9xyb

Crystal structure of a ZIKV E glycoprotein DI-DIII vaccine candidate in complex with human neutralizing antibody MZ4

Method: X-RAY DIFFRACTION D_max: 103.9 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Envelope protein E

Zika virus ZIKV/H. sapiens/FrenchPolynesia/10087PF/2013

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain E； UniProt 291–342 Chain E； UniProt 425–486 Chain E； UniProt 576–695	Not recorded	Human MZ4 Fab heavy chain × 1 Human MZ4 Fab light chain × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；291 K；40% (v/v) pentaerythritol propoxylate (5/4 PO/OH), 15% (v/v) ethanol	Resolution 2.85 Å R-free 0.316

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9XYB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5GZR Zika virus E protein complexed with a neutralizing antibody Z23-Fab Deposited 2016-10-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 600 PDB declaration: 600-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa） Chain D 216–290（75 aa） Chain E 216–290（75 aa） Chain F 216–290（75 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3 uL Zika virus-Z23 Fab complex sample was transferred onto a glow-discharged ultra-thin carbon-coated copper grid (Purchased from Zhongjingkeyi Company, China) followed by 60s waiting and blotted for 2s with filter paper before plugging into liquid ethane using the FEI Vitrobot Mark IV	Resolution 9.40 Å
5GZR Zika virus E protein complexed with a neutralizing antibody Z23-Fab Deposited 2016-10-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa） Chain D 216–290（75 aa） Chain E 216–290（75 aa） Chain F 216–290（75 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3 uL Zika virus-Z23 Fab complex sample was transferred onto a glow-discharged ultra-thin carbon-coated copper grid (Purchased from Zhongjingkeyi Company, China) followed by 60s waiting and blotted for 2s with filter paper before plugging into liquid ethane using the FEI Vitrobot Mark IV	Resolution 9.40 Å
5GZR Zika virus E protein complexed with a neutralizing antibody Z23-Fab Deposited 2016-10-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 50 PDB declaration: 50-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa） Chain D 216–290（75 aa） Chain E 216–290（75 aa） Chain F 216–290（75 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3 uL Zika virus-Z23 Fab complex sample was transferred onto a glow-discharged ultra-thin carbon-coated copper grid (Purchased from Zhongjingkeyi Company, China) followed by 60s waiting and blotted for 2s with filter paper before plugging into liquid ethane using the FEI Vitrobot Mark IV	Resolution 9.40 Å
5GZR Zika virus E protein complexed with a neutralizing antibody Z23-Fab Deposited 2016-10-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 60 PDB declaration: 60-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa） Chain D 216–290（75 aa） Chain E 216–290（75 aa） Chain F 216–290（75 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3 uL Zika virus-Z23 Fab complex sample was transferred onto a glow-discharged ultra-thin carbon-coated copper grid (Purchased from Zhongjingkeyi Company, China) followed by 60s waiting and blotted for 2s with filter paper before plugging into liquid ethane using the FEI Vitrobot Mark IV	Resolution 9.40 Å
5GZR Zika virus E protein complexed with a neutralizing antibody Z23-Fab Deposited 2016-10-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa） Chain D 216–290（75 aa） Chain E 216–290（75 aa） Chain F 216–290（75 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3 uL Zika virus-Z23 Fab complex sample was transferred onto a glow-discharged ultra-thin carbon-coated copper grid (Purchased from Zhongjingkeyi Company, China) followed by 60s waiting and blotted for 2s with filter paper before plugging into liquid ethane using the FEI Vitrobot Mark IV	Resolution 9.40 Å
5GZR Zika virus E protein complexed with a neutralizing antibody Z23-Fab Deposited 2016-10-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 600 PDB declaration: 600-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa） Chain D 216–290（75 aa） Chain E 216–290（75 aa） Chain F 216–290（75 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；3 uL Zika virus-Z23 Fab complex sample was transferred onto a glow-discharged ultra-thin carbon-coated copper grid (Purchased from Zhongjingkeyi Company, China) followed by 60s waiting and blotted for 2s with filter paper before plugging into liquid ethane using the FEI Vitrobot Mark IV	Resolution 9.40 Å
5H30 Cryo-EM structure of zika virus complexed with Fab C10 at pH 6.5 Deposited 2016-10-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 720 PDB declaration: 720-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa） Chain D 216–290（75 aa） Chain E 216–290（75 aa） Chain F 216–290（75 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
5H30 Cryo-EM structure of zika virus complexed with Fab C10 at pH 6.5 Deposited 2016-10-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa） Chain D 216–290（75 aa） Chain E 216–290（75 aa） Chain F 216–290（75 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
5H30 Cryo-EM structure of zika virus complexed with Fab C10 at pH 6.5 Deposited 2016-10-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 60 PDB declaration: 60-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa） Chain D 216–290（75 aa） Chain E 216–290（75 aa） Chain F 216–290（75 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
5H30 Cryo-EM structure of zika virus complexed with Fab C10 at pH 6.5 Deposited 2016-10-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 72 PDB declaration: 72-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa） Chain D 216–290（75 aa） Chain E 216–290（75 aa） Chain F 216–290（75 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
5H30 Cryo-EM structure of zika virus complexed with Fab C10 at pH 6.5 Deposited 2016-10-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa） Chain D 216–290（75 aa） Chain E 216–290（75 aa） Chain F 216–290（75 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
5H30 Cryo-EM structure of zika virus complexed with Fab C10 at pH 6.5 Deposited 2016-10-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 720 PDB declaration: 720-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa） Chain D 216–290（75 aa） Chain E 216–290（75 aa） Chain F 216–290（75 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
5H32 Cryo-EM structure of zika virus complexed with Fab C10 at pH 5.0 Deposited 2016-10-20	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 540 PDB declaration: 540-meric	Chain A 291–693（403 aa） Chain B 291–693（403 aa） Chain C 291–693（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 12.00 Å
5H32 Cryo-EM structure of zika virus complexed with Fab C10 at pH 5.0 Deposited 2016-10-20	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 291–693（403 aa） Chain B 291–693（403 aa） Chain C 291–693（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 12.00 Å
5H32 Cryo-EM structure of zika virus complexed with Fab C10 at pH 5.0 Deposited 2016-10-20	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain A 291–693（403 aa） Chain B 291–693（403 aa） Chain C 291–693（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 12.00 Å
5H32 Cryo-EM structure of zika virus complexed with Fab C10 at pH 5.0 Deposited 2016-10-20	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 54 PDB declaration: 54-meric	Chain A 291–693（403 aa） Chain B 291–693（403 aa） Chain C 291–693（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 12.00 Å
5H32 Cryo-EM structure of zika virus complexed with Fab C10 at pH 5.0 Deposited 2016-10-20	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 291–693（403 aa） Chain B 291–693（403 aa） Chain C 291–693（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 12.00 Å
5H32 Cryo-EM structure of zika virus complexed with Fab C10 at pH 5.0 Deposited 2016-10-20	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 540 PDB declaration: 540-meric	Chain A 291–693（403 aa） Chain B 291–693（403 aa） Chain C 291–693（403 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 12.00 Å
5H37 Cryo-EM structure of zika virus complexed with Fab C10 at pH 8.0 Deposited 2016-10-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 720 PDB declaration: 720-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa） Chain D 216–290（75 aa） Chain E 216–290（75 aa） Chain F 216–290（75 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
5H37 Cryo-EM structure of zika virus complexed with Fab C10 at pH 8.0 Deposited 2016-10-20	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa） Chain D 216–290（75 aa） Chain E 216–290（75 aa） Chain F 216–290（75 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
5H37 Cryo-EM structure of zika virus complexed with Fab C10 at pH 8.0 Deposited 2016-10-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 60 PDB declaration: 60-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa） Chain D 216–290（75 aa） Chain E 216–290（75 aa） Chain F 216–290（75 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
5H37 Cryo-EM structure of zika virus complexed with Fab C10 at pH 8.0 Deposited 2016-10-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 72 PDB declaration: 72-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa） Chain D 216–290（75 aa） Chain E 216–290（75 aa） Chain F 216–290（75 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
5H37 Cryo-EM structure of zika virus complexed with Fab C10 at pH 8.0 Deposited 2016-10-20	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa） Chain D 216–290（75 aa） Chain E 216–290（75 aa） Chain F 216–290（75 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
5H37 Cryo-EM structure of zika virus complexed with Fab C10 at pH 8.0 Deposited 2016-10-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 720 PDB declaration: 720-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa） Chain D 216–290（75 aa） Chain E 216–290（75 aa） Chain F 216–290（75 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
5IY3 Zika Virus Non-structural Protein NS1 Deposited 2016-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 966–1146（181 aa） Fragment：UNP residues 966-1146 Chain B 966–1146（181 aa） Fragment：UNP residues 966-1146	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.09 M NPS mix[NaNO3, Na2HPO4, (NH4)2SO4], 0.1 M buffer mix (Imidazole, Sodium Cacodylate, MES; Bis-Tris) pH 6.5, 37.5% MPD_P1K_P3350 mix(MPD, PEG 1000, PEG 3350)	Resolution 2.20 Å R-free 0.246
5IZ7 Cryo-EM structure of thermally stable Zika virus strain H/PF/2013 Deposited 2016-03-25	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 360 PDB declaration: 360-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 180	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 1s	Resolution 3.70 Å
5IZ7 Cryo-EM structure of thermally stable Zika virus strain H/PF/2013 Deposited 2016-03-25	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 1s	Resolution 3.70 Å
5IZ7 Cryo-EM structure of thermally stable Zika virus strain H/PF/2013 Deposited 2016-03-25	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 15	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 1s	Resolution 3.70 Å
5IZ7 Cryo-EM structure of thermally stable Zika virus strain H/PF/2013 Deposited 2016-03-25	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 1s	Resolution 3.70 Å
5IZ7 Cryo-EM structure of thermally stable Zika virus strain H/PF/2013 Deposited 2016-03-25	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 1s	Resolution 3.70 Å
5JMT Crystal structure of Zika virus NS3 helicase Deposited 2016-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1674–2119（446 aa） Fragment：UNP residues 1674-2119	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 5.2；291 K；0.1 M Sodium citrate tribasic dihydrate (pH 5.5), 22%(w/v) polyethylene glycol 1000	Resolution 1.80 Å R-free 0.200
5KVD Zika specific antibody, ZV-2, bound to ZIKA envelope DIII Deposited 2016-07-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 589–697（109 aa） Fragment：UNP residues 589-697	Not recorded	NA SODIUM ION × 2 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.1 M MES pH6.5, 0.6 M NaCl and 20.6% PEG 4000	Resolution 1.65 Å R-free 0.221
5KVF Zika specific antibody, ZV-64, bound to ZIKA envelope DIII Deposited 2016-07-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 589–697（109 aa） Fragment：UNP residues 589-697	Not recorded	GOL GLYCEROL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.1 M sodium acetate and 22% PEG4000	Resolution 1.40 Å R-free 0.186
5KVG Zika specific antibody, ZV-67, bound to ZIKA envelope DIII Deposited 2016-07-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 589–697（109 aa） Fragment：UNP residues 589-697	Not recorded	CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.2 M Ammonium formate, 20% PEG 3350	Resolution 1.40 Å R-free 0.179
6CO8 Structure of Zika virus at a resolution of 3.1 Angstrom Deposited 2018-03-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 360 PDB declaration: 360-meric	Chain A 291–794（504 aa） Fragment：UNP residues 291-794 Chain B 216–290（75 aa） Fragment：UNP residues 216-290 Chain C 291–794（504 aa） Fragment：UNP residues 291-794 Chain D 216–290（75 aa） Fragment：UNP residues 216-290 Chain E 291–794（504 aa） Fragment：UNP residues 291-794 Chain F 216–290（75 aa） Fragment：UNP residues 216-290	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；12 mM Tris-HCl, pH 8, 120 mM NaCl, 1 mM EDTA cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
6CO8 Structure of Zika virus at a resolution of 3.1 Angstrom Deposited 2018-03-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 291–794（504 aa） Fragment：UNP residues 291-794 Chain B 216–290（75 aa） Fragment：UNP residues 216-290 Chain C 291–794（504 aa） Fragment：UNP residues 291-794 Chain D 216–290（75 aa） Fragment：UNP residues 216-290 Chain E 291–794（504 aa） Fragment：UNP residues 291-794 Chain F 216–290（75 aa） Fragment：UNP residues 216-290	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；12 mM Tris-HCl, pH 8, 120 mM NaCl, 1 mM EDTA cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
6CO8 Structure of Zika virus at a resolution of 3.1 Angstrom Deposited 2018-03-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Homooligomer；Protein × 30 PDB declaration: 30-meric	Chain A 291–794（504 aa） Fragment：UNP residues 291-794 Chain B 216–290（75 aa） Fragment：UNP residues 216-290 Chain C 291–794（504 aa） Fragment：UNP residues 291-794 Chain D 216–290（75 aa） Fragment：UNP residues 216-290 Chain E 291–794（504 aa） Fragment：UNP residues 291-794 Chain F 216–290（75 aa） Fragment：UNP residues 216-290	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；12 mM Tris-HCl, pH 8, 120 mM NaCl, 1 mM EDTA cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
6CO8 Structure of Zika virus at a resolution of 3.1 Angstrom Deposited 2018-03-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Homooligomer；Protein × 36 PDB declaration: 36-meric	Chain A 291–794（504 aa） Fragment：UNP residues 291-794 Chain B 216–290（75 aa） Fragment：UNP residues 216-290 Chain C 291–794（504 aa） Fragment：UNP residues 291-794 Chain D 216–290（75 aa） Fragment：UNP residues 216-290 Chain E 291–794（504 aa） Fragment：UNP residues 291-794 Chain F 216–290（75 aa） Fragment：UNP residues 216-290	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；12 mM Tris-HCl, pH 8, 120 mM NaCl, 1 mM EDTA cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
6CO8 Structure of Zika virus at a resolution of 3.1 Angstrom Deposited 2018-03-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 291–794（504 aa） Fragment：UNP residues 291-794 Chain B 216–290（75 aa） Fragment：UNP residues 216-290 Chain C 291–794（504 aa） Fragment：UNP residues 291-794 Chain D 216–290（75 aa） Fragment：UNP residues 216-290 Chain E 291–794（504 aa） Fragment：UNP residues 291-794 Chain F 216–290（75 aa） Fragment：UNP residues 216-290	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；12 mM Tris-HCl, pH 8, 120 mM NaCl, 1 mM EDTA cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
6JFH The asymmetric-reconstructed cryo-EM structure of Zika virus-FabZK2B10 complex Deposited 2019-02-08	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain B 216–290（75 aa） Chain D 216–290（75 aa） Chain F 216–290（75 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 20.00 Å
6JFI The symmetric-reconstructed cryo-EM structure of Zika virus-FabZK2B10 complex Deposited 2019-02-08	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 600 PDB declaration: 600-meric	Chain B 216–290（75 aa） Chain D 216–290（75 aa） Chain F 216–290（75 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.00 Å
6JFI The symmetric-reconstructed cryo-EM structure of Zika virus-FabZK2B10 complex Deposited 2019-02-08	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain B 216–290（75 aa） Chain D 216–290（75 aa） Chain F 216–290（75 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.00 Å
6JFI The symmetric-reconstructed cryo-EM structure of Zika virus-FabZK2B10 complex Deposited 2019-02-08	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 50 PDB declaration: 50-meric	Chain B 216–290（75 aa） Chain D 216–290（75 aa） Chain F 216–290（75 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.00 Å
6JFI The symmetric-reconstructed cryo-EM structure of Zika virus-FabZK2B10 complex Deposited 2019-02-08	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 60 PDB declaration: 60-meric	Chain B 216–290（75 aa） Chain D 216–290（75 aa） Chain F 216–290（75 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.00 Å
6JFI The symmetric-reconstructed cryo-EM structure of Zika virus-FabZK2B10 complex Deposited 2019-02-08	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain B 216–290（75 aa） Chain D 216–290（75 aa） Chain F 216–290（75 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.00 Å
6LD1 Zika NS5 polymerase domain Deposited 2019-11-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2790–3411（622 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 3 ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；293 K；10% PEG 6000, 0.2M HEPES pH 7.5	Resolution 1.40 Å R-free 0.218
6LD2 Zika NS5 polymerase domain Deposited 2019-11-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2790–3411（622 aa）	Not recorded	ZN ZINC ION × 2 KY3 (1S,2S,4S,5R)-2,4-dimethoxy-5-thiophen-2-yl-cyclohexane-1-carboxylic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；10% PEG 6000, 0.2M HEPES pH7.5	Resolution 1.40 Å R-free 0.227
6LD3 Zika NS5 polymerase domain Deposited 2019-11-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2790–3411（622 aa）	Not recorded	ZN ZINC ION × 2 G8O 2,4-dimethoxy-5-thiophen-2-yl-benzoic acid × 1 FB2 benzenesulfonamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；10% PEG 6000, 0.2M HEPES pH 7.5	Resolution 2.30 Å R-free 0.249
6LD4 Zika NS5 polymerase domain Deposited 2019-11-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2790–3411（622 aa）	Not recorded	ZN ZINC ION × 2 G8O 2,4-dimethoxy-5-thiophen-2-yl-benzoic acid × 1 G8F 3-methoxybenzenesulfonamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；10% PEG 6000, 0.2M HEPES pH7.5	Resolution 1.50 Å R-free 0.224
6LD5 Zika NS5 polymerase domain Deposited 2019-11-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2790–3411（622 aa）	Not recorded	ZN ZINC ION × 2 G8O 2,4-dimethoxy-5-thiophen-2-yl-benzoic acid × 1 G8L quinoline-8-sulfonamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；10% PEG 6000, 0.2M HEPES pH 7.4	Resolution 1.94 Å R-free 0.226
6LNT Cryo-EM structure of immature Zika virus in complex with human antibody DV62.5 Fab Deposited 2020-01-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 720 PDB declaration: 720-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa） Chain D 128–290（163 aa） Chain E 128–290（163 aa） Chain F 128–290（163 aa） Chain M 6–122（117 aa） Chain N 6–122（117 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl, 120 mM NaCl, 1 mM EDTA, pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.00 Å
6LNT Cryo-EM structure of immature Zika virus in complex with human antibody DV62.5 Fab Deposited 2020-01-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa） Chain D 128–290（163 aa） Chain E 128–290（163 aa） Chain F 128–290（163 aa） Chain M 6–122（117 aa） Chain N 6–122（117 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl, 120 mM NaCl, 1 mM EDTA, pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.00 Å
6LNT Cryo-EM structure of immature Zika virus in complex with human antibody DV62.5 Fab Deposited 2020-01-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 60 PDB declaration: 60-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa） Chain D 128–290（163 aa） Chain E 128–290（163 aa） Chain F 128–290（163 aa） Chain M 6–122（117 aa） Chain N 6–122（117 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl, 120 mM NaCl, 1 mM EDTA, pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.00 Å
6LNT Cryo-EM structure of immature Zika virus in complex with human antibody DV62.5 Fab Deposited 2020-01-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 72 PDB declaration: 72-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa） Chain D 128–290（163 aa） Chain E 128–290（163 aa） Chain F 128–290（163 aa） Chain M 6–122（117 aa） Chain N 6–122（117 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl, 120 mM NaCl, 1 mM EDTA, pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.00 Å
6LNT Cryo-EM structure of immature Zika virus in complex with human antibody DV62.5 Fab Deposited 2020-01-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa） Chain D 128–290（163 aa） Chain E 128–290（163 aa） Chain F 128–290（163 aa） Chain M 6–122（117 aa） Chain N 6–122（117 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl, 120 mM NaCl, 1 mM EDTA, pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 8.00 Å
6LNU Cryo-EM structure of immature Zika virus Deposited 2020-01-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 360 PDB declaration: 360-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa） Chain D 128–290（163 aa） Chain E 128–290（163 aa） Chain F 128–290（163 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl, 120 mM NaCl, 1 mM EDTA, pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
6LNU Cryo-EM structure of immature Zika virus Deposited 2020-01-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa） Chain D 128–290（163 aa） Chain E 128–290（163 aa） Chain F 128–290（163 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl, 120 mM NaCl, 1 mM EDTA, pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
6LNU Cryo-EM structure of immature Zika virus Deposited 2020-01-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 30 PDB declaration: 30-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa） Chain D 128–290（163 aa） Chain E 128–290（163 aa） Chain F 128–290（163 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl, 120 mM NaCl, 1 mM EDTA, pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
6LNU Cryo-EM structure of immature Zika virus Deposited 2020-01-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 36 PDB declaration: 36-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa） Chain D 128–290（163 aa） Chain E 128–290（163 aa） Chain F 128–290（163 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl, 120 mM NaCl, 1 mM EDTA, pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
6LNU Cryo-EM structure of immature Zika virus Deposited 2020-01-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa） Chain D 128–290（163 aa） Chain E 128–290（163 aa） Chain F 128–290（163 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；10 mM Tris-HCl, 120 mM NaCl, 1 mM EDTA, pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 9.00 Å
6MID Cryo-EM structure of the ZIKV virion in complex with Fab fragments of the potently neutralizing human monoclonal antibody ZIKV-195 Deposited 2018-09-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 480 PDB declaration: 480-meric	Chain A 291–794（504 aa） Fragment：UNP residues 291-794 Chain B 216–290（75 aa） Fragment：UNP residues 216-290 Chain C 291–794（504 aa） Fragment：UNP residues 291-794 Chain D 216–290（75 aa） Fragment：UNP residues 216-290 Chain E 291–794（504 aa） Fragment：UNP residues 291-794 Chain F 216–290（75 aa） Fragment：UNP residues 216-290	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；NTE buffer at pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
6MID Cryo-EM structure of the ZIKV virion in complex with Fab fragments of the potently neutralizing human monoclonal antibody ZIKV-195 Deposited 2018-09-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 291–794（504 aa） Fragment：UNP residues 291-794 Chain B 216–290（75 aa） Fragment：UNP residues 216-290 Chain C 291–794（504 aa） Fragment：UNP residues 291-794 Chain D 216–290（75 aa） Fragment：UNP residues 216-290 Chain E 291–794（504 aa） Fragment：UNP residues 291-794 Chain F 216–290（75 aa） Fragment：UNP residues 216-290	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；NTE buffer at pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
6MID Cryo-EM structure of the ZIKV virion in complex with Fab fragments of the potently neutralizing human monoclonal antibody ZIKV-195 Deposited 2018-09-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 40 PDB declaration: 40-meric	Chain A 291–794（504 aa） Fragment：UNP residues 291-794 Chain B 216–290（75 aa） Fragment：UNP residues 216-290 Chain C 291–794（504 aa） Fragment：UNP residues 291-794 Chain D 216–290（75 aa） Fragment：UNP residues 216-290 Chain E 291–794（504 aa） Fragment：UNP residues 291-794 Chain F 216–290（75 aa） Fragment：UNP residues 216-290	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；NTE buffer at pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
6MID Cryo-EM structure of the ZIKV virion in complex with Fab fragments of the potently neutralizing human monoclonal antibody ZIKV-195 Deposited 2018-09-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 48 PDB declaration: 48-meric	Chain A 291–794（504 aa） Fragment：UNP residues 291-794 Chain B 216–290（75 aa） Fragment：UNP residues 216-290 Chain C 291–794（504 aa） Fragment：UNP residues 291-794 Chain D 216–290（75 aa） Fragment：UNP residues 216-290 Chain E 291–794（504 aa） Fragment：UNP residues 291-794 Chain F 216–290（75 aa） Fragment：UNP residues 216-290	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；NTE buffer at pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
6MID Cryo-EM structure of the ZIKV virion in complex with Fab fragments of the potently neutralizing human monoclonal antibody ZIKV-195 Deposited 2018-09-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 291–794（504 aa） Fragment：UNP residues 291-794 Chain B 216–290（75 aa） Fragment：UNP residues 216-290 Chain C 291–794（504 aa） Fragment：UNP residues 291-794 Chain D 216–290（75 aa） Fragment：UNP residues 216-290 Chain E 291–794（504 aa） Fragment：UNP residues 291-794 Chain F 216–290（75 aa） Fragment：UNP residues 216-290	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；NTE buffer at pH 8.0 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
6NIP Crystal structure of a human anti-ZIKV-DENV neutralizing antibody MZ1 in complex with ZIKV E glycoprotein Deposited 2018-12-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 291–695（405 aa） Chain Z 291–695（405 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；291 K；0.06 M MgCl2, 0.1M Imidazole MES monohydrate (pH 6.5), 20% Ethylene glycol and 10% PEG 8,000	Resolution 4.16 Å R-free 0.237
6NIU Crystal structure of a human anti-ZIKV-DENV neutralizing antibody MZ4 in complex with ZIKV E glycoprotein Deposited 2018-12-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 291–695（405 aa） Chain Z 291–695（405 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9.5；291 K；1.26 M ammonium sulfate, 0.1 M CHES/NaOH (pH 9.5) and 0.2 M sodium chloride	Resolution 4.30 Å R-free 0.359
6NIU Crystal structure of a human anti-ZIKV-DENV neutralizing antibody MZ4 in complex with ZIKV E glycoprotein Deposited 2018-12-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 291–695（405 aa） Chain B 291–695（405 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9.5；291 K；1.26 M ammonium sulfate, 0.1 M CHES/NaOH (pH 9.5) and 0.2 M sodium chloride	Resolution 4.30 Å R-free 0.359
7BSD Complex structure of 1G5.3 Fab bound to ZIKV NS1c Deposited 2020-03-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain G 966–1146（181 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；14% v/vPoly(acrylic acid-co-maleic acid) solution	Resolution 2.53 Å R-free 0.239
7BSD Complex structure of 1G5.3 Fab bound to ZIKV NS1c Deposited 2020-03-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain I 966–1146（181 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；14% v/vPoly(acrylic acid-co-maleic acid) solution	Resolution 2.53 Å R-free 0.239
7BU8 Cryo-EM structure of zika virus complexed with Fab SIgN-3C at pH 6.5 Deposited 2020-04-05	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 720 PDB declaration: 720-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 180	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
7BU8 Cryo-EM structure of zika virus complexed with Fab SIgN-3C at pH 6.5 Deposited 2020-04-05	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
7BU8 Cryo-EM structure of zika virus complexed with Fab SIgN-3C at pH 6.5 Deposited 2020-04-05	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 60 PDB declaration: 60-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 15	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
7BU8 Cryo-EM structure of zika virus complexed with Fab SIgN-3C at pH 6.5 Deposited 2020-04-05	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 72 PDB declaration: 72-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
7BU8 Cryo-EM structure of zika virus complexed with Fab SIgN-3C at pH 6.5 Deposited 2020-04-05	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
7BUA Cryo-EM structure of zika virus complexed with Fab SIgN-3C at pH 8.0 Deposited 2020-04-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 720 PDB declaration: 720-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 180	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.80 Å
7BUA Cryo-EM structure of zika virus complexed with Fab SIgN-3C at pH 8.0 Deposited 2020-04-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.80 Å
7BUA Cryo-EM structure of zika virus complexed with Fab SIgN-3C at pH 8.0 Deposited 2020-04-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 60 PDB declaration: 60-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 15	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.80 Å
7BUA Cryo-EM structure of zika virus complexed with Fab SIgN-3C at pH 8.0 Deposited 2020-04-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 72 PDB declaration: 72-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.80 Å
7BUA Cryo-EM structure of zika virus complexed with Fab SIgN-3C at pH 8.0 Deposited 2020-04-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.80 Å
7CBP CryoEM structure of Zika virus with Fab at 4.1 Angstrom Deposited 2020-06-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 600 PDB declaration: 600-meric	Chain K 291–791（501 aa） Chain N 291–791（501 aa） Chain Q 291–791（501 aa） Chain T 216–290（75 aa） Chain U 216–290（75 aa） Chain V 216–290（75 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
7CBP CryoEM structure of Zika virus with Fab at 4.1 Angstrom Deposited 2020-06-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain K 291–791（501 aa） Chain N 291–791（501 aa） Chain Q 291–791（501 aa） Chain T 216–290（75 aa） Chain U 216–290（75 aa） Chain V 216–290（75 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
7CBP CryoEM structure of Zika virus with Fab at 4.1 Angstrom Deposited 2020-06-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 50 PDB declaration: 50-meric	Chain K 291–791（501 aa） Chain N 291–791（501 aa） Chain Q 291–791（501 aa） Chain T 216–290（75 aa） Chain U 216–290（75 aa） Chain V 216–290（75 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
7CBP CryoEM structure of Zika virus with Fab at 4.1 Angstrom Deposited 2020-06-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 60 PDB declaration: 60-meric	Chain K 291–791（501 aa） Chain N 291–791（501 aa） Chain Q 291–791（501 aa） Chain T 216–290（75 aa） Chain U 216–290（75 aa） Chain V 216–290（75 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
7CBP CryoEM structure of Zika virus with Fab at 4.1 Angstrom Deposited 2020-06-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain K 291–791（501 aa） Chain N 291–791（501 aa） Chain Q 291–791（501 aa） Chain T 216–290（75 aa） Chain U 216–290（75 aa） Chain V 216–290（75 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
7YAR ZIKV_Fab_G9E Deposited 2022-06-28	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 720 PDB declaration: 720-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
7YAR ZIKV_Fab_G9E Deposited 2022-06-28	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
7YAR ZIKV_Fab_G9E Deposited 2022-06-28	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 60 PDB declaration: 60-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
7YAR ZIKV_Fab_G9E Deposited 2022-06-28	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 72 PDB declaration: 72-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
7YAR ZIKV_Fab_G9E Deposited 2022-06-28	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.90 Å
8EE5 Crystal structure of a NHP anti-ZIKV neutralizing antibody rhMZ119-D in complex with ZIKV E glycoprotein Deposited 2022-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain Z 291–695（405 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；0.06M Nitrate Phosphate Sulfate , 0.1M Sodium HEPES and MOPS (acid) pH 7.5, 20% Ethylene glycol, 10 % PEG 8000 + 2% w/v Benzamidine hydrochloride	Resolution 3.58 Å R-free 0.296
8EE8 Crystal structure of a NHP anti-ZIKV neutralizing antibody rhMZ100-C in complex with ZIKV E glycoprotein Deposited 2022-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 291–695（405 aa） Chain B 291–695（405 aa） Chain E 291–695（405 aa） Chain Z 291–695（405 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；12% PEG 8000, 0.2 M (NH4)2SO4, 0.1M Tris (pH 8.5)	Resolution 2.80 Å R-free 0.295
8EED Crystal structure of a NHP anti-ZIKV neutralizing antibody rhMZ107-B in complex with ZIKV E glycoprotein Deposited 2022-09-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 291–695（405 aa） Chain B 291–695（405 aa） Chain C 291–695（405 aa） Chain D 291–695（405 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；15% PEG 6000, 5% MPD, 0.1 M MES (pH 6.5)	Resolution 3.49 Å R-free 0.331
8EEE Crystal structure of a NHP anti-ZIKV neutralizing antibody rhMZ104-d in complex with ZIKV E glycoprotein Deposited 2022-09-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 291–695（405 aa） Chain Z 291–695（405 aa）	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；12% PEG 8000, 0.2 M (NH4)2SO4, 0.1M Tris-HCl (pH 8.5)	Resolution 2.82 Å R-free 0.275
9JS6 cryoEM of antibody complexed with immature Zika virus Deposited 2024-09-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 480 PDB declaration: 480-meric	Chain A 292–794（503 aa） Chain B 292–794（503 aa） Chain C 292–794（503 aa） Chain D 128–290（163 aa） Chain E 128–290（163 aa） Chain F 128–290（163 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.80 Å
9JS6 cryoEM of antibody complexed with immature Zika virus Deposited 2024-09-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 292–794（503 aa） Chain B 292–794（503 aa） Chain C 292–794（503 aa） Chain D 128–290（163 aa） Chain E 128–290（163 aa） Chain F 128–290（163 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.80 Å
9JS6 cryoEM of antibody complexed with immature Zika virus Deposited 2024-09-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain A 292–794（503 aa） Chain B 292–794（503 aa） Chain C 292–794（503 aa） Chain D 128–290（163 aa） Chain E 128–290（163 aa） Chain F 128–290（163 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.80 Å
9JS6 cryoEM of antibody complexed with immature Zika virus Deposited 2024-09-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 48 PDB declaration: 48-meric	Chain A 292–794（503 aa） Chain B 292–794（503 aa） Chain C 292–794（503 aa） Chain D 128–290（163 aa） Chain E 128–290（163 aa） Chain F 128–290（163 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.80 Å
9JS6 cryoEM of antibody complexed with immature Zika virus Deposited 2024-09-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 292–794（503 aa） Chain B 292–794（503 aa） Chain C 292–794（503 aa） Chain D 128–290（163 aa） Chain E 128–290（163 aa） Chain F 128–290（163 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.80 Å
9JS7 cryoEM of antibody complexed with mature Zika virus Deposited 2024-09-30	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 420 PDB declaration: 420-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.84 Å
9JS7 cryoEM of antibody complexed with mature Zika virus Deposited 2024-09-30	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.84 Å
9JS7 cryoEM of antibody complexed with mature Zika virus Deposited 2024-09-30	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 35 PDB declaration: 35-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.84 Å
9JS7 cryoEM of antibody complexed with mature Zika virus Deposited 2024-09-30	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 42 PDB declaration: 42-meric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.84 Å
9JS7 cryoEM of antibody complexed with mature Zika virus Deposited 2024-09-30	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 291–794（504 aa） Chain B 291–794（504 aa） Chain C 291–794（504 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.84 Å
9OD2 Cryo-EM structure of modified Zika virus E protein dimer complexed with a neutralizing antibody SMZAb2 Fab Deposited 2025-04-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 290–695（406 aa） Chain B 290–695（406 aa）	Mutation：G5C, G102C Mutation：G5C, G102C	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.09 Å

35 other PDB entries and 105 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	POLG_ZIKVF
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain E； PDBConstruct 1–52； UniProt 291–342 Author chain E； PDBConstruct 61–122； UniProt 425–486 Author chain E； PDBConstruct 131–250； UniProt 576–695

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9xyb
Deposition date deposition_date	2025-08-25
Structure title title	Crystal structure of a ZIKV E glycoprotein DI-DIII vaccine candidate in complex with human neutralizing antibody MZ4
Keywords keywords	envelope protein, vaccine candidate, recombinant protein, Zika virus, human antibody, neutralizing antibody, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	30.71 Å
Radius of gyration Rg (electron density) rg_electron	30.49 Å
Forward intensity I(0) i0	82347000.00
Molecular weight molecular_weight	70263.0 kDa
Excluded volume excluded_volume	87373 Å³
Envelope volume envelope_volume	111900 Å³
Hydration-shell volume shell_volume	32334 Å³
Envelope diameter envelope_diameter	108.4 Å
Shell Rg shell_rg	35.77 Å
Envelope Rg envelope_rg	30.51 Å
Shape Rg shape_rg	30.46 Å
Total Rg total_rg	31.04 Å
Total atoms total_atoms	4936
Residues n_residues	641
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	103.9 Å
Rg (real space) rg_real	30.93 Å
Rg uncertainty (real space) rg_real_error	0.79 Å
I(0) (real space) i0_real	8.2350e+07
I(0) uncertainty (real space) i0_real_error	1.2160e+06
Rg (reciprocal space) rg_reciprocal	30.84 Å
I(0) (reciprocal space) i0_reciprocal	82340000.0000
Solution quality estimate total_estimate	0.8503
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	32.0 Å
Skewness Skewness skewness	0.531
Kurtosis Kurtosis kurtosis	-0.240
Angular range angular_range	— – 0.2600 Å⁻¹
Current regularization parameter α current_alpha	0.0001
Highest regularization parameter α highest_alpha	15260000.0000
Real-space data points n_real_points	53
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.802; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.863; Smooth: 0.780

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Human MZ4 Fab heavy chain
Molecular weight formula_weight	23371.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H
Atom count atom_count	4937

QVHLQESGPGLVRPSETLSLTCTVSDGSISSYYWSWIRQPPGKGLEWIGSIYYTGSTNYNPSLKSRVTMSVDTSKNQFSLRLNSVTAADTAMYYCAGLDRYSWNEGGDHWGQGILVSVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE

来源 Source

来源生物 organism	Homo sapiens
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Human MZ4 Fab light chain
Molecular weight formula_weight	22799.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

QPVLTQPPSASGTPGQRVSISCSGSRSNLGKNTVNWYQQLPGTAPKLLIYNHSRRPSGVPERFSGSKSGTSASLAISGLQSEDEADYFCAAWDDSLNGLYVFGTGTKVTVLRQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT

来源 Source

来源生物 organism	Homo sapiens
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	Envelope protein E
Molecular weight formula_weight	29375.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

IRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIELVTTTVSNGGGGGGGGLEYRIMLSVHGSQHSGMIVNDTGHETDENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLGGGGGGGGSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSGGGSGLNDIFEAQKIEWHEHHHHHHHH

来源 Source

来源生物 organism	Zika virus ZIKV/H. sapiens/FrenchPolynesia/10087PF/2013
NCBI Class编号 ncbi_taxonomy_id	2043570
宿主生物 host_organism	Drosophila melanogaster

Entity 4 Entity 4 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	nat
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1

▶

8. Citations (1)

▶

Unit-cell length a length_a	135.551 Å
Unit-cell length b length_b	57.257 Å
Unit-cell length c length_c	88.126 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	2.850 Å
Low-resolution limit resolution_low	32.900 Å
R factor r_factor	0.2395
R_work r_work	0.2354
R_free r_free	0.3161

fit	/app/data/saxs_computation/xy/9xyb/9xyb.fit
pddf	/app/data/pr_computation/xy/9xyb/9xyb.pr.out
profile	/app/data/saxs_computation/xy/9xyb/9xyb.dat

Crystal structure of a ZIKV E glycoprotein DI-DIII vaccine candidate in complex with human neutralizing antibody MZ4

1. Protein Identity and Related Structures Protein Identity & Related Structures

Envelope protein E

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)