9uzp

Cryo-EM Structure of the Vaccinia Virus Entry/Fusion Complex (EFC) Including the F9 Subunit

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Virion membrane protein OPG143

Orthopoxvirus vaccinia

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Entry-fusion complex protein OPG094 × 1 （P07611） Envelope protein OPG155 × 2 （P68633） Protein OPG107 × 2 （P08583） Entry-fusion complex protein OPG086 × 2 （P68458） Entry-fusion complex protein OPG094 × 2 （P68623） Entry-fusion complex associated protein OPG083 × 1 （P24361） Protein OPG104 × 1 （P07618） Virion membrane protein OPG147 × 2 （P68712） Entry-fusion complex protein OPG076 × 2 （P0CK21）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PG143_VACCW
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–377； UniProt 1–377

Entry-fusion complex protein OPG094

Orthopoxvirus vaccinia

UniProt P07611

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Virion membrane protein OPG143 × 1 （P16710） Envelope protein OPG155 × 2 （P68633） Protein OPG107 × 2 （P08583） Entry-fusion complex protein OPG086 × 2 （P68458） Entry-fusion complex protein OPG094 × 2 （P68623） Entry-fusion complex associated protein OPG083 × 1 （P24361） Protein OPG104 × 1 （P07618） Virion membrane protein OPG147 × 2 （P68712） Entry-fusion complex protein OPG076 × 2 （P0CK21）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PG094_VACCW
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–340； UniProt 1–340

Envelope protein OPG155

Orthopoxvirus vaccinia

UniProt P68633

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Virion membrane protein OPG143 × 1 （P16710） Entry-fusion complex protein OPG094 × 1 （P07611） Protein OPG107 × 2 （P08583） Entry-fusion complex protein OPG086 × 2 （P68458） Entry-fusion complex protein OPG094 × 2 （P68623） Entry-fusion complex associated protein OPG083 × 1 （P24361） Protein OPG104 × 1 （P07618） Virion membrane protein OPG147 × 2 （P68712） Entry-fusion complex protein OPG076 × 2 （P0CK21）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PG155_VACCW
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–146； UniProt 1–146 Author chain c； PDBConstruct 1–146； UniProt 1–146

Protein OPG107

Orthopoxvirus vaccinia

UniProt P08583

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Virion membrane protein OPG143 × 1 （P16710） Entry-fusion complex protein OPG094 × 1 （P07611） Envelope protein OPG155 × 2 （P68633） Entry-fusion complex protein OPG086 × 2 （P68458） Entry-fusion complex protein OPG094 × 2 （P68623） Entry-fusion complex associated protein OPG083 × 1 （P24361） Protein OPG104 × 1 （P07618） Virion membrane protein OPG147 × 2 （P68712） Entry-fusion complex protein OPG076 × 2 （P0CK21）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PG107_VACCW
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–189； UniProt 1–189 Author chain d； PDBConstruct 1–189； UniProt 1–189

Entry-fusion complex protein OPG086

Orthopoxvirus vaccinia

UniProt P68458

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Virion membrane protein OPG143 × 1 （P16710） Entry-fusion complex protein OPG094 × 1 （P07611） Envelope protein OPG155 × 2 （P68633） Protein OPG107 × 2 （P08583） Entry-fusion complex protein OPG094 × 2 （P68623） Entry-fusion complex associated protein OPG083 × 1 （P24361） Protein OPG104 × 1 （P07618） Virion membrane protein OPG147 × 2 （P68712） Entry-fusion complex protein OPG076 × 2 （P0CK21）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PG086_VACCW
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–111； UniProt 1–111 Author chain e； PDBConstruct 1–111； UniProt 1–111

Entry-fusion complex protein OPG094

Orthopoxvirus vaccinia

UniProt P68623

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Virion membrane protein OPG143 × 1 （P16710） Entry-fusion complex protein OPG094 × 1 （P07611） Envelope protein OPG155 × 2 （P68633） Protein OPG107 × 2 （P08583） Entry-fusion complex protein OPG086 × 2 （P68458） Entry-fusion complex associated protein OPG083 × 1 （P24361） Protein OPG104 × 1 （P07618） Virion membrane protein OPG147 × 2 （P68712） Entry-fusion complex protein OPG076 × 2 （P0CK21）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PG099_VACCW
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–128； UniProt 1–128 Author chain f； PDBConstruct 1–128； UniProt 1–128

Entry-fusion complex associated protein OPG083

Orthopoxvirus vaccinia

UniProt P24361

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Virion membrane protein OPG143 × 1 （P16710） Entry-fusion complex protein OPG094 × 1 （P07611） Envelope protein OPG155 × 2 （P68633） Protein OPG107 × 2 （P08583） Entry-fusion complex protein OPG086 × 2 （P68458） Entry-fusion complex protein OPG094 × 2 （P68623） Protein OPG104 × 1 （P07618） Virion membrane protein OPG147 × 2 （P68712） Entry-fusion complex protein OPG076 × 2 （P0CK21）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PG053_VACCW
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–212； UniProt 1–212

Protein OPG104

Orthopoxvirus vaccinia

UniProt P07618

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Virion membrane protein OPG143 × 1 （P16710） Entry-fusion complex protein OPG094 × 1 （P07611） Envelope protein OPG155 × 2 （P68633） Protein OPG107 × 2 （P08583） Entry-fusion complex protein OPG086 × 2 （P68458） Entry-fusion complex protein OPG094 × 2 （P68623） Entry-fusion complex associated protein OPG083 × 1 （P24361） Virion membrane protein OPG147 × 2 （P68712） Entry-fusion complex protein OPG076 × 2 （P0CK21）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PG104_VACCW
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain I； PDBConstruct 1–133； UniProt 1–133

Virion membrane protein OPG147

Orthopoxvirus vaccinia

UniProt P68712

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Virion membrane protein OPG143 × 1 （P16710） Entry-fusion complex protein OPG094 × 1 （P07611） Envelope protein OPG155 × 2 （P68633） Protein OPG107 × 2 （P08583） Entry-fusion complex protein OPG086 × 2 （P68458） Entry-fusion complex protein OPG094 × 2 （P68623） Entry-fusion complex associated protein OPG083 × 1 （P24361） Protein OPG104 × 1 （P07618） Entry-fusion complex protein OPG076 × 2 （P0CK21）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PG147_VACCW
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain J； PDBConstruct 1–117； UniProt 1–117 Author chain j； PDBConstruct 1–117； UniProt 1–117

Entry-fusion complex protein OPG076

Orthopoxvirus vaccinia

UniProt P0CK21

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Virion membrane protein OPG143 × 1 （P16710） Entry-fusion complex protein OPG094 × 1 （P07611） Envelope protein OPG155 × 2 （P68633） Protein OPG107 × 2 （P08583） Entry-fusion complex protein OPG086 × 2 （P68458） Entry-fusion complex protein OPG094 × 2 （P68623） Entry-fusion complex associated protein OPG083 × 1 （P24361） Protein OPG104 × 1 （P07618） Virion membrane protein OPG147 × 2 （P68712）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PG076_VACCW
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain K； PDBConstruct 1–35； UniProt 1–35 Author chain k； PDBConstruct 1–35； UniProt 1–35

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9uzp
Deposition date deposition_date	2025-05-16
Structure title title	Cryo-EM Structure of the Vaccinia Virus Entry/Fusion Complex (EFC) Including the F9 Subunit
Keywords keywords	Vaccinia Virus, Entry-Fusion Complex (EFC), cryo-EM, Single-particle reconstruction, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9uzp__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9uzp__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9uzp__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	50.24 Å
Rg (electron density)	51.06 Å
Total Rg	51.06 Å
Atom count	19067
Residues	2365
Excluded volume	342350 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9uzp__assembly_1__model_1`	hexadecameric （16）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (10)

Entity 1 Entity 1 polymer

Description description	Virion membrane protein OPG143
Molecular weight formula_weight	43486.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	19067

MGAAVTLNRIKIAPGIADIRDKYMELGFNYPEYNRAVKFAEESYTYYYETSPGEIKPKFCLIDGMSIDHCSSFIVPEFAKQYVLIHGEPCSSFKFRPGSLIYYQNEVTPEYIKDLKHATDYIASGQRCHFIKKDYLLGDSDSVAKCCSKTNTKHCPKIFNNNYKTEHCDDFMTGFCRNDPGNPNCLEWLRAKRKPAMSTYSDICSKHMDARYCSEFIRIIRPDYFTFGDTALYVFCNDHKGNRNCWCANYPKSNSGDKYLGPRVCWLHECTDESRDRKWLYYNQDVQRTRCKYVGCTINVNSLALKNSQAELTSNCTRTTSAVGDVHPGEPVVKDKIKLPTWLGAAITLVVISVIFYFISIYSRPKIKTNDINVRRR

Source Source

Source organism organism	Orthopoxvirus vaccinia
NCBI taxonomy ID ncbi_taxonomy_id	10245
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Entry-fusion complex protein OPG094
Molecular weight formula_weight	38840.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MGGGVSVELPKRDPPPGVPTDEMLLNVDKMHDVIAPAKLLEYVHIGPLAKDKEDKVKKRYPEFRLVNTGPGGLSALLRQSYNGTAPNCCRTFNRTHYWKKDGKISDKYEEGAVLESCWPDVHDTGKCDVDLFDWCQGDTFDRNICHQWIGSAFNRSNRTVEGQQSLINLYNKMQTLCSKDASVPICESFLHHLRAHNTEDSKEMIDYILRQQSADFKQKYMRCSYPTRDKLEESLKYAEPRECWDPECSNANVNFLLTRNYNNLGLCNIVRCNTSVNNLQMDKTSSLRLSCGLSNSDRFSTVPVNRAKVVQHNIKHSFDLKLHLISLLSLLVIWILIVAI

Source Source

Source organism organism	Orthopoxvirus vaccinia
NCBI taxonomy ID ncbi_taxonomy_id	10245
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	Envelope protein OPG155
Molecular weight formula_weight	16340.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,c

MNSLSIFFIVVATAAVCLLFIQGYSIYENYGNIKEFNATHAAFEYSKSIGGTPALDRRVQDVNDTISDVKQKWRCVVYPGNGFVSASIFGFQAEVGPNNTRSIRKFNTMQQCIDFTFSDVININIYNPCVVPNINNAECQFLKSVL

Source Source

Source organism organism	Orthopoxvirus vaccinia
NCBI taxonomy ID ncbi_taxonomy_id	10245
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	Protein OPG107
Molecular weight formula_weight	21568.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,d

MDKTTLSVNACNLEYVREKAIVGVQAAKTSTLIFFVIILAISALLLWFQTSDNPVFNELTRYMRIKNTVNDWKSLTDSKTKLESDRGRLLAAGKDDIFEFKCVDFGAYFIAMRLDKKTYLPQAIRRGTGDAWMVKKAAKVDPSAQQFCQYLIKHKSNNVITCGNEMLNELGYSGYFMSPHWCSDFSNME

Source Source

Source organism organism	Orthopoxvirus vaccinia
NCBI taxonomy ID ncbi_taxonomy_id	10245
Host organism host_organism	Homo sapiens

Entity 5 Entity 5 polymer

Description description	Entry-fusion complex protein OPG086
Molecular weight formula_weight	12814.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,e

MASLLYLILFLLFVCISYYFTYYPTNKLQAAVMETDRENAIIRQRNDEIPTRTLDTAIFTDASTVASAQIHLYYNSNIGKIIMSLNGKKHTFNLYDDNDIRTLLPILLLSK

Source Source

Source organism organism	Orthopoxvirus vaccinia
NCBI taxonomy ID ncbi_taxonomy_id	10245
Host organism host_organism	Homo sapiens

Entity 6 Entity 6 polymer

Description description	Entry-fusion complex protein OPG094
Molecular weight formula_weight	15062.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,f

MENVPNVYFNPVFIEPTFKHSLLSVYKHRLIVLFEVFVVFILIYVFFRSELNMFFMPKRKIPDPIDRLRRANLACEDDKLMIYGLPWMTTQTSALSINSKPIVYKDCAKLLRSINGSQPVSLNDVLRR

Source Source

Source organism organism	Orthopoxvirus vaccinia
NCBI taxonomy ID ncbi_taxonomy_id	10245
Host organism host_organism	Homo sapiens

Entity 7 Entity 7 polymer

Description description	Entry-fusion complex associated protein OPG083
Molecular weight formula_weight	23900.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MAETKEFKTLYNLFIDSYLQKLAQHSIPTNVTCAIHIGEVIGQFKNCALRITNKCMSNSRLSFTLMVESFIEVISLLPEKDRRRIAEEIGIDLDDVPSAVSKLEKNCNAYAEVNNIIDIQKLDIGECSAPPGQHMLLQIVNTGSAEANCGLQTIVKSLNKIYVPPIIENRLPYYDPWFLVGVAIILVIFTVAICSIRRNLALKYRYGTFLYV

Source Source

Source organism organism	Orthopoxvirus vaccinia
NCBI taxonomy ID ncbi_taxonomy_id	10245
Host organism host_organism	Homo sapiens

Entity 8 Entity 8 polymer

Description description	Protein OPG104
Molecular weight formula_weight	15174.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MTDEQIYAFCDANKDDIRCKCIYPDKSIVRIGIDTRLPYYCWYEPCKRSDALLPASLKKNITKCNVSDCTISLGNVSITDSKLDVNNVCDSKRVATENIAVRYLNQEIRYPIIDIKWLPIGLLALAILILAFF

Source Source

Source organism organism	Orthopoxvirus vaccinia
NCBI taxonomy ID ncbi_taxonomy_id	10245
Host organism host_organism	Homo sapiens

Entity 9 Entity 9 polymer

Description description	Virion membrane protein OPG147
Molecular weight formula_weight	13661.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,j

MITLFLILCYFILIFNIIVPAISEKMRRERAAYVNYKRLNKNFICVDDRLFSYNFTTSGIKAKVAVDNKNVPIPCSKINEVNNNKDVDTLYCDKDRDDIPGFARSCYRAYSDLFFTT

Source Source

Source organism organism	Orthopoxvirus vaccinia
NCBI taxonomy ID ncbi_taxonomy_id	10245
Host organism host_organism	Homo sapiens

Entity 10 Entity 10 polymer

Description description	Entry-fusion complex protein OPG076
Molecular weight formula_weight	4230.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,k

MLVVIMFFIAFAFCSWLSYSYLRPYISTKELNKSR

Source Source

Source organism organism	Orthopoxvirus vaccinia
NCBI taxonomy ID ncbi_taxonomy_id	10245
Host organism host_organism	Homo sapiens

▶

Resolution resolution	3.05 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	474787

Cryo-EM Structure of the Vaccinia Virus Entry/Fusion Complex (EFC) Including the F9 Subunit

1. Protein Identity and Related Structures Protein Identity & Related Structures

Virion membrane protein OPG143

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Entry-fusion complex protein OPG094

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Envelope protein OPG155

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein OPG107

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Entry-fusion complex protein OPG086

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Entry-fusion complex protein OPG094

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Entry-fusion complex associated protein OPG083

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein OPG104

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Virion membrane protein OPG147

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Entry-fusion complex protein OPG076

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer