SAXSdb — 9rt2

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Leukocidin/Hemolysin toxin family

Clostridium perfringens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Anthrax toxin receptor 2 × 4 （P58335）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0D3QGV4_CLOPF
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain N1； PDBConstruct 9–289； UniProt 25–305 Author chain N2； PDBConstruct 9–289； UniProt 25–305 Author chain N3； PDBConstruct 9–289； UniProt 25–305 Author chain N4； PDBConstruct 9–289； UniProt 25–305 Author chain N5； PDBConstruct 9–289； UniProt 25–305 Author chain N6； PDBConstruct 9–289； UniProt 25–305 Author chain N7； PDBConstruct 9–289； UniProt 25–305 Author chain N8； PDBConstruct 9–289； UniProt 25–305

Anthrax toxin receptor 2

Homo sapiens

UniProt P58335

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	Leukocidin/Hemolysin toxin family × 8 （A0A0D3QGV4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ANTR2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C1； PDBConstruct 1–285； UniProt 34–318 Author chain C2； PDBConstruct 1–285； UniProt 34–318 Author chain C3； PDBConstruct 1–285； UniProt 34–318 Author chain C4； PDBConstruct 1–285； UniProt 34–318

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9rt2
Deposition date deposition_date	2025-07-01
Structure title title	NetF - ANTXR2 structure (C4)
Keywords keywords	NetF, clostridium perfringens, hemolysin, CMG2, ANTXR2, toxin receptor interaction, transmembrane beta-barrel, TOXIN; TOXIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9rt2__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9rt2__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9rt2__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	49.93 Å
Rg (electron density)	49.77 Å
Total Rg	50.07 Å
Atom count	51141
Residues	3279
Excluded volume	458310 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9rt2__assembly_1__model_1`	12-meric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Leukocidin/Hemolysin toxin family
Molecular weight formula_weight	32874.6 kDa
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N1,N2,N3,N4,N5,N6,N7,N8
Atom count atom_count	51141

MVHHHHHHNSFPESIINSKGKQAEVYTSSDASERDGIKTSLSASFIEDPNSNNLTALVSLKGFIPSGLIKTGTYYSANMYWPSKYNINIETTDEKNNVKILESIPSNTIETVRVTESMGYSIGGNVSVSKKSSSVGANAGFNVQRSVQYEQPDFKTIQKSDGIRKASWNIVFNKTKDGYDQNSYHALYGNQLFMKSRLHNTGAKNLVEDKDLSPLISGGFTPNMVIALKAPKGTKKSMINLNYNLYQDLYTLEWYKTQWWGENRVAKEPYYTYQTYELDWENHTVEFIY

Source Source

Source organism organism	Clostridium perfringens
NCBI taxonomy ID ncbi_taxonomy_id	1502
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Anthrax toxin receptor 2
Molecular weight formula_weight	34978.7 kDa
Mutation mutation	deleted TM and cytoplasmic domains
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C1,C2,C3,C4

QEQPSCRRAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYCVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGIINSILAQSCTEILELQPSSVCVGEEFQIVLSGRGFMLGSRNGSVLCTYTVNETYTTSVKPVSVQLNSMLCPAPILNKAGETLDVSVSFNGGKSVISGSLIVTATECSNGRTENLYFQGGAGARSIEGRIVKDYKDDDDKHHHHHH

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	2.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	67074

NetF - ANTXR2 structure (C4)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Leukocidin/Hemolysin toxin family

State in the Current Structure

Other States of the Same Protein in the Database

Anthrax toxin receptor 2

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9rt2__assembly_1__model_1

9rt2__assembly_1__model_1 | I(q)

9rt2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)

NetF - ANTXR2 structure (C4)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Leukocidin/Hemolysin toxin family

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anthrax toxin receptor 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9rt2__assembly_1__model_1

9rt2__assembly_1__model_1 | I(q)

9rt2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)