SAXSdb — 3o0e

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Porin OmpF

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Colicin-E9 × 3 （P09883） octyl beta-D-glucopyranoside × 3 water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	Colicin-E9 × 3 （P09883） octyl beta-D-glucopyranoside × 3 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A418U3R0_ECOLX
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–340； UniProt 10–349 Author chain B； PDBConstruct 1–340； UniProt 10–349 Author chain C； PDBConstruct 1–340； UniProt 10–349 Author chain D； PDBConstruct 1–340； UniProt 10–349 Author chain E； PDBConstruct 1–340； UniProt 10–349 Author chain F； PDBConstruct 1–340； UniProt 10–349

Colicin-E9

OrganismNot specified

UniProt P09883

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Porin OmpF × 3 （A0A418U3R0） octyl beta-D-glucopyranoside × 3 water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	Porin OmpF × 3 （A0A418U3R0） octyl beta-D-glucopyranoside × 3 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CEA9_ECOLX
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain L； PDBConstruct 1–17； UniProt 2–18 Author chain M； PDBConstruct 1–17； UniProt 2–18 Author chain N； PDBConstruct 1–17； UniProt 2–18 Author chain O； PDBConstruct 1–17； UniProt 2–18 Author chain P； PDBConstruct 1–17； UniProt 2–18 Author chain Q； PDBConstruct 1–17； UniProt 2–18

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3o0e
Deposition date deposition_date	2010-07-19
Structure title title	Crystal structure of OmpF in complex with colicin peptide OBS1
Keywords keywords	porin, membrane protein, complex, colicin; MEMBRANE PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3o0e__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3o0e__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3o0e__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	30.90 Å
Rg (electron density)	30.36 Å
Total Rg	31.12 Å
Atom count	15827
Residues	1060
Excluded volume	142880 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3o0e__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3o0e__assembly_2__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Porin OmpF
Molecular weight formula_weight	37114.2 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F
Atom count atom_count	31735

AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF

Entity 2 Entity 2 polymer

Description description	Colicin-E9
Molecular weight formula_weight	1557.5 kDa
EC 编号 ec_number	3.1.-.-
Source method src_method	syn
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,M,N,O,P,Q

SGGDGRGHNTGAHSTSG

Entity 3 Entity 3 non-polymer

Description description	octyl beta-D-glucopyranoside
Molecular weight formula_weight	292.4 kDa
Source method src_method	man
Copy count entity_count	6

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	42

▼

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	3o0eA00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	160 — Porin
Homologous superfamily homologous superfamily	10 — Porin

Domain ID domain_id	3o0eB00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	160 — Porin
Homologous superfamily homologous superfamily	10 — Porin

Domain ID domain_id	3o0eC00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	160 — Porin
Homologous superfamily homologous superfamily	10 — Porin

Domain ID domain_id	3o0eD00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	160 — Porin
Homologous superfamily homologous superfamily	10 — Porin

Domain ID domain_id	3o0eE00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	160 — Porin
Homologous superfamily homologous superfamily	10 — Porin

Domain ID domain_id	3o0eF00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	160 — Porin
Homologous superfamily homologous superfamily	10 — Porin

▶

Unit-cell length a length_a	101.491 Å
Unit-cell length b length_b	101.618 Å
Unit-cell length c length_c	162.142 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	94.46 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	3.010 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.2669
R_work r_work	0.2651
R_free r_free	0.3025

Crystal structure of OmpF in complex with colicin peptide OBS1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Porin OmpF

State in the Current Structure

Other States of the Same Protein in the Database

Colicin-E9

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3o0e__assembly_1__model_1

3o0e__assembly_1__model_1 | I(q)

3o0e__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)

Crystal structure of OmpF in complex with colicin peptide OBS1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Porin OmpF

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Colicin-E9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3o0e__assembly_1__model_1

3o0e__assembly_1__model_1 | I(q)

3o0e__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)