9se6

Structure of Photosystem I from Chlamydomonas reinhardtii at 1.83 A resolution

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Light-harvesting chlorophyll-a/b protein of photosystem I, type III

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CHLOROPHYLL A × 188 CHLOROPHYLL B × 28 BETA-CAROTENE × 27 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 DODECYL-ALPHA-D-MALTOSIDE × 27 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 2 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 water × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0ABF7PHF8_CHLRE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 3； PDBConstruct 1–221； UniProt 44–264

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q75VZ0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CHLOROPHYLL A × 188 CHLOROPHYLL B × 28 BETA-CAROTENE × 27 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 DODECYL-ALPHA-D-MALTOSIDE × 27 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 2 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 water × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75VZ0_CHLRE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 4； PDBConstruct 1–212； UniProt 53–264

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q75VY8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CHLOROPHYLL A × 188 CHLOROPHYLL B × 28 BETA-CAROTENE × 27 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 DODECYL-ALPHA-D-MALTOSIDE × 27 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 2 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 water × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75VY8_CHLRE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 5； PDBConstruct 1–227； UniProt 31–257

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q75VY6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CHLOROPHYLL A × 188 CHLOROPHYLL B × 28 BETA-CAROTENE × 27 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 DODECYL-ALPHA-D-MALTOSIDE × 27 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 2 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 water × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75VY6_CHLRE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 6； PDBConstruct 1–230； UniProt 28–257

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q84Y02

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CHLOROPHYLL A × 188 CHLOROPHYLL B × 28 BETA-CAROTENE × 27 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 DODECYL-ALPHA-D-MALTOSIDE × 27 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 2 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 water × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q84Y02_CHLRE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 7； PDBConstruct 1–213； UniProt 29–241

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q75VY7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CHLOROPHYLL A × 188 CHLOROPHYLL B × 28 BETA-CAROTENE × 27 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 DODECYL-ALPHA-D-MALTOSIDE × 27 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 2 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 water × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q75VY7_CHLRE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 8； PDBConstruct 1–217； UniProt 27–243

Photosystem I P700 chlorophyll a apoprotein A1

OrganismNot specified

UniProt P12154

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CHLOROPHYLL A × 188 CHLOROPHYLL B × 28 BETA-CAROTENE × 27 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 DODECYL-ALPHA-D-MALTOSIDE × 27 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 2 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 water × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAA_CHLRE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain A； PDBConstruct 1–742； UniProt 10–751

Photosystem I P700 chlorophyll a apoprotein A2

OrganismNot specified

UniProt P09144

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CHLOROPHYLL A × 188 CHLOROPHYLL B × 28 BETA-CAROTENE × 27 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 DODECYL-ALPHA-D-MALTOSIDE × 27 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 2 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 water × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAB_CHLRE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain B； PDBConstruct 1–733； UniProt 3–735

Photosystem I iron-sulfur center

OrganismNot specified

UniProt Q00914

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CHLOROPHYLL A × 188 CHLOROPHYLL B × 28 BETA-CAROTENE × 27 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 DODECYL-ALPHA-D-MALTOSIDE × 27 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 2 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 water × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAC_CHLRE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain C； PDBConstruct 1–80； UniProt 2–81

Photosystem I reaction center subunit II, chloroplastic

OrganismNot specified

UniProt Q39615

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CHLOROPHYLL A × 188 CHLOROPHYLL B × 28 BETA-CAROTENE × 27 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 DODECYL-ALPHA-D-MALTOSIDE × 27 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 2 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 water × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAD_CHLRE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain D； PDBConstruct 1–144； UniProt 53–196

Photosystem I reaction center subunit IV, chloroplastic

OrganismNot specified

UniProt P12352

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CHLOROPHYLL A × 188 CHLOROPHYLL B × 28 BETA-CAROTENE × 27 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 DODECYL-ALPHA-D-MALTOSIDE × 27 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 2 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 water × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAE_CHLRE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain E； PDBConstruct 1–64； UniProt 34–97

Photosystem I reaction center subunit VIII

OrganismNot specified

UniProt A8IFG7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CHLOROPHYLL A × 188 CHLOROPHYLL B × 28 BETA-CAROTENE × 27 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 DODECYL-ALPHA-D-MALTOSIDE × 27 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 2 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 water × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8IFG7_CHLRE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain I； PDBConstruct 1–37； UniProt 68–104

Photosystem I reaction center subunit IX

OrganismNot specified

UniProt P59777

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CHLOROPHYLL A × 188 CHLOROPHYLL B × 28 BETA-CAROTENE × 27 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 DODECYL-ALPHA-D-MALTOSIDE × 27 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 2 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 water × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAJ_CHLRE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain J； PDBConstruct 2–41； UniProt 1–40

Photosystem I reaction center subunit psaK, chloroplastic

OrganismNot specified

UniProt P14225

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CHLOROPHYLL A × 188 CHLOROPHYLL B × 28 BETA-CAROTENE × 27 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 DODECYL-ALPHA-D-MALTOSIDE × 27 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 2 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 water × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAK_CHLRE
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain K； PDBConstruct 1–86； UniProt 28–113

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q7DM26

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CHLOROPHYLL A × 188 CHLOROPHYLL B × 28 BETA-CAROTENE × 27 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 DODECYL-ALPHA-D-MALTOSIDE × 27 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 2 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 water × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7DM26_CHLRE
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain 1； PDBConstruct 1–194； UniProt 31–224 Author chain Z； PDBConstruct 1–194； UniProt 31–224

Photosystem I reaction center subunit III, chloroplastic

OrganismNot specified

UniProt P12356

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit V, chloroplastic × 1 （P14224） Chains: L × 1 CHLOROPHYLL A × 188 CHLOROPHYLL B × 28 BETA-CAROTENE × 27 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 DODECYL-ALPHA-D-MALTOSIDE × 27 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 2 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 water × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAF_CHLRE
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain F； PDBConstruct 1–165； UniProt 63–227

Photosystem I reaction center subunit V, chloroplastic

OrganismNot specified

UniProt P14224

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Light-harvesting chlorophyll-a/b protein of photosystem I, type III × 1 （A0ABF7PHF8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VZ0） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY8） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY6） Chlorophyll a-b binding protein, chloroplastic × 1 （Q84Y02） Chlorophyll a-b binding protein, chloroplastic × 1 （Q75VY7） Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P12154） Photosystem I P700 chlorophyll a apoprotein A2 × 1 （P09144） Photosystem I iron-sulfur center × 1 （Q00914） Photosystem I reaction center subunit II, chloroplastic × 1 （Q39615） Photosystem I reaction center subunit IV, chloroplastic × 1 （P12352） Photosystem I reaction center subunit VIII × 1 （A8IFG7） Photosystem I reaction center subunit IX × 1 （P59777） Photosystem I reaction center subunit psaK, chloroplastic × 1 （P14225） Chlorophyll a-b binding protein, chloroplastic × 2 （Q7DM26） Photosystem I reaction center subunit III, chloroplastic × 1 （P12356） Chains: L × 1 CHLOROPHYLL A × 188 CHLOROPHYLL B × 28 BETA-CAROTENE × 27 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 16 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 12 DODECYL-ALPHA-D-MALTOSIDE × 27 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 14 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 2 CHLOROPHYLL A ISOMER × 1 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 water × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAG_CHLRE
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain G； PDBConstruct 1–95； UniProt 32–126

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9se6
Deposition date deposition_date	2025-08-15
Structure title title	Structure of Photosystem I from Chlamydomonas reinhardtii at 1.83 A resolution
Keywords keywords	Photosystem I, Chlamydomonas reinhardtii, CryoEM, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9se6__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9se6__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9se6__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	60.25 Å
Rg (electron density)	59.80 Å
Total Rg	59.85 Å
Atom count	47459
Residues	3993
Excluded volume	895450 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9se6__assembly_1__model_1`	19-meric （19）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (32)

Entity 1 Entity 1 polymer

Description description	Light-harvesting chlorophyll-a/b protein of photosystem I, type III
Molecular weight formula_weight	23888.2 kDa
Mutation mutation	No
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3
Atom count atom_count	48478

QLYVGASQSSLAYLDGSLPGDFGFDPLGLLDPVNSGGFIEPKWLQYSEVIHARWAMLGAAGCIAPEVLGAAGLIPDATNIKWFESGVIPPAGSYNGYWADPYTIFFVEIVAMQFAELRRLQDFRYPGSMGQQYFLGLEAIFKGSGDAAYPGGPFFNLFNLGKTEAAMKELKLKEIKNGRLAMLAMLGYGAQAVMTGKGPFQNLVEHLADPVNNNILTNFAG

Entity 2 Entity 2 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	23304.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

KRDAALPSWMPGADLPGYLNGTLPGDFGFDPLYLGQDPVKLKWYAQAELMNARFAMLAVAGILVPELLSNIGFSWPGAGVAWYDAGKFEYFAPASSLFGVQMLLFAWVEIRRYQDFVKPGSANQDPIFTNNKLPDGNEPGYPGGIFDPFGWSKGDIKSLKLKEIKNGRLAMLAFAGFIGQAYTTGTTPLKNLSTHLADPWSTTVWQNDLARL

Entity 3 Entity 3 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	25122.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

DRKLWAPGVVAPEYLKGDLAGDYGWDPLGLGADPTALKWYRQSELQHARWAMLGVAGVLVQEIVKPDVYFYEAGLPQNLPEPFTNINMGGLLAWEFILMHWVEVRRWQDYKNFGSVNEDPIFKGNKVPNPEMGYPGGIFDPFGFSKGNLKELQTKEIKNGRLAMIAYMAFILQAQATGKGPLAALSAHLSNPFGNNILKNIGTCTVPHSVDVQGLTIPLTCLWPGSQ

Entity 4 Entity 4 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	25025.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

SRPLWLPGSTPPAHLKGDLPGDFGFDPLGLGANAESLKWFKESELVHSRWAMAAVAGILVQEIVRPDVFWYNAGKEVESPLGPLGLLAVEFFLMHWVEVRRWQDLRKPGSVDQDPIFSQYKLPPHEVGYPGGVFAPFIPGDLAELKVKEIKNGRLAMLAFVGFVMAAQVTGKGPIAALQEHLADPWGTTIFSKAAVVPGQAVAPPCKIPASVSYKGIEIPTPCFLQGLWP

Entity 5 Entity 5 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	23304.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

VRPVWFPGNPPPAHLDGSLAGDYGFDPLFLGQEPQTLKWYVQAELVHGRFAMLGAAGIILTSIGAKVGLGFPEWYDAGKVVVEKNNIDFPTLMVIQFYLMGWAETKRWYDFKNPGSQADGSFLGFTEEFKGLENGYPGGRFFDPMGLSRGDAAKYQEYKQKEVKNGRLAMIACLGFAAQYAATGKGPLDNLADHLADPNHVNFATNGVSIPIA

Entity 6 Entity 6 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	23293.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8

RQSWLPGSQIPAHLDTPAAQALAGNFGFDPLGLGKDPVALRWYQQAELIHCRTAMAGVAGILIPGLLTKAGALNVPEWYDAGKVAIENSFAPWGSLLAVQLFLCGFVEAKRWQDIRKPGSQGEPGSFLGFEASLKGTSELGYPGGPFDPLGLSKEADKWADWKLKEVKNGRLAMLAFLGFVAQKYATGAGPVDNLAAHLKDPWHVNYATNGVSLPFL

Entity 7 Entity 7 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	82193.0 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

AKKVKIAVDRNPVETSFEKWAKPGHFSRTLSKGPNTTTWIWNLHADAHDFDSHTSDLEEISRKVFSAHFGQLGIIFIWLSGMYFHGARFSNYEAWLSDPTHIKPSAQVVWPIVGQEILNGDVGGGFQGIQITSGFFQLWRASGITSELQLYTTAIGGLVMAAAMFFAGWFHYHKAAPKLEWFQNVESMLNHHLGGLLGLGSLAWAGHQIHVSLPVNKLLDAGVDPKEIPLPHDLLLNRAIMADLYPSFAKGIAPFFTLNWSEYSDFLTFKGGLNPVTGGLWLSDTAHHHVAIAVLFLVAGHMYRTNWGIGHSMKEILEAHRGPFTGEGHVGLYEILTTSWHAQLAINLALFGSLSIIVAHHMYAMPPYPYLATDYGTQLSLFTHHTWIGGFCIVGAGAHAAIFMVRDYDPTNNYNNLLDRVIRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNTHFLAPQLTAPNALAATSLTWGGDLVAVGGKVAMMPISLGTSDFMVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVTASGVSHITGGNFAQSANTINGWLRDFLWAQSSQVIQSYGSALSAYGLIFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIATTWSFFLARIISVG

Entity 8 Entity 8 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	81982.0 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

TKLFPKFSQGLAQDPTTRRIWYGLAMAHDFESHDGMTEENLYQKIFASHFGQLSIIFLWTSGNLFHVAWQGNFEQWVTDPVHIRPIAHAIWDPHFGQPAVEAFTRGGASGPVNISTSGVYQWWYTIGMRTNQDLYVGSVFLALVSAIFLFAGWLHLQPNFQPSLSWFKDAESRLNHHLSGLFGVSSLAWTGHLVHVAIPESRGQHVGWDNFLSVLPHPQGLTPFFTGNWAAYAQSPDTASHVFGTAQGSGQAILTFLGGFHPQTQSLWLTDMAHHHLAIAVIFIVAGHMYRTNFGIGHRMQAILEAHTPPSGSLGAGHKGLFDTVNNSLHFQLGLALASVGTITSLVAQHMYSLPPYAFQAIDFTTQAALYTHHQYIAGFIMCGAFAHGAIFFIRDYDPEQNKGNVLARMLDHKEALISHLSWVSLFLGFHTLGLYVHNDVMQAFGTPEKQILIEPVFAQWIQAAHGKALYGFDFLLSSKTSAAFANGQSLWLPGWLDAINNNQNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAYDAFYLAVFWMLNTIGWVTFYWHWKHLTLWQGNVAQFDESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWTFLFGHLIYATGFMFLISWRGYWQELIETLVWAHEKTPLANLVYWKDKPVALSIVQARLVGLAHFSVGYIFTYAAFLIASTSGRFG

Entity 9 Entity 9 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8738.1 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

AHIVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKASQMASAPRTEDCVGCKRCETACPTDFLSVRVYLGSESTRSMGLSY

Entity 10 Entity 10 polymer

Description description	Photosystem I reaction center subunit II, chloroplastic
Molecular weight formula_weight	16123.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

WTVPTLNPDTPSPIFGGSTGGLLRKAQTEEFYVITWEAKKEQIFEMPTGGAAIMRQGPNLLKFGKKEQCLALTTQLRNKFKLTPCFYRVFPDGKVQYLHPADGVYPEKVNAGRVGANQNMRRIGQNVNPIKVKFSGRMMSPAEI

Entity 11 Entity 11 polymer

Description description	Photosystem I reaction center subunit IV, chloroplastic
Molecular weight formula_weight	7151.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

EVGPKRGSLVKILRPESYWFNQVGKVVSVDQSGVRYPVVVRFENQNYAGVTTNNYALDEVVAAK

Entity 12 Entity 12 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	3970.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

PFVPPSWAPSVFVPLTGLVLPAIAMATLFVYIEKEAP

Entity 13 Entity 13 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	4629.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

XMKDFTTYLSTAPVIATIWFTFTAGLLIEINRYFPDPLVFS

Entity 14 Entity 14 polymer

Description description	Photosystem I reaction center subunit psaK, chloroplastic
Molecular weight formula_weight	8316.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

GFIGSSTNLIMVASTTATLAAARFGLAPTVKKNTTAGLKLVDSKNSAGVISNDPAGFTIVDVLAMGAAGHGLGVGIVLGLKGIGAL

Entity 15 Entity 15 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	20368.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z,1

KAGNWLPGSDAPAWLPDDLPGNYGFDPLSLGKEPASLKRFTESEVIHGRWAMLGVAGSLAVELLGYGNWYDAPLWAVNGGKATWFGIEVPFDLNALLAFEFVAMAAAEGQRGDAGGVVYPGGAFDPLGFAKDSSKSGELKLKEIKNGRLAMVAFLGFVAQHAATGKGPIAALGEHLANPWGANFATNGISVPFF

Entity 16 Entity 16 polymer

Description description	Photosystem I reaction center subunit III, chloroplastic
Molecular weight formula_weight	17957.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

DIAGLTPCSESKAYAKLEKKELKTLEKRLKQYEADSAPAVALKATMERTKARFANYAKAGLLCGNDGLPHLIADPGLALKYGHAGEVFIPTFGFLYVAGYIGYVGRQYLIAVKGEAKPTDKEIIIDVPLATKLAWQGAGWPLAAVQELQRGTLLEKEENITVSPR

Entity 17 Entity 17 polymer

Description description	Photosystem I reaction center subunit V, chloroplastic
Molecular weight formula_weight	9958.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

LDPQIVISGSTAAFLAIGRFVFLGYQRREANFDSTVGPKTTGATYFDDLQKNSTIFATNDPAGFNIIDVAGWGALGHAVGFAVLAINSLQGANLS

Entity 18 Entity 18 polymer

Description description	Chains: L
Molecular weight formula_weight	12744.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

GMLETPVTSAPIVATYLSNLPAYRTGVAPVLRGVEIGLAHGFLLAGPFIKLGPLRNVPETAEIAGSLSAAGLVLILALCLSIYGSAQFQSARDPLFSADGWSEFAAGFLVGGEAGVAWAYVCTQ

Entity 19 Entity 19 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	188

Entity 20 Entity 20 non-polymer

Description description	CHLOROPHYLL B
Molecular weight formula_weight	907.5 kDa
Source method src_method	syn
Copy count entity_count	28

Entity 21 Entity 21 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	27

Entity 22 Entity 22 non-polymer

Description description	(3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	16

Entity 23 Entity 23 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 24 Entity 24 non-polymer

Description description	DODECYL-ALPHA-D-MALTOSIDE
Molecular weight formula_weight	510.6 kDa
Source method src_method	syn
Copy count entity_count	27

Entity 25 Entity 25 non-polymer

Description description	;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 26 Entity 26 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	14

Entity 27 Entity 27 non-polymer

Description description	;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 28 Entity 28 non-polymer

Description description	CHLOROPHYLL A ISOMER
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 29 Entity 29 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 30 Entity 30 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 31 Entity 31 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 32 Entity 32 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1019

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	1.83 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	246159

Structure of Photosystem I from Chlamydomonas reinhardtii at 1.83 A resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

Light-harvesting chlorophyll-a/b protein of photosystem I, type III

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chlorophyll a-b binding protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chlorophyll a-b binding protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chlorophyll a-b binding protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chlorophyll a-b binding protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chlorophyll a-b binding protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit II, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer