4xk8

Crystal structure of plant photosystem I-LHCI super-complex at 2.8 angstrom resolution

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I iron-sulfur center

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Photosystem I P700 chlorophyll a apoprotein A1 × 1 Photosystem I P700 chlorophyll a apoprotein A2 × 1 Uncharacterized protein × 1 （I1NGD2） Putative uncharacterized protein × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Photosystem I reaction center subunit V, chloroplastic × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （A4GGC6） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） Putative uncharacterized protein × 1 （E1C9L1） Chlorophyll a-b binding protein 6, chloroplastic × 1 Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 CHLOROPHYLL A × 143 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 6 BETA-CAROTENE × 26 IRON/SULFUR CLUSTER × 3 heptyl 1-thio-beta-D-glucopyranoside × 3 DODECYL-BETA-D-MALTOSIDE × 1 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 CHLOROPHYLL B × 12 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 water × 11	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 16	Photosystem I P700 chlorophyll a apoprotein A1 × 1 Photosystem I P700 chlorophyll a apoprotein A2 × 1 Uncharacterized protein × 1 （I1NGD2） Putative uncharacterized protein × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Photosystem I reaction center subunit V, chloroplastic × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （A4GGC6） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） Putative uncharacterized protein × 1 （E1C9L1） Chlorophyll a-b binding protein 6, chloroplastic × 1 Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 CHLOROPHYLL A × 142 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 26 IRON/SULFUR CLUSTER × 3 heptyl 1-thio-beta-D-glucopyranoside × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 CHLOROPHYLL B × 12 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 water × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAC_PEA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–80； UniProt 2–81 Author chain c； PDBConstruct 1–80； UniProt 2–81

Uncharacterized protein

OrganismNot specified

UniProt I1NGD2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Photosystem I P700 chlorophyll a apoprotein A1 × 1 Photosystem I P700 chlorophyll a apoprotein A2 × 1 Photosystem I iron-sulfur center × 1 （P10793） Putative uncharacterized protein × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Photosystem I reaction center subunit V, chloroplastic × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （A4GGC6） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） Putative uncharacterized protein × 1 （E1C9L1） Chlorophyll a-b binding protein 6, chloroplastic × 1 Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 CHLOROPHYLL A × 143 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 6 BETA-CAROTENE × 26 IRON/SULFUR CLUSTER × 3 heptyl 1-thio-beta-D-glucopyranoside × 3 DODECYL-BETA-D-MALTOSIDE × 1 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 CHLOROPHYLL B × 12 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 water × 11	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 16	Photosystem I P700 chlorophyll a apoprotein A1 × 1 Photosystem I P700 chlorophyll a apoprotein A2 × 1 Photosystem I iron-sulfur center × 1 （P10793） Putative uncharacterized protein × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Photosystem I reaction center subunit V, chloroplastic × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （A4GGC6） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） Putative uncharacterized protein × 1 （E1C9L1） Chlorophyll a-b binding protein 6, chloroplastic × 1 Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 CHLOROPHYLL A × 142 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 26 IRON/SULFUR CLUSTER × 3 heptyl 1-thio-beta-D-glucopyranoside × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 CHLOROPHYLL B × 12 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 water × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I1NGD2_SOYBN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–141； UniProt 63–203 Author chain d； PDBConstruct 1–141； UniProt 63–203

Photosystem I reaction center subunit VIII

OrganismNot specified

UniProt P17227

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Photosystem I P700 chlorophyll a apoprotein A1 × 1 Photosystem I P700 chlorophyll a apoprotein A2 × 1 Photosystem I iron-sulfur center × 1 （P10793） Uncharacterized protein × 1 （I1NGD2） Putative uncharacterized protein × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Photosystem I reaction center subunit V, chloroplastic × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit IX × 1 （A4GGC6） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） Putative uncharacterized protein × 1 （E1C9L1） Chlorophyll a-b binding protein 6, chloroplastic × 1 Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 CHLOROPHYLL A × 143 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 6 BETA-CAROTENE × 26 IRON/SULFUR CLUSTER × 3 heptyl 1-thio-beta-D-glucopyranoside × 3 DODECYL-BETA-D-MALTOSIDE × 1 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 CHLOROPHYLL B × 12 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 water × 11	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 16	Photosystem I P700 chlorophyll a apoprotein A1 × 1 Photosystem I P700 chlorophyll a apoprotein A2 × 1 Photosystem I iron-sulfur center × 1 （P10793） Uncharacterized protein × 1 （I1NGD2） Putative uncharacterized protein × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Photosystem I reaction center subunit V, chloroplastic × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit IX × 1 （A4GGC6） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） Putative uncharacterized protein × 1 （E1C9L1） Chlorophyll a-b binding protein 6, chloroplastic × 1 Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 CHLOROPHYLL A × 142 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 26 IRON/SULFUR CLUSTER × 3 heptyl 1-thio-beta-D-glucopyranoside × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 CHLOROPHYLL B × 12 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 water × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAI_PEA
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–30； UniProt 2–31 Author chain i； PDBConstruct 1–30； UniProt 2–31

Photosystem I reaction center subunit IX

OrganismNot specified

UniProt A4GGC6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Photosystem I P700 chlorophyll a apoprotein A1 × 1 Photosystem I P700 chlorophyll a apoprotein A2 × 1 Photosystem I iron-sulfur center × 1 （P10793） Uncharacterized protein × 1 （I1NGD2） Putative uncharacterized protein × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Photosystem I reaction center subunit V, chloroplastic × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） Putative uncharacterized protein × 1 （E1C9L1） Chlorophyll a-b binding protein 6, chloroplastic × 1 Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 CHLOROPHYLL A × 143 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 6 BETA-CAROTENE × 26 IRON/SULFUR CLUSTER × 3 heptyl 1-thio-beta-D-glucopyranoside × 3 DODECYL-BETA-D-MALTOSIDE × 1 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 CHLOROPHYLL B × 12 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 water × 11	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 16	Photosystem I P700 chlorophyll a apoprotein A1 × 1 Photosystem I P700 chlorophyll a apoprotein A2 × 1 Photosystem I iron-sulfur center × 1 （P10793） Uncharacterized protein × 1 （I1NGD2） Putative uncharacterized protein × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Photosystem I reaction center subunit V, chloroplastic × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） Putative uncharacterized protein × 1 （E1C9L1） Chlorophyll a-b binding protein 6, chloroplastic × 1 Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 CHLOROPHYLL A × 142 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 26 IRON/SULFUR CLUSTER × 3 heptyl 1-thio-beta-D-glucopyranoside × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 CHLOROPHYLL B × 12 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 water × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAJ_PHAVU
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–39； UniProt 1–39 Author chain j； PDBConstruct 1–39； UniProt 1–39

Photosystem I reaction center subunit X psaK

OrganismNot specified

UniProt E1C9L3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Photosystem I P700 chlorophyll a apoprotein A1 × 1 Photosystem I P700 chlorophyll a apoprotein A2 × 1 Photosystem I iron-sulfur center × 1 （P10793） Uncharacterized protein × 1 （I1NGD2） Putative uncharacterized protein × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Photosystem I reaction center subunit V, chloroplastic × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （A4GGC6） Putative uncharacterized protein × 1 （E1C9L1） Chlorophyll a-b binding protein 6, chloroplastic × 1 Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 CHLOROPHYLL A × 143 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 6 BETA-CAROTENE × 26 IRON/SULFUR CLUSTER × 3 heptyl 1-thio-beta-D-glucopyranoside × 3 DODECYL-BETA-D-MALTOSIDE × 1 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 CHLOROPHYLL B × 12 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 water × 11	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 16	Photosystem I P700 chlorophyll a apoprotein A1 × 1 Photosystem I P700 chlorophyll a apoprotein A2 × 1 Photosystem I iron-sulfur center × 1 （P10793） Uncharacterized protein × 1 （I1NGD2） Putative uncharacterized protein × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Photosystem I reaction center subunit V, chloroplastic × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （A4GGC6） Putative uncharacterized protein × 1 （E1C9L1） Chlorophyll a-b binding protein 6, chloroplastic × 1 Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 CHLOROPHYLL A × 142 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 26 IRON/SULFUR CLUSTER × 3 heptyl 1-thio-beta-D-glucopyranoside × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 CHLOROPHYLL B × 12 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 water × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E1C9L3_PEA
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–84； UniProt 1–84 Author chain k； PDBConstruct 1–84； UniProt 1–84

Putative uncharacterized protein

OrganismNot specified

UniProt E1C9L1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Photosystem I P700 chlorophyll a apoprotein A1 × 1 Photosystem I P700 chlorophyll a apoprotein A2 × 1 Photosystem I iron-sulfur center × 1 （P10793） Uncharacterized protein × 1 （I1NGD2） Putative uncharacterized protein × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Photosystem I reaction center subunit V, chloroplastic × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （A4GGC6） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） Chlorophyll a-b binding protein 6, chloroplastic × 1 Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 CHLOROPHYLL A × 143 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 6 BETA-CAROTENE × 26 IRON/SULFUR CLUSTER × 3 heptyl 1-thio-beta-D-glucopyranoside × 3 DODECYL-BETA-D-MALTOSIDE × 1 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 CHLOROPHYLL B × 12 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 water × 11	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 16	Photosystem I P700 chlorophyll a apoprotein A1 × 1 Photosystem I P700 chlorophyll a apoprotein A2 × 1 Photosystem I iron-sulfur center × 1 （P10793） Uncharacterized protein × 1 （I1NGD2） Putative uncharacterized protein × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Photosystem I reaction center subunit V, chloroplastic × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （A4GGC6） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） Chlorophyll a-b binding protein 6, chloroplastic × 1 Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 CHLOROPHYLL A × 142 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 26 IRON/SULFUR CLUSTER × 3 heptyl 1-thio-beta-D-glucopyranoside × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 CHLOROPHYLL B × 12 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 water × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E1C9L1_PEA
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–153； UniProt 4–156 Author chain l； PDBConstruct 1–153； UniProt 4–156

Type II chlorophyll a/b binding protein from photosystem I

OrganismNot specified

UniProt Q41038

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Photosystem I P700 chlorophyll a apoprotein A1 × 1 Photosystem I P700 chlorophyll a apoprotein A2 × 1 Photosystem I iron-sulfur center × 1 （P10793） Uncharacterized protein × 1 （I1NGD2） Putative uncharacterized protein × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Photosystem I reaction center subunit V, chloroplastic × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （A4GGC6） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） Putative uncharacterized protein × 1 （E1C9L1） Chlorophyll a-b binding protein 6, chloroplastic × 1 Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 CHLOROPHYLL A × 143 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 6 BETA-CAROTENE × 26 IRON/SULFUR CLUSTER × 3 heptyl 1-thio-beta-D-glucopyranoside × 3 DODECYL-BETA-D-MALTOSIDE × 1 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 CHLOROPHYLL B × 12 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 water × 11	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 16	Photosystem I P700 chlorophyll a apoprotein A1 × 1 Photosystem I P700 chlorophyll a apoprotein A2 × 1 Photosystem I iron-sulfur center × 1 （P10793） Uncharacterized protein × 1 （I1NGD2） Putative uncharacterized protein × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Photosystem I reaction center subunit V, chloroplastic × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （A4GGC6） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） Putative uncharacterized protein × 1 （E1C9L1） Chlorophyll a-b binding protein 6, chloroplastic × 1 Chlorophyll a-b binding protein 3, chloroplastic × 1 （Q32904） Chlorophyll a-b binding protein P4, chloroplastic × 1 CHLOROPHYLL A × 142 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 26 IRON/SULFUR CLUSTER × 3 heptyl 1-thio-beta-D-glucopyranoside × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 CHLOROPHYLL B × 12 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 water × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q41038_PEA
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain 2； PDBConstruct 1–206； UniProt 62–267 Author chain 7； PDBConstruct 1–206； UniProt 62–267

Chlorophyll a-b binding protein 3, chloroplastic

OrganismNot specified

UniProt Q32904

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Photosystem I P700 chlorophyll a apoprotein A1 × 1 Photosystem I P700 chlorophyll a apoprotein A2 × 1 Photosystem I iron-sulfur center × 1 （P10793） Uncharacterized protein × 1 （I1NGD2） Putative uncharacterized protein × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Photosystem I reaction center subunit V, chloroplastic × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （A4GGC6） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） Putative uncharacterized protein × 1 （E1C9L1） Chlorophyll a-b binding protein 6, chloroplastic × 1 Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） Chlorophyll a-b binding protein P4, chloroplastic × 1 CHLOROPHYLL A × 143 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 6 BETA-CAROTENE × 26 IRON/SULFUR CLUSTER × 3 heptyl 1-thio-beta-D-glucopyranoside × 3 DODECYL-BETA-D-MALTOSIDE × 1 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 3 CHLOROPHYLL B × 12 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 water × 11	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 16	Photosystem I P700 chlorophyll a apoprotein A1 × 1 Photosystem I P700 chlorophyll a apoprotein A2 × 1 Photosystem I iron-sulfur center × 1 （P10793） Uncharacterized protein × 1 （I1NGD2） Putative uncharacterized protein × 1 Photosystem I reaction center subunit III, chloroplastic × 1 Photosystem I reaction center subunit V, chloroplastic × 1 Putative uncharacterized protein × 1 Photosystem I reaction center subunit VIII × 1 （P17227） Photosystem I reaction center subunit IX × 1 （A4GGC6） Photosystem I reaction center subunit X psaK × 1 （E1C9L3） Putative uncharacterized protein × 1 （E1C9L1） Chlorophyll a-b binding protein 6, chloroplastic × 1 Type II chlorophyll a/b binding protein from photosystem I × 1 （Q41038） Chlorophyll a-b binding protein P4, chloroplastic × 1 CHLOROPHYLL A × 142 PHYLLOQUINONE × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 5 BETA-CAROTENE × 26 IRON/SULFUR CLUSTER × 3 heptyl 1-thio-beta-D-glucopyranoside × 3 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 1 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 CHLOROPHYLL B × 12 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 5 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 4 water × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CB23_PEA
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain 3； PDBConstruct 1–218； UniProt 55–272 Author chain 8； PDBConstruct 1–218； UniProt 55–272

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4xk8
Deposition date deposition_date	2015-01-10
Structure title title	Crystal structure of plant photosystem I-LHCI super-complex at 2.8 angstrom resolution
Keywords keywords	photosynthesis, photosystem i, plant LHCI-PSI supercomplex; PHOTOSYNTHESIS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4xk8__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4xk8__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4xk8__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	51.25 Å
Rg (electron density)	50.52 Å
Total Rg	50.65 Å
Atom count	35367
Residues	3174
Excluded volume	660490 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4xk8__assembly_1__model_1`	hexadecameric （16）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4xk8__assembly_2__model_1`	hexadecameric （16）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (29)

Entity 1 Entity 1 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	82408.3 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,a
Atom count atom_count	71157

EVKILVDRDPIKTSFEQWAKPGHFSRTIAKGPDTTTWIWNLHADAHDFDSHTSDLEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLNDPTHIKPSAQVVWPIVGQEILNGDVGGGFRGIQITSGFFQIWRASGITSELQLYCTAIGALVFAGLMLFAGWFHYHKAAPKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQVHVSLPINQFLNAGVDPKEIPLPHEFILNRDLLAQLYPSFAEGATPFFTLNWSKYADFLTFRGGLDPLTGGLWLTDIAHHHLAIAILFLIAGHMYRTNWGIGHGIKDILEAHKGPFTGQGHKGLYEILTTSWHAQLSINLAMLGSLTIVVAQHMYSMPPYPYLATDYATQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRYNDLLDRVLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDTAIQLQPVFAQWIQNTHALAPGTTAPGATASTSLTWGGGDLVAVGGKVALLPIPLGTADFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSISVVIFHFSWKMQSDVWGTINDQGVVTHITAGNFAQSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPATQPRALSIVQGRAVGVTHYLLGGIATTWAFFLARIIAVG

Entity 2 Entity 2 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2
Molecular weight formula_weight	82466.8 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,b

ALRFPRFSQGIAQDPTTRRIWFGIATAHDFESHDDITEGRLYQNIFASHFGQLAIIFLWTSGNLFHVAWQGNFEAWVQDPFHVRPIAHAIWDPHFGQPAVEAFTRGGALGPVNNAYSGVYQWWYTIGLRTNEDLYTGAIFLLFLSFISLLAGWLHLQPKWKPSVSWFKNAESRLNHHLSGLFGVSSLAWAGHLVHVAIPGSRGEYVRWNNFLDVLPHPQGLGPLLTGQWNLYAQNPSSSNHLFGTTQGAGTAILTILGGFHPQTQSLWLTDMAHHHLAIAFLFLIGGHMYRTNFGIGHSIKYILEAHIPPGGRLGRGHKGLYDTINNSIHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQDFTTQAALYTHHQYIAGFIMTGAFAHGPIFFIRDYNPEQNADNVLARMLEHKEAIISHLSWASLFLGFHTLGLYVHNDVMLAFGTPEKQILIEPIFAQWIQSAHGKTTYGFDVLLSSTNGPALNAGRNIWLPGWLNAINENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWRGNVSQFNESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETLAWAHERTPLANLIRWRDKPVALSIVQARLVGLVHFSVGYIFTYAAFLIASTSGKFG

Entity 3 Entity 3 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8860.3 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,c

SHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY

Entity 4 Entity 4 polymer

Description description	Uncharacterized protein
Molecular weight formula_weight	15853.1 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,d

TPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWDSPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRQGVGQNFRSIGKNVSPIEVKFTGKQPYDL

Entity 5 Entity 5 polymer

Description description	Putative uncharacterized protein
Molecular weight formula_weight	7299.2 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,e

IGPKRGAKVKILRKESYWYKGTGSVVAVDQDPNTRYPVVVRFNKVNYANVSTNNYALDEIQEVE

Entity 6 Entity 6 polymer

Description description	Photosystem I reaction center subunit III, chloroplastic
Molecular weight formula_weight	17009.8 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,f

DISGLTPCKESKQFAKREKQALKKLQASLKLYADDSAPALAIKATMEKTKKRFDNYGKYGLLCGSDGLPHLIVSGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAIRDEKKPTQKEIIIDVPLASRLLFRGFSWPVAAYRELLNGELVD

Entity 7 Entity 7 polymer

Description description	Photosystem I reaction center subunit V, chloroplastic
Molecular weight formula_weight	10460.7 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,g

ELSPSLVISLSTGLSLFLGRFVFFNFQRENVAKQVPEQNGLTHFEAGDTRAKEYVSLLKSNDPVGFNIVDVLAWGSIGHIVAYYILATTSNGYDP

Entity 8 Entity 8 polymer

Description description	Putative uncharacterized protein
Molecular weight formula_weight	9639.9 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,h

SVYFDLEDLGNTTGQWDSYGSDAPSPYNPLQSKLFETFAAPFTKRGLLLKFLILGGGSTLAYLSATASGDILPITRGPQQPPKLGPRGKI

Entity 9 Entity 9 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	3296.0 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,i

INLPSLFVPLVGLLFPAVAMASLFLHVEKR

Entity 10 Entity 10 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	4402.2 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,j

MRDLKTYLSVAPVVSTLWFGALAGLLIEINRFFPDALIF

Entity 11 Entity 11 polymer

Description description	Photosystem I reaction center subunit X psaK
Molecular weight formula_weight	8462.8 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,k

DFIGSPTNLIMVTSTSLMLFAGRFGLAPSANRKATAGLKLEVRDSGLQTGDPAGFTLADTLACGVVGHIIGVGVVLGLKNIGAL

Entity 12 Entity 12 polymer

Description description	Putative uncharacterized protein
Molecular weight formula_weight	16130.5 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,l

YQVIQPINGDPFIGSLETPVTSSPLIAWYLSNLPAYRTAVSPLLRGIEVGLAHGYLLVGPFVKAGPLRNTEIAGQAGSLAAGGLVVILSLCLTIYGISSFNEGAPSTAPSLTLTGRKKEPDQLQTADGWAKFTGGFFFGGISGVIWAYFLLYV

Entity 13 Entity 13 polymer

Description description	Chlorophyll a-b binding protein 6, chloroplastic
Molecular weight formula_weight	21354.4 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,6

AHWMPGEPRPAYLDGSAPGDFGFDPLGLGEVPANLERYKESELIHCRWAMLAVPGILVPEALGYGNWVKAQEWAALPGGQATYLGNPVPWGTLPTILAIEFLAIAFVEHQRSMEKDPEKKKYPGGAFDPLGYSKDPKKLEELKVKEIKNGRLALLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNIGDILIGF

Entity 14 Entity 14 polymer

Description description	Type II chlorophyll a/b binding protein from photosystem I
Molecular weight formula_weight	22693.7 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2,7

PDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLGSDPESLRWNVQAELVHSRWAMLGAAGIFIPEFLTKLGILNTPSWYTAGEQEYFTDTTTLFIVELVFIGWAEGRRWADILNPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSASPQKLKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFT

Entity 15 Entity 15 polymer

Description description	Chlorophyll a-b binding protein 3, chloroplastic
Molecular weight formula_weight	23725.0 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3,8

RPLWFASKQSLSYLDGSLPGDYGFDPLGLSDPEGTGGFIEPRWLAYGEVINGRFAMLGAVGAIAPEYLGKVGLIPQETALAWFQTGVIPPAGTYNYWADNYTLFVLEMALMGFAEHRRFQDWAKPGSMGKQYFLGLEKGFGGSGNPAYPGGPFFNPLGFGKDEKSLKELKLKEVKNGRLAMLAILGYFIQGLVTGVGPYQNLLDHVADPVNNNVLTSL

Entity 16 Entity 16 polymer

Description description	Chlorophyll a-b binding protein P4, chloroplastic
Molecular weight formula_weight	21719.7 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4,9

GEWLPGLASPGYLTGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGIINVPKWYAAGKEEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPAGEVGYPGGIFNPLNFAPTLEAKEKEIANGRLAMLAFLGFIIQHNVTGKGPFDNLLQHISDPWHNTIVQTL

Entity 17 Entity 17 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	285

Entity 18 Entity 18 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 19 Entity 19 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	11

Entity 20 Entity 20 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	52

Entity 21 Entity 21 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 22 Entity 22 non-polymer

Description description	heptyl 1-thio-beta-D-glucopyranoside
Molecular weight formula_weight	294.4 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 23 Entity 23 non-polymer

Description description	DODECYL-BETA-D-MALTOSIDE
Molecular weight formula_weight	510.6 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 24 Entity 24 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 25 Entity 25 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 26 Entity 26 non-polymer

Description description	CHLOROPHYLL B
Molecular weight formula_weight	907.5 kDa
Source method src_method	syn
Copy count entity_count	24

Entity 27 Entity 27 non-polymer

Description description	(3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 28 Entity 28 non-polymer

Description description	;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 29 Entity 29 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	185

▼

6. Fold Classification (SCOP + CATH) 29 domains

SCOP 2.08 (15 domains)

Domain ID domain_id	d4xk81_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d4xk82_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d4xk83_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d4xk84_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d4xk86_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d4xk87_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d4xk88_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d4xk89_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d4xk8a_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.29 — Photosystem I subunits PsaA/PsaB
Superfamily Superfamily superfamily	f.29.1 — Photosystem I subunits PsaA/PsaB
Family Family family	f.29.1.1 — Photosystem I subunits PsaA/PsaB

Domain ID domain_id	d4xk8b_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.29 — Photosystem I subunits PsaA/PsaB
Superfamily Superfamily superfamily	f.29.1 — Photosystem I subunits PsaA/PsaB
Family Family family	f.29.1.1 — Photosystem I subunits PsaA/PsaB

Domain ID domain_id	d4xk8c_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.1 — 4Fe-4S ferredoxins
Family Family family	d.58.1.2 — 7-Fe ferredoxin

Domain ID domain_id	d4xk8d_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.187 — Photosystem I subunit PsaD
Superfamily Superfamily superfamily	d.187.1 — Photosystem I subunit PsaD
Family Family family	d.187.1.1 — Photosystem I subunit PsaD

Domain ID domain_id	d4xk8e_
Class class	b — All beta proteins
Fold Fold fold	b.34 — SH3-like barrel
Superfamily Superfamily superfamily	b.34.4 — Electron transport accessory proteins
Family Family family	b.34.4.0 — automated matches

Domain ID domain_id	d4xk8f_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.16 — Subunit III of photosystem I reaction centre, PsaF
Family Family family	f.23.16.0 — automated matches

Domain ID domain_id	d4xk8j_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.18 — Subunit IX of photosystem I reaction centre, PsaJ
Family Family family	f.23.18.0 — automated matches

CATH v4.4 (14 domains)

Domain ID domain_id	4xk8A00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1130 — Photosystem I p700 chlorophyll A apoprotein A1
Homologous superfamily homologous superfamily	10 — Photosystem I PsaA/PsaB

Domain ID domain_id	4xk8B00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1130 — Photosystem I p700 chlorophyll A apoprotein A1
Homologous superfamily homologous superfamily	10 — Photosystem I PsaA/PsaB

Domain ID domain_id	4xk8C00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	4xk8D00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1470 — Photosystem 1 Reaction Centre Subunit Ii; Chain: D;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaD, reaction center subunit II

Domain ID domain_id	4xk8E00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	50 —

Domain ID domain_id	4xk8F00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	8 — Helicase, Ruva Protein; domain 3
Homologous superfamily homologous superfamily	110 — Photosystem I, reaction centre, subunit PsaF

Domain ID domain_id	4xk8L00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1240 — Photosystem 1 Reaction Centre Subunit Xi; Chain: L;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaL, reaction centre subunit XI

Domain ID domain_id	4xk8a00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1130 — Photosystem I p700 chlorophyll A apoprotein A1
Homologous superfamily homologous superfamily	10 — Photosystem I PsaA/PsaB

Domain ID domain_id	4xk8b00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1130 — Photosystem I p700 chlorophyll A apoprotein A1
Homologous superfamily homologous superfamily	10 — Photosystem I PsaA/PsaB

Domain ID domain_id	4xk8c00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	4xk8d00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1470 — Photosystem 1 Reaction Centre Subunit Ii; Chain: D;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaD, reaction center subunit II

Domain ID domain_id	4xk8e00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	50 —

Domain ID domain_id	4xk8f00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	8 — Helicase, Ruva Protein; domain 3
Homologous superfamily homologous superfamily	110 — Photosystem I, reaction centre, subunit PsaF

Domain ID domain_id	4xk8l00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1240 — Photosystem 1 Reaction Centre Subunit Xi; Chain: L;
Homologous superfamily homologous superfamily	10 — Photosystem I PsaL, reaction centre subunit XI

▶

Unit-cell length a length_a	165.624 Å
Unit-cell length b length_b	192.220 Å
Unit-cell length c length_c	175.089 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	91.41 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.800 Å
Low-resolution limit resolution_low	49.147 Å
R factor r_factor	0.2123
R_work r_work	0.2105
R_free r_free	0.2476

Crystal structure of plant photosystem I-LHCI super-complex at 2.8 angstrom resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Uncharacterized protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit X psaK

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Putative uncharacterized protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Type II chlorophyll a/b binding protein from photosystem I

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chlorophyll a-b binding protein 3, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4xk8__assembly_2__model_1

4xk8__assembly_2__model_1 | I(q)

4xk8__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (29)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer