8 polymer

Description description	Large ribosomal subunit protein uL11m
Molecular weight formula_weight	18853.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

GVIRSIVRAGQAIPGPPLGPILGQRGVSINQFCKEFNEKTKDIKEGIPLPTKIFIKPDRTFELKIGQPTVSYFLKAAAGIEKGARHTGKEVAGLVSLKHVYEIACVKAKDDAFAMQDVPLSSVVRSIIGSARSLGIRVVKDLSAEELEAFQKERAVFLAAQKEADLAAQAEAAKK

Entity 9 Entity 9 polymer

Description description	Large ribosomal subunit protein uL13m
Molecular weight formula_weight	20576.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

SSFSRAPQQWATFARMWYLLDGKMQPPGKLAVIASNKLQGLNKPVYHQLSDCGDHVVIINTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHRKDPVAIVKLAIYGMLPKNLHRRTMMQRLHLFPDEDIPEDILKNLVEELPQPRRVPKRLDEYTQEEIEAFPRVWTPPDDFRM

Entity 10 Entity 10 polymer

Description description	Large ribosomal subunit protein uL14m
Molecular weight formula_weight	12751.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

AVQKMTRVRVVDNSALGSTPYHRPPRCIHVYNKSGVGKVGDQILLAIRGQKKKALIVGHRMPGSRMTPKFDSNNVVLIEDNGNPVGTRIKIPIPTSLRRREGEYSKVLAIAQNFV

Entity 11 Entity 11 polymer

Description description	Large ribosomal subunit protein uL15m
Molecular weight formula_weight	32847.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

GTSLDLLRSLPRVSLANLKPSPNSRKRERRPRDRRRGRKCGRGHKGERQRGTRPRLGFEGGQTPFYIRIPKYGFNEGHSFRHQYQPLSLRRLQYLIDLGRVDPTQPIDLTQLVNGRGVTIQPLKRDYGVQLVEEGADTFQAKINIEVQLASELAIAAIEKNGGVVTTAFYDPRSLEILCKPIPFFLRGQPIPKRMLPPESLVPYYTDAKNRGYLADPAKFPEARLELAMKFGYVLPDITKDELFRMLSARKDPRQIFFGLAPGWVVNMADKKILKPTDENLLKYYSS

Entity 12 Entity 12 polymer

Description description	Large ribosomal subunit protein uL16m
Molecular weight formula_weight	25582.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

LKTLLPVPTFENVSIPERSKLKFVERVPLVPKVRREPKNLKDIRGPSTEATDFTEGNFAILALGGGYLHWGHFEMMRLTINRFMDPKNMFAIWRVPAPFKPITRKGVGQRMGGGKGAIDHYVTPVKTGCLVVEMGGRCEFEEVKGILNQVAHKLPFPAKAVSRKTLERMHQNQRERELNNQNPWTFEHIATANMFGIRKFLSPYDLTQKGRYWGKFYMPKRV

Entity 13 Entity 13 polymer

Description description	Large ribosomal subunit protein bL17m
Molecular weight formula_weight	17908.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

ISHGRVYRRLGLGPESRIHLLRNLLTGLVRHERIEATWARADEMRGYAEKLIDYGKLGDTNERAMRMADFWLTEKDLIPKLFKVLAPRFQGQNGNYTRMLQIPNRKEQDRAKMAVIEYKGNYLPPLPLPHRDSNLTLLNQLLLGLQQDLHHNQ

Entity 14 Entity 14 polymer

Description description	Large ribosomal subunit protein uL18m
Molecular weight formula_weight	16407.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

KENEAVAPEFTNRNPRNLELLGVARKERGWATVWPNREFWHRLRVVKTQHHVEAFVEHLNGQVVVSASTREWAIKKHLYSTRNVVACESIGRVLAQRCLEAGINFMVYQPTPWEASSDSIKRLQNAMTESGVMLREPRRIY

Entity 15 Entity 15 polymer

Description description	Large ribosomal subunit protein bL19m
Molecular weight formula_weight	25467.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

RFLSPEFIPPRGRTNPLKFKIERKDMLDRRKVLPIPEFYVGSILRVTTADPYASGKTSQFLGICIKRSGNGLGATFTLRNTIEGQGVEICFELYNPRIQEIQVVKLEKRLDDNLLYLRDALPEYSTFDVNMKPVPQEACQEVPVNKLKVKMKPKPWSKRWERPNFNIKGIRFDLALTEEQMKEAQKWNKPWIEFDMMREYDTSKIEAALWEEIEASK

Entity 16 Entity 16 polymer

Description description	Large ribosomal subunit protein bL20m
Molecular weight formula_weight	16482.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

LRNRLTDRYWRVQEVLKHAQHFRGRKNRCYRLAVRAVTRAFVKCTKARRLKKRNLRTLWINRITAASQEHGLKYPAFIVNLIKCQVELNRKVLVDLAIYEPKTFKSLAALAKRRQQEGFAAALGDGKEPEGIFSRVVQYH

Entity 17 Entity 17 polymer

Description description	Large ribosomal subunit protein bL21m
Molecular weight formula_weight	18457.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

YPQGYVPKTSLSSPPWQEVVLPDPVEETRHHAEVVKRVNELIATGQYGRLFAVVHFASHQWKVTAEDLILIENELDIKCGERIRLEKVLLVGADNFTLLGKPLLRKELVRVEATVIEKTESWPKINMKFRKRKNFRKKKIIVNPQTILRINTIEIAPRL

Entity 18 Entity 18 polymer

Description description	Large ribosomal subunit protein uL22m
Molecular weight formula_weight	19504.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

ISRKWEKKNKIVYPPQLPGEPRRPAEIYHCRRQIKYSKDKMWYLAKMIRGMSIDQALAQLEFNDKKGAQIIKEVLLEAQDMAVRDHNVEFRSNLHIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPPEVPKTAVDHAKDYIQQLRSRTIIHTL

Entity 19 Entity 19 polymer

Description description	Large ribosomal subunit protein uL23m
Molecular weight formula_weight	17014.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

ARNVLYPLYQLGGPQLRVFRTNFFIQLVRPGTAQPEDTVQFRIPMEMTRVDLRNYLEQIYNVPVAAVRTRVQHGSNRRRDHKNVRIKKPDYKVAYVQLAHGQTFTFPDLFPEKDPRSPEPLEEELPQQRQSSDLRCPGIPSWFGL

Entity 20 Entity 20 polymer

Description description	Large ribosomal subunit protein uL24m
Molecular weight formula_weight	24016.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

ASKATSSPFYRYGMSRPGSIADKRKNPPWSRRRPVVVEPISDEDWHLFCGDMVEILEGKDAGKQGKVVQVVRQRNWVVLEGLNTHYRYIGRTKDHRGTMIASEAPLLHHQVKLVDPVDRKPTEIQWRFTEAGERVRVSTRSGRIIPKPEFPRADGIVPETWTDGPKDTSVEDALERTYVPRLKTLEEDVMEAMGIQETRRFKKVYWY

Entity 21 Entity 21 polymer

Description description	Large ribosomal subunit protein bL27m
Molecular weight formula_weight	11264.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

KHYGIKKMEGHYVHAGNILGTQRQFRWHPGAHVGLGRNKCLYALEEGIVRYTKDVYVPNPKNTEAVDLVTSLPKGAVLYKTFVHVVPAKPEGTFKLVDML

Entity 22 Entity 22 polymer

Description description	Large ribosomal subunit protein bL28m
Molecular weight formula_weight	28613.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

PLHRYPVHLWQKLRLRQGICARLPAHFLRSLEEERTPTPVHYKPHGTKFKINPKNGQRERVEDVPIPVHYPPESQQGLWGGEGLILGYRYANNDKLSKRVKKVWKPQLFTRELYSEILDKKFTVTVTMRTLDLIDEAYGFDFYILKTPKEDLGSKFGMDLKRGMLLRLARQDPHLHPENPERRAAIYDKYRSFVIPEAEAEWVGLTLEEALEKQRLLEEKDPVPLFKVYVEELVQRLQEQVL

Entity 23 Entity 23 polymer

Description description	Large ribosomal subunit protein uL29m
Molecular weight formula_weight	21602.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

GLEEFFDDPKNWGEEKVKSGASWTCQQLRNKSNEDLHKLWYVLLKERNMLLTLEQEAKRQRLPMPSPERLEKVVDSMDNVDKVVQEREDALRLLQTGQEKPRPGAWRRDIFGRIVWHKFKQWPIPWYLNKRYNRRRFFAMPYVDRFIRLRIEKHARIEARKRSLQKKKEKILHAKF

Entity 24 Entity 24 polymer

Description description	Large ribosomal subunit protein uL30m
Molecular weight formula_weight	14040.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

KFTKSRIPDKVFQPKPEDHEKYGGDPQNPHKLHIVTRIRSTKRRPYWEKDTIKMLGLQKAHSPQIHKNIPSVNAKLKVVKHLIRIQPLKLPQGLPTEETMSSTCLKSTGELVVQWHLKPVE

Entity 25 Entity 25 polymer

Description description	5-cytosine rRNA methyltransferase NSUN4
Molecular weight formula_weight	38580.0 kDa
EC 编号 ec_number	2.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x

QFTASRLALQNFDMTYSVQFGDLWPSIRVSLLSEQKYGALVNNFAAWDSVSAKLEQLSAKDFVSEAISHQKLEPESGLSPTPSLDCSPNLRCFTFSRGDVSRFPPARLGSLGLMDYYLMDAASLLPVLALGLQHGDTVLDLCAAPGGKTLALLQTGCCRNLAANDLSTSRTGRLQKVLHSYVPQDIREGNQVRVTSWDGRKWGELEGDTYDRVLVDVPCTTDRHSLHEEENNIFQRSRKKERQMLPMLQVQLLAAGLLATKPGGHVVYSTCSLSHLQNEYVVQGAIELLANQYNIKVQVEDLSHFRKLFMDTFCFFPSCQVGELVIPNLMVNFGPMYFCKLHRLP

Entity 26 Entity 26 polymer

Description description	Large ribosomal subunit protein bL32m
Molecular weight formula_weight	12618.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0

AAPKNRRTIEVNRCRRRNPQKLIKIKNNIDICPECGHLKQKHVLCGYCYEKVRQETTKIRQQIGAQEGGPFRAPSVETMVLYTGEKPSEKDQGKRIVERNIKRPSWFT

Entity 27 Entity 27 polymer

Description description	Large ribosomal subunit protein bL33m
Molecular weight formula_weight	6079.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

KTILVKLVSQAGTGFSFNHKRSRLREKLSLLHYDPIVNKKVLFVEQKKIRSL

Entity 28 Entity 28 polymer

Description description	Large ribosomal subunit protein bL34m
Molecular weight formula_weight	5420.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

RARGNEYQPSNIKRKHKHGWVRRLSTPAGVQVILRRMLKGRKSLSH

Entity 29 Entity 29 polymer

Description description	Large ribosomal subunit protein bL35m
Molecular weight formula_weight	11703.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

LTYCSTRKGKRKTVKSVVHRFLRLHSGLWLRRKAGYKKKLWKKSTARKKRLREFVFCSKTQSKLLDKMTTSFWKRRNWYAGDPYQMYHDRTNLRV

Entity 30 Entity 30 polymer

Description description	Large ribosomal subunit protein bL36m
Molecular weight formula_weight	4623.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

FKTKGVIKKRCKDCYKVKRRGRWFILCKTNPKHKQRQ

Entity 31 Entity 31 polymer

Description description	Large ribosomal subunit protein mL38
Molecular weight formula_weight	40115.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

ERLEKYRSFERYRRRAEQEARAPHWWRTYREHFVKETDPKDKIDIGLPPPRVSRTQKLLERKHFLRELRANVEEERAARLRTASIPLEAVRAEWERTCGPYHKQRLAEYYGLYRDLFHGATFVPWVPLHVAYAVGEEDLIPVYHGNEVTPTEASRAPEVTYEADKDSLWTLLFINLDGHLLEPDAEYVHWLLTNIPSNRVAEGQETCPYLPPFPARGSGFHRFAFLLFKQDKPINFSEDTRPSPCYQLAQRTFRTFDFYKRHQEAMTPAGLAFFQCRWDDSVTHTFHQLLDMREPVFEFVRPPPYHPKQKRFPHEQPLRYLDRYRDSHEPTYGIY

Entity 32 Entity 32 polymer

Description description	Large ribosomal subunit protein mL39
Molecular weight formula_weight	33902.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

SPTELTEMRNDLFNREKSRQLSLTPRTEKIEVKHVGKTDPGTVFVMNKNISTPYSCAMHLSEWYCSKSILALVDGQPWDMYKPLTKSCEIKFLTFKDPDPKEVNKAYWRSCAMMLGCVIERAFKDDYVVSLVRAPEVPVIAGAFCYDVTLDKRLDEWMPTKENLRSFTKDAHALIYRDLPFETLDVDARVALEIFQHNKYKVDFIEEKASQNPERIVKLHRIGDFIDVSEGPLIPRTSVCFQYEVSAVHNLNPSQPNLIRRFQGLSLPTHLRAQFTIWDKLVERSRKMVTED

Entity 33 Entity 33 polymer

Description description	Large ribosomal subunit protein mL43
Molecular weight formula_weight	16787.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

TGRGTSSRFLTSVLHNGLGRYVQQLQRLSLSLSRDAPSSRGAREFVEREVTDFARRNPGVVVYVNPRPCAMPRIVAEYLNGAVREENVNSKSVEEIKSLVQKLADQSGLDVIRIRKPFHTDNPSIQGQWHPFTNKRTALHGLRPRELR

Entity 34 Entity 34 polymer

Description description	Large ribosomal subunit protein mL44
Molecular weight formula_weight	33030.9 kDa
EC 编号 ec_number	3.1.26.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

VKKGFRAAFRFQKELERWRLLRCPPPPVRRSEKPNWDYHAEVQAFGSRLQETFSLDLLKTAFINSCYIKSEEAKRQSLGIEKEAALLNLKDNQELFEQGLSFSHRCLTQFLEDEFPDLPAEGTESLVSFLTGEAVVCHVARNLAVEQLTLSAEFPVPLPVLRQTFFAVIGALLQSSGPERAALFIRDFLITQMTGKELFEMWTVVNPMGLLVEELKKRNISAPESRLTRQSGSTTALPLYFVGLYCDRKLIAEGPGETVLVAEEEAARVALRKLYGFTENRRPWDYSKPK

Entity 35 Entity 35 polymer

Description description	Large ribosomal subunit protein mL45
Molecular weight formula_weight	35463.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MAAPVPRGLSSLYRTLGWWSRQPILVTQSTTVVQVKTKSRFRPPTPEPKYKTEKEFLEYARKAGLVIPQERLERPIHLACTAGIFDPYVPPEGDARMSSLSKEGLTQRTERLRKNAASQLAIRKIREFDANFKTKDFPEKAKDIFIEAHLCLNNSDHDRLHTLVTEHCFPDMVWDLKYKTVRWGFVESLEPAQVVHVRCSGLVNQSNMYGQVTVRLHTRQTLAIYDRFGRLMYGQEDVPKDVLEYVVFERHLMNPYGSWRMHAKIVPAWAPPKQPILKTLMIPGPQLKPWEEYEETQGEAQKPQLA

Entity 36 Entity 36 polymer

Description description	Large ribosomal subunit protein mL46
Molecular weight formula_weight	32175.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

MAAPVGRTLLGLARGWRQLDRFWAGSSRGLSLEAASSSSRSPWRLSGALCLQRPPLITKALTPLQEEMAGLLQQIEVERSLYSDHELRALDEAQRLAKKKADLYDEEQEQGITLAQDLEDMWEQAFLQFRPGARETEADKKNDRTSLHRKLDRNLVLLVREKLGDQDVWMLPQVEWQPGETLRGTAERILATLSENNMEAKFLGNAPCGHYKFKFPKAIQTESDLGVKVFFFKALLLTGDFVQAGKKSRHVWASKEELGDYLQPKYLAQVRRFLLDSDGLSCL

Entity 37 Entity 37 polymer

Description description	Large ribosomal subunit protein mL48
Molecular weight formula_weight	14725.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

DYEYGVLNIHLTAYDMSLAESYAQYVHRLCNRLSIKVEESYAMPTKTMEVMRLPDQGNKMVLDSVLTTHERVVQISGLSATFAEIFLEVLQSNLPEGVRLSVREHTEEDFKGRFKARPELEELLAKLN

Entity 38 Entity 38 polymer

Description description	Large ribosomal subunit protein mL49
Molecular weight formula_weight	15412.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

NPGFVESVDEYQFVERLLPPTKIPEPPKHKHYPTPSGWQPPRDPLPSLPYFVRRSRMHNIPVYKEITHGNRQMTLIRKVEGDIWALQKDVEEFLSPLLGKTPITQVNEVTGTLRIKGYFDEQLKAWLLEKGF

Entity 39 Entity 39 polymer

Description description	Large ribosomal subunit protein mL50
Molecular weight formula_weight	12412.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

VLVCPPLRSRAYTPPSDLQSRLESHIKEVLGSSLPNNWQDISLDDGHMKFRLLAGLADGLGHAVPNSRLHQMCRVRDVLDFYNVPVQDKSKFDELVASNLPPNLKISWSY

Entity 40 Entity 40 polymer

Description description	Large ribosomal subunit protein mL51
Molecular weight formula_weight	11744.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

AFVRLTLPPPKVVDRWNEKRALFGVYDNIGILGNFEKHPKELIKGPVWLRGWRGNELQRCVRKKKFVGNRMFIEDLHNLNKRISYLYKHFNRHGKYR

Entity 41 Entity 41 polymer

Description description	Large ribosomal subunit protein mL52
Molecular weight formula_weight	13681.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

MAALGTWLSSVRRLHCSVVARAGGQWRLQQGLAANPSGYGPLTELPDWSFADGRPAPPMKGQLRRKAQREKLARRVVLLTQEMDAGIQAWKLRQQKLQEERKKEHDLKPKGTLLRSPLPNQ

Entity 42 Entity 42 polymer

Description description	Large ribosomal subunit protein mL53
Molecular weight formula_weight	12756.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

MAAALARLGLRPVKLVRVQFCPFEKNVESTRTFLQTVSSEKVRATNLNCSVIADVRHDGSEPCVDVLFGDGYRLIMRGAHLTTQEMLSALASHIRDRNAAAASAPGADKVAPGTSTRR

Entity 43 Entity 43 polymer

Description description	Large ribosomal subunit protein mL63
Molecular weight formula_weight	9126.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o

RTVSFQAKESMIRRLEVEAENHYWLSMPYMTAEQECGHAAERRAQAFEAIKAAATSKFPKHRYIADQLDHLNISKKWS

Entity 44 Entity 44 polymer

Description description	Large ribosomal subunit protein mL62
Molecular weight formula_weight	17574.0 kDa
EC 编号 ec_number	3.1.1.29
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p

TFQSIYSLDKLYPESKGADTAWKVPEHAKQASSYIPLDRLSISYCRSSGPGGQNVNKVNSKAEVRFHLASADWIEEPVRQKIALTHKNKINKAGELVLTSESSRYQFRNLAECLQKIRDMIAEASQVPKEPSKEDARLQRLRIEKMNRERLRQ

Entity 45 Entity 45 polymer

Description description	Large ribosomal subunit protein mL64
Molecular weight formula_weight	16082.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q

YRAPPPPRRRPGPHSPDPENLLTPRWQLTPRYVAKQFGRHGAISGVPPASLWPTPEQLRELEAEEQEWYPSLATMQESLRLQQQALEARRQAREQRIAECMAKMPQMIENWRKQKRERWEKIQADKERRARLQAE

Entity 46 Entity 46 polymer

Description description	Large ribosomal subunit protein mL66
Molecular weight formula_weight	22363.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r

MAALRRLVSGCGRQLQAFLAGPAATGWLWLPARGLREVVKIQEGKTTVIEGRITETPKATPDPPNPSGQCPICRWNLKHKYTYEDVLLLSQFIRPYGGMLPRRVTGLCREEHRKIEECVKMAHRAGLLPNHRPQLPEGCLPKDKPKLNRYLTRWAPKSVKPIYKKGHRWNKVGMAVGSPLLKDNVCYSRRPLKMMH

Entity 47 Entity 47 polymer

Description description	Large ribosomal subunit protein mL65
Molecular weight formula_weight	43897.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s

VARYPPIVASMTADSKAARQRRVQRWQATVHAAPSVDEKIRILTKMQFKKYVVHPQISALNADRWYQSFTKTVFVSGLPPAPALSPPPPSLDLAALRAAVCDCILQEQVYVRRRRPRSLFDRRQALASSILDQVVRTLVNLLAPLNPVLSTAALDCKRSVDFYWLRGEERIPAGHRKGHIDALRYQINDKPHNQIRISKQLPEFVPLDYSIPTEIPVMKCKPDKLPLFRRQYENSIFTGSKTADPCCYGHTQFHLIPDRLKRERLIRQNQAEQVEAVFRANAIASLFAWTGAQAMYQGFWSEADVTRPFVSQAVITDGKYFSFFCYQLNTLALTVQADQNNPRKNLCWGSQSQPLYETVEDNDVKGFDDGTLLQIVHFLLNKPR

Entity 48 Entity 48 polymer

Description description	Mitochondrial assembly of ribosomal large subunit protein 1
Molecular weight formula_weight	14705.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	u

KFDIDMLVSLLRQENARDICVIQVPPEMRYTDYFVIGSGTSTRHLHAMVHYLVKMYKHLKCRSDPYVKIEGKDADDWLCVDFGSMVIHLMLPETRETYELEKLWTLRSFDDQLAQIAAETLPEDF

Entity 49 Entity 49 polymer

Description description	Predicted gene, 55359
Molecular weight formula_weight	8313.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	v

APWSREAVLCLYRALLRQGRELRYTDRDFYFASIRREFRKNQKLENLEAREKQLEKGLVFLHSKLGGLI

Entity 50 Entity 50 polymer

Description description	Acyl carrier protein, mitochondrial
Molecular weight formula_weight	9131.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	w

LTLDGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKK

Entity 51 Entity 51 polymer

Description description	Large ribosomal subunit protein mL37
Molecular weight formula_weight	45665.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

AYEWGVRSTRKPEPRPLDRVYEIPGLEPITYEGKKHFVPWLARPIFPPWERGWNDPRFHRAAPIHEQTLYKEEPCYIFHQRCRLLEGMKQALWLTKTKLIEGLPKKVLSLVDDPANHIENQEQRVLDIISHARLWHSTEDIPKRETYCPLIVDSLIQLCKSQILKHPSLARRTSAQNCTLATTWNRESLLLQVRGTSSTILSAKDPLPVIASREEVEATRSHVLETFYPISPTIDLQECHVYEVKDDTGFQEGYPYPHPHTLYFLEKANLRPQRFLPEQLRAKMLLFAFANALAQARLLYGNTAKVLEQPIVVQSVGTDGRVFQFLVLQLNTTDLASSEGVKNLVWTDSDQLLYRHFWCRPVIKKKVVVEPVGPVDFQPETFRKFLALYLHGVV

Entity 52 Entity 52 polymer

Description description	Large ribosomal subunit protein mL40
Molecular weight formula_weight	8402.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

EHSPEESERRALLLKRWALFKQQEHEMERDAIRSMLEAQQEALEELKLESAELYAEAIKRDTSLFPFEKE

Entity 53 Entity 53 polymer

Description description	Large ribosomal subunit protein mL41
Molecular weight formula_weight	15284.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	9

MGFLTAVTQGLVRGADRMSKWTSKRGPRTFTKSRGAKKTGIYTSDRKFVQIKEMVPEFVVPDLTGFKLKPYVNYRAPAGIDTPLTAKALFQETVAPAIEKDFKEGTFDANNLEKYGFEPTQEGKLFQLYPKNFPR

Entity 54 Entity 54 polymer

Description description	Large ribosomal subunit protein mL42
Molecular weight formula_weight	16521.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MAAAVKWAISNRTIWKHLLPIQNGALSSACHKSTYSSLPDDYNCQVDLALTADGRTIVCYHPSVDIPYEHTKPIPQPDLLHNNEETHEQILKAKLEVRKSKQLEQGPMIEQLSKVFYTTKHRWYPHGQYHNRRKKLNPPRDR

Entity 55 Entity 55 polymer

Description description	Large ribosomal subunit protein mL55
Molecular weight formula_weight	15152.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m

MPLAILLSLLRHCGVRAALPTPRHLHTSPWRADCSRASLTRLRRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPLDLDALSPEERRARFRKREAQLQQKREEEPEVVDSFDTERYKQFWTKTKK

Entity 56 Entity 56 polymer

Description description	Mitochondrial ribosome-associated GTPase 1
Molecular weight formula_weight	36732.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	z

MRLWPQAWGAVRGAWRECFPLQGHDVARWFPGHMAKGLKKMQSSLKSVDCVIEVHDARIPFSGRNPLFQELLGLKPHLLVLNKMDLADLTEQQKIVQRLEEKGLSNVLFTNCVKDENIKQIVPKVMELIRCSYRYHRAETPEYCIMVVGVPNVGKSSLINSLRRQHLRTGKAARVGGEPGITRAVTSRIQVCERPLVFLLDTPGVLAPRIESVETGLKLALCGTVLDHLVGEETMADYLLYTLNRHGLFGYVQHYALASACDQIEWVLKNVAIKLRKTRKVKVLTGTGNVNVIQPDYAMAARDFLRTFRSGLLGQVMLDRDIIPAC

Entity 57 Entity 57 polymer

Description description	Large ribosomal subunit protein mL54
Molecular weight formula_weight	15450.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l

MAAAHLLRASRVWARWHPRALPVLRRPGGFSIREYAKKPVGKGGKGGVAAEALKDPEVCTDPTQLTTHAMGVNIYKEGQDVALKADSEYPTWLFQVNLGPPKKLEELEPESREYWRLLRKQNIWRHNRLSKNKKL

Entity 58 Entity 58 polymer

Description description	rRNA methyltransferase 2, mitochondrial
Molecular weight formula_weight	27189.7 kDa
EC 编号 ec_number	2.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	t

MAGHLKLVGVPLKVRRLHTAVCHYRGRTGAEHLWLTRHLKDPFVKAAKVESYRCRSAFKLLEMNEKHQILRPGLRVLDCGAAPGAWSQVAVQRVNATGADSSSPVGFVLGVDLLHIFPLAGATFLCPADVTDPRTFQKILELLPSRRADVILSDMAPNATGIRDLDHDKLISLCLTLVDMAVDILHPGGTLLCKTWAGSKSHLLQKRLTQEFQSTRVVKPEASRKESSEVYLLATQYRGGKGTRRP

Entity 59 Entity 59 polymer

Description description	Transcription termination factor 4, mitochondrial
Molecular weight formula_weight	40306.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	y

MASLGRQVPEWHRLLALSWACLVRQTPHLREQKQMSPSLSCKLTTVPGRGSFQEFSSITPQKYMQEPENRTRLVQCLHEEQKPCVDPESLEPEKVIRSLQDMGFAEAHIHSLFSIQPSVHPQQLLGIVSELLLLGLNPEPVFNALKKNPQLLKLSSMQMKRRSSYLRKLGLGEGKLKRVLSVCPEVFTMHQRDIDRVVKVLREKCLFTAQHITDVLHRCPTVLQEDPNELEYKFQYAYFRMGLTHLDIVRTNFLQYSITKIKQRHIYLERLGRYQTPDKKGQTQIPNPSLRNILRVSEAEFLARTACSSVEEFQVFKKLLDQEEEEESESHASEEEEEEEEEEELL

Entity 60 Entity 60 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	105

Entity 61 Entity 61 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 62 Entity 62 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 63 Entity 63 non-polymer

Description description	S-ADENOSYL-L-HOMOCYSTEINE
Molecular weight formula_weight	384.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 64 Entity 64 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.91 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	97203

Mouse mitoribosome large subunit assembly intermediate bound to NSUN4, METRF4, MRM2, GTPBP7 and MALSU1-L0R8F8-mt-ACP complex, State D (SAMC knock-out)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Large ribosomal subunit protein uL2m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein uL3m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein uL4m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein bL9m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein uL10m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein uL11m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein uL13m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein uL14m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein uL15m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Large ribosomal subunit protein uL16m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer