SAXSdb — 9rt4

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Anthrax toxin receptor 2

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain C1； UniProt 34–318	Not recorded	Leukocidin/Hemolysin toxin family × 1 （A0A0D3QGV4）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.60 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9RT4	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1SHT Crystal Structure of the von Willebrand factor A domain of human capillary morphogenesis protein 2: an anthrax toxin receptor Deposited 2004-02-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain X 38–217（180 aa） Fragment：VWA domain	Not recorded	ACT ACETATE ION × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；PEG8K, magnesium acetate, sodium cacodylate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.81 Å R-free 0.186
1SHU Crystal Structure of the von Willebrand factor A domain of human capillary morphogenesis protein 2: an anthrax toxin receptor Deposited 2004-02-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain X 38–218（181 aa） Fragment：VWA domain	Not recorded	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；PEG3350, magnesium chloride, bis-tris, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.50 Å R-free 0.215
1T6B Crystal structure of B. anthracis Protective Antigen complexed with human Anthrax toxin receptor Deposited 2004-05-05	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain Y 35–212（178 aa） Fragment：A/I domain	Not recorded	CA CALCIUM ION × 2 NA SODIUM ION × 2 PG4 TETRAETHYLENE GLYCOL × 1 MN MANGANESE (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9；300 K；CHES buffer, PEG400, pH 9.0, VAPOR DIFFUSION, SITTING DROP, temperature 300K	Resolution 2.50 Å R-free 0.266
1TZN Crystal Structure of the Anthrax Toxin Protective Antigen Heptameric Prepore bound to the VWA domain of CMG2, an anthrax toxin receptor Deposited 2004-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain a 38–218（181 aa） Fragment：VWA domain Chain b 38–218（181 aa） Fragment：VWA domain Chain c 38–218（181 aa） Fragment：VWA domain Chain d 38–218（181 aa） Fragment：VWA domain Chain e 38–218（181 aa） Fragment：VWA domain Chain f 38–218（181 aa） Fragment：VWA domain Chain o 38–218（181 aa） Fragment：VWA domain	Not recorded	CA CALCIUM ION × 14 MG MAGNESIUM ION × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；PEG 8000, sodium chloride, Tris, magnesium chloride, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 4.30 Å R-free 0.330
1TZN Crystal Structure of the Anthrax Toxin Protective Antigen Heptameric Prepore bound to the VWA domain of CMG2, an anthrax toxin receptor Deposited 2004-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain g 38–218（181 aa） Fragment：VWA domain Chain h 38–218（181 aa） Fragment：VWA domain Chain i 38–218（181 aa） Fragment：VWA domain Chain j 38–218（181 aa） Fragment：VWA domain Chain k 38–218（181 aa） Fragment：VWA domain Chain l 38–218（181 aa） Fragment：VWA domain Chain m 38–218（181 aa） Fragment：VWA domain	Not recorded	CA CALCIUM ION × 14 MG MAGNESIUM ION × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；PEG 8000, sodium chloride, Tris, magnesium chloride, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 4.30 Å R-free 0.330
1TZN Crystal Structure of the Anthrax Toxin Protective Antigen Heptameric Prepore bound to the VWA domain of CMG2, an anthrax toxin receptor Deposited 2004-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 28 PDB declaration: 28-meric	Chain a 38–218（181 aa） Fragment：VWA domain Chain b 38–218（181 aa） Fragment：VWA domain Chain c 38–218（181 aa） Fragment：VWA domain Chain d 38–218（181 aa） Fragment：VWA domain Chain e 38–218（181 aa） Fragment：VWA domain Chain f 38–218（181 aa） Fragment：VWA domain Chain g 38–218（181 aa） Fragment：VWA domain Chain h 38–218（181 aa） Fragment：VWA domain Chain i 38–218（181 aa） Fragment：VWA domain Chain j 38–218（181 aa） Fragment：VWA domain Chain k 38–218（181 aa） Fragment：VWA domain Chain l 38–218（181 aa） Fragment：VWA domain Chain m 38–218（181 aa） Fragment：VWA domain Chain o 38–218（181 aa） Fragment：VWA domain	Not recorded	CA CALCIUM ION × 28 MG MAGNESIUM ION × 14	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；PEG 8000, sodium chloride, Tris, magnesium chloride, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 4.30 Å R-free 0.330
1TZN Crystal Structure of the Anthrax Toxin Protective Antigen Heptameric Prepore bound to the VWA domain of CMG2, an anthrax toxin receptor Deposited 2004-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 28 PDB declaration: 28-meric	Chain a 38–218（181 aa） Fragment：VWA domain Chain b 38–218（181 aa） Fragment：VWA domain Chain c 38–218（181 aa） Fragment：VWA domain Chain d 38–218（181 aa） Fragment：VWA domain Chain e 38–218（181 aa） Fragment：VWA domain Chain f 38–218（181 aa） Fragment：VWA domain Chain g 38–218（181 aa） Fragment：VWA domain Chain h 38–218（181 aa） Fragment：VWA domain Chain i 38–218（181 aa） Fragment：VWA domain Chain j 38–218（181 aa） Fragment：VWA domain Chain k 38–218（181 aa） Fragment：VWA domain Chain l 38–218（181 aa） Fragment：VWA domain Chain m 38–218（181 aa） Fragment：VWA domain Chain o 38–218（181 aa） Fragment：VWA domain	Not recorded	CA CALCIUM ION × 28 MG MAGNESIUM ION × 14	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；PEG 8000, sodium chloride, Tris, magnesium chloride, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 4.30 Å R-free 0.330
1TZN Crystal Structure of the Anthrax Toxin Protective Antigen Heptameric Prepore bound to the VWA domain of CMG2, an anthrax toxin receptor Deposited 2004-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 28 PDB declaration: 28-meric	Chain a 38–218（181 aa） Fragment：VWA domain Chain b 38–218（181 aa） Fragment：VWA domain Chain c 38–218（181 aa） Fragment：VWA domain Chain d 38–218（181 aa） Fragment：VWA domain Chain e 38–218（181 aa） Fragment：VWA domain Chain f 38–218（181 aa） Fragment：VWA domain Chain g 38–218（181 aa） Fragment：VWA domain Chain h 38–218（181 aa） Fragment：VWA domain Chain i 38–218（181 aa） Fragment：VWA domain Chain j 38–218（181 aa） Fragment：VWA domain Chain k 38–218（181 aa） Fragment：VWA domain Chain l 38–218（181 aa） Fragment：VWA domain Chain m 38–218（181 aa） Fragment：VWA domain Chain o 38–218（181 aa） Fragment：VWA domain	Not recorded	CA CALCIUM ION × 28 MG MAGNESIUM ION × 14	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；PEG 8000, sodium chloride, Tris, magnesium chloride, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 4.30 Å R-free 0.330
7N1O The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone Deposited 2021-05-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 40–217（178 aa）	Mutation：1TEL: R41A,D46G,V112E,K122A,vWa: R49A,C175A,V112A,K112A	MG MAGNESIUM ION × 1 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.7；298 K；100 mM BisTris, 3.0 M NaCl	Resolution 2.77 Å R-free 0.228
8FT6 The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Ala-Ala linker variant, SUMO tag-free preparation. Deposited 2023-01-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 40–217（178 aa）	Mutation：R14A,V77E,K87A,R89A,R91A,A225V	CIT CITRIC ACID × 1 IOD IODIDE ION × 2 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.2M Ammonium citrate tribasic, 20% w/v PEG 3350	Resolution 2.62 Å R-free 0.234
8FT8 The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Thr-Val linker variant, SUMO tag-free preparation Deposited 2023-01-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 40–217（178 aa）	Mutation：R14A,V77E,K87A,R89A,R91T,A92V,A225V	GOL GLYCEROL × 1 CL CHLORIDE ION × 3 K POTASSIUM ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.1M HEPES, 2.0M ammonium sulfate	Resolution 1.60 Å R-free 0.204
8FZ4 The von Willebrand factor A domain of Anthrax toxin receptor 2 Deposited 2023-01-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 37–217（181 aa）	Mutation：P37G, C39A, C175A	MG MAGNESIUM ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9.5；298 K；1.2 uL of 20 mg/mL protein in 12.5 mM Tris pH 8.8, 200mM KCl, 10mM MgCl2 combined with 1.2 uL of 0.1 M Glycine pH 9.5, 24% PEG 3350	Resolution 2.19 Å R-free 0.256
8FZ4 The von Willebrand factor A domain of Anthrax toxin receptor 2 Deposited 2023-01-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 37–217（181 aa）	Mutation：P37G, C39A, C175A	MG MAGNESIUM ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9.5；298 K；1.2 uL of 20 mg/mL protein in 12.5 mM Tris pH 8.8, 200mM KCl, 10mM MgCl2 combined with 1.2 uL of 0.1 M Glycine pH 9.5, 24% PEG 3350	Resolution 2.19 Å R-free 0.256
8FZU The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Thr-Val linker variant, Expressed with SUMO tag Deposited 2023-01-30	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 39–217（179 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.1M HEPES 2.0M ammonium sulfate	Resolution 1.90 Å R-free 0.266
8FZU The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Thr-Val linker variant, Expressed with SUMO tag Deposited 2023-01-30	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 39–217（179 aa）	Not recorded	K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.1M HEPES 2.0M ammonium sulfate	Resolution 1.90 Å R-free 0.266
8FZU The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Thr-Val linker variant, Expressed with SUMO tag Deposited 2023-01-30	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain C 39–217（179 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.1M HEPES 2.0M ammonium sulfate	Resolution 1.90 Å R-free 0.266
8FZV The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Ala-Ala linker variant, expressed with SUMO tag Deposited 2023-01-30	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 40–217（178 aa）	Not recorded	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；298 K；100 mM sodium acetate, pH 4.6, 2.0 M sodium formate	Resolution 3.29 Å R-free 0.314
8FZV The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Ala-Ala linker variant, expressed with SUMO tag Deposited 2023-01-30	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 40–217（178 aa）	Not recorded	UNX UNKNOWN LIGAND × 32	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；298 K；100 mM sodium acetate, pH 4.6, 2.0 M sodium formate	Resolution 3.29 Å R-free 0.314
8FZV The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Ala-Ala linker variant, expressed with SUMO tag Deposited 2023-01-30	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain C 40–217（178 aa）	Not recorded	UNX UNKNOWN LIGAND × 58	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；298 K；100 mM sodium acetate, pH 4.6, 2.0 M sodium formate	Resolution 3.29 Å R-free 0.314
9DOC The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Thr-Val linker variant, at 1.2 Angstrom resolution Deposited 2024-09-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 43–217（175 aa） Fragment：von Willebrand factor A domain of CMG2	Mutation：TELSAM: R80S,V112E (Uniprot numbering),vWA: C175A (Uniprot numbering)	GOL GLYCEROL × 1 PO4 PHOSPHATE ION × 2 MG MAGNESIUM ION × 7 NA SODIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.25；298 K；100 mM Bis-Tris, pH 7.25, 1350 mM Sodium Potassium Phosphate	Resolution 1.19 Å R-free 0.197
9RT2 NetF - ANTXR2 structure (C4) Deposited 2025-07-01	Different construct Different mutation/modification Different oligomeric state	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: 12-meric	Chain C1 34–318（285 aa） Chain C2 34–318（285 aa） Chain C3 34–318（285 aa） Chain C4 34–318（285 aa）	Mutation：deleted TM and cytoplasmic domains Mutation：deleted TM and cytoplasmic domains Mutation：deleted TM and cytoplasmic domains Mutation：deleted TM and cytoplasmic domains	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9YKB The von Willebrand factor A domain of human capillary morphogenesis gene II, fused to the 1TEL crystallization chaperone, Ala-Val linker variant, expressed with SUMO tag. Deposited 2025-10-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 40–217（178 aa）	Mutation：R4A,V67E,K77A,R81A,A82V,C215A	MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；0.1 M BisTrisPropane, 1.5M Ammonium Sulfate	Resolution 2.50 Å R-free 0.194
9YKB The von Willebrand factor A domain of human capillary morphogenesis gene II, fused to the 1TEL crystallization chaperone, Ala-Val linker variant, expressed with SUMO tag. Deposited 2025-10-06	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain C 40–217（178 aa）	Mutation：R4A,V67E,K77A,R81A,A82V,C215A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；0.1 M BisTrisPropane, 1.5M Ammonium Sulfate	Resolution 2.50 Å R-free 0.194
9YKB The von Willebrand factor A domain of human capillary morphogenesis gene II, fused to the 1TEL crystallization chaperone, Ala-Val linker variant, expressed with SUMO tag. Deposited 2025-10-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 40–217（178 aa）	Mutation：R4A,V67E,K77A,R81A,A82V,C215A	MG MAGNESIUM ION × 2 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；0.1 M BisTrisPropane, 1.5M Ammonium Sulfate	Resolution 2.50 Å R-free 0.194

13 other PDB entries and 24 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ANTR2_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain C1； PDBConstruct 36–320； UniProt 34–318

Leukocidin/Hemolysin toxin family

Clostridium perfringens

UniProt A0A0D3QGV4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain N2； UniProt 25–305	Not recorded	Anthrax toxin receptor 2 × 1 （P58335）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.60 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9RT4	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9RSM NetF 9mer pre-pore structure on 2N2 nanodiscs. Deposited 2025-07-01	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 9 PDB declaration: nonameric	Chain A 25–305（281 aa） Chain B 25–305（281 aa） Chain C 25–305（281 aa） Chain D 25–305（281 aa） Chain E 25–305（281 aa） Chain F 25–305（281 aa） Chain G 25–305（281 aa） Chain H 25–305（281 aa） Chain I 25–305（281 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.13 Å
9RSU NetF pore structure Deposited 2025-07-01	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 25–305（281 aa） Chain B 25–305（281 aa） Chain C 25–305（281 aa） Chain D 25–305（281 aa） Chain E 25–305（281 aa） Chain F 25–305（281 aa） Chain G 25–305（281 aa） Chain H 25–305（281 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.10 Å
9RT2 NetF - ANTXR2 structure (C4) Deposited 2025-07-01	Different construct Different mutation/modification Different oligomeric state	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: 12-meric	Chain N1 25–305（281 aa） Chain N2 25–305（281 aa） Chain N3 25–305（281 aa） Chain N4 25–305（281 aa） Chain N5 25–305（281 aa） Chain N6 25–305（281 aa） Chain N7 25–305（281 aa） Chain N8 25–305（281 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A0D3QGV4_CLOPF
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain N2； PDBConstruct 9–289； UniProt 25–305

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9rt4
Deposition date deposition_date	2025-07-02
Structure title title	NetF - ANTXR2 local refinement focused
Keywords keywords	NetF, clostridium perfringens, hemolysin, CMG2, ANTXR2, toxin receptor interaction, transmembrane beta-barrel, TOXIN; TOXIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	23.75 Å
Radius of gyration Rg (electron density) rg_electron	23.08 Å
Forward intensity I(0) i0	29839300.00
Molecular weight molecular_weight	42803.0 kDa
Excluded volume excluded_volume	53956 Å³
Envelope volume envelope_volume	65090 Å³
Hydration-shell volume shell_volume	24140 Å³
Envelope diameter envelope_diameter	82.9 Å
Shell Rg shell_rg	29.41 Å
Envelope Rg envelope_rg	23.43 Å
Shape Rg shape_rg	23.10 Å
Total Rg total_rg	23.82 Å
Total atoms total_atoms	5992
Residues n_residues	387
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	79.5 Å
Rg (real space) rg_real	23.81 Å
Rg uncertainty (real space) rg_real_error	0.50 Å
I(0) (real space) i0_real	2.9840e+07
I(0) uncertainty (real space) i0_real_error	4.1820e+05
Rg (reciprocal space) rg_reciprocal	23.80 Å
I(0) (reciprocal space) i0_reciprocal	29840000.0000
Solution quality estimate total_estimate	0.8014
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	27.3 Å
Skewness Skewness skewness	0.453
Kurtosis Kurtosis kurtosis	-0.164
Angular range angular_range	— – 0.3350 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	6134000.0000
Real-space data points n_real_points	65
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.817; Stabil: 0.999; Sysdev: 1.000; Positv: 1.000; Valcen: 0.966; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Anthrax toxin receptor 2
Molecular weight formula_weight	38765.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C1
Atom count atom_count	5992

MGTLSAPPCTQRIKWKGLLLTASLLNFWNLPTTAGQEQPSCRRAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYCVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGIINSILAQSCTEILELQPSSVCVGEEFQIVLSGRGFMLGSRNGSVLCTYTVNETYTTSVKPVSVQLNSMLCPAPILNKAGETLDVSVSFNGGKSVISGSLIVTATECSNGRTENLYFQGGAGARSIEGRIVKDYKDDDDKHHHHHH

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Leukocidin/Hemolysin toxin family
Molecular weight formula_weight	32874.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N2

MVHHHHHHNSFPESIINSKGKQAEVYTSSDASERDGIKTSLSASFIEDPNSNNLTALVSLKGFIPSGLIKTGTYYSANMYWPSKYNINIETTDEKNNVKILESIPSNTIETVRVTESMGYSIGGNVSVSKKSSSVGANAGFNVQRSVQYEQPDFKTIQKSDGIRKASWNIVFNKTKDGYDQNSYHALYGNQLFMKSRLHNTGAKNLVEDKDLSPLISGGFTPNMVIALKAPKGTKKSMINLNYNLYQDLYTLEWYKTQWWGENRVAKEPYYTYQTYELDWENHTVEFIY

来源 Source

来源生物 organism	Clostridium perfringens
NCBI Class编号 ncbi_taxonomy_id	1502
宿主生物 host_organism	Escherichia coli

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	2.60 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	268296

fit	/app/data/saxs_computation/rt/9rt4/9rt4.fit
pddf	/app/data/pr_computation/rt/9rt4/9rt4.pr.out
profile	/app/data/saxs_computation/rt/9rt4/9rt4.dat

NetF - ANTXR2 local refinement focused

1. Protein Identity and Related Structures Protein Identity & Related Structures

Anthrax toxin receptor 2

State in the Current Structure

Other States of the Same Protein in the Database

Leukocidin/Hemolysin toxin family

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)